HHsearch alignment for GI: 254780696 and conserved domain: PRK05294

>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed.
Probab=98.62  E-value=1.5e-05  Score=56.79  Aligned_cols=283  Identities=16%  Similarity=0.220  Sum_probs=146.0

Q ss_pred             CCCEEEEEECCHHHCCCC---CCCHHHHHHHHHHCCCEEEEEEHHHEEEECCEEEEEEEEEEEECCCCCEEEECCCCCCC
Q ss_conf             533189970998884847---64679999999988988999954124899989999999999807774126504644352
Q gi|254780696|r    3 KIRNIAIQMNHISTVKVK---EDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIID   79 (316)
Q Consensus         3 k~~kI~fimDpi~~i~~~---~DTT~~Lm~eAq~RGheV~~~~~~dL~~~~g~v~A~~~~i~i~~~~~~~f~~~~~~~~~   79 (316)
T Consensus         6 ~ikkvLviGsGp~~IGqa~EfDysg~qa~~al~e~g~~vilvN~NpaTv~Td~~~ad~vY~--ePlt~e~v----~~Ii~   79 (1063)
T PRK05294          6 DIKKILIIGSGPIVIGQACEFDYSGTQACKALREEGYRVVLVNSNPATIMTDPEMADATYI--EPITPEFV----EKIIE   79 (1063)
T ss_pred             CCCEEEEECCCCCHHCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHCCCCCCCCEEEE--CCCCHHHH----HHHHH
T ss_conf             8788999898825103723326569999999998699899987985441078776643787--27989999----99999


Q ss_pred             HHHCCEEEEECCCCCCHHHHHHHHHHHHH---C-CCCEEE-CCHHHHHHCCCHH-HHH---HHHHHCCCCEEECCHHHHH
Q ss_conf             10063668832886224799999999862---3-585041-1748875256503-433---4543044310003724556
Q gi|254780696|r   80 LSQMDVILIRQDPPFNMHYITSTYLLEKI---N-PETLIV-NNPFWIRNSPEKI-FVT---EFSELMPPTLISRDITQIT  150 (316)
Q Consensus        80 L~~fD~i~iR~dPp~d~~yi~~~~~Le~~---~-~~~~vi-N~p~~i~~~~eKl-~~~---~~~~~~P~T~vt~~~~~~~  150 (316)
T Consensus        80 ~E~Pd~il~~~G---GQtaLnla~~L~~~GiL~~~~v~lLGt~~~~I~~aedR~~F~~~l~~i~~p~~~s~~~~s~~ea~  156 (1063)
T PRK05294         80 KERPDAILPTMG---GQTALNLALELAESGVLEKYGVELIGAKLEAIDKAEDRELFKEAMKKIGLPVPRSGIAHTMEEAL  156 (1063)
T ss_pred             HHCCCEEEECCC---CHHHHHHHHHHHHCCCHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCHHCCCHHHHH
T ss_conf             759997886677---80599999999975967764972756999999977789999999997699999725309999999


Q ss_pred             HHHHHHH-HHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHC-CCCCCEEECCCCCCCCCEEEEEE-CCE----EEEE
Q ss_conf             8888521-433111688543446874488711588999998400-13340021053445682699998-998----8632
Q gi|254780696|r  151 RFYLEMK-DIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKY-PEPLMIQSYLPQIRDGDKRILLL-NGK----PVGA  223 (316)
Q Consensus       151 ~f~~~~~-~vViKPl~g~~G~gV~~i~~~~~~~~~~~e~~~~~~-~~~ii~Qefi~~~~~gD~Rv~vi-~g~----~v~a  223 (316)
T Consensus       157 ~~a~~igyPvivRps~~LGG~g~~-i~~n~~eL~~~~~~~~~~S~~~qvLie~sl~gwk--Eie~ev~rD~~~n~i~v~~  233 (1063)
T PRK05294        157 EVAEEIGYPVIIRPSFTLGGTGGG-IAYNREELEEIVERGLDLSPTTEVLIEESLLGWK--EYEMEVMRDKADNCIIVCS  233 (1063)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCE-EECCHHHHHHHHHHHHHHCCCCCEEEEHHCCCCE--EEEEEEEEECCCCEEEEEE
T ss_conf             999865998899844216787640-4349999999999999619998689661117988--9999999818999899954


Q ss_pred             EEEECCCCCCCCCCCCCCCEEE---EECCHHHHH----HHHHHHHHHHHCCCE--EEEEEE-E---C--CEEEEEECCCC
Q ss_conf             1220456860000001473111---007789999----999999999984987--999951-1---7--87889836883
Q gi|254780696|r  224 VNRIPSEVDNRSNIHAGGKAEL---TKLTKIDLD----ICKRIGESLRERGLF--FTGIDV-I---G--DYITEINVTSP  288 (316)
Q Consensus       224 ~~R~~~~~~~r~Nl~~Gg~~~~---~~lt~~~~~----i~~~~~~~L~~~gl~--~~GiDi-i---g--~~i~EvNvtsP  288 (316)
T Consensus       234 mEnidp-----~GIHtGDSi~vaP~qTL~d~e~q~lR~~a~kI~~~L---~iv~G~~NiQfA~~p~~~~~~VIEvN---P  302 (1063)
T PRK05294        234 IENIDP-----MGVHTGDSITVAPAQTLTDKEYQMLRDASIAILREI---GVETGGSNVQFAVNPKDGRYVVIEMN---P  302 (1063)
T ss_pred             ECCCCC-----CCCCCCCCCEECCCCCCCHHHHHHHHHHHHHHHHHC---CCCCCCEEEEEEECCCCCCEEEEECC---C
T ss_conf             113545-----645666725356886589899999999999999982---95736447999874899848999637---7


Q ss_pred             HHHH---HHHHHCCCCHHHHHHH
Q ss_conf             0378---8997519998999999
Q gi|254780696|r  289 TCIR---EIHRNGGENVASLFWD  308 (316)
Q Consensus       289 ~g~~---~~~~~~~~~i~~~i~d  308 (316)
T Consensus       303 R~SRssalaSKaTGyPiA~vaak  325 (1063)
T PRK05294        303 RVSRSSALASKATGYPIAKVAAK  325 (1063)
T ss_pred             CCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             50010688888738878999999