HHsearch alignment for GI: 254780696 and conserved domain: PRK05294

>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed.
Probab=98.52  E-value=2e-05  Score=55.97  Aligned_cols=263  Identities=16%  Similarity=0.259  Sum_probs=153.2

Q ss_pred             CCHHHHHHHHHHCCCEEEEEEHHHEEEECCEEEEEEEEEEEECCCCCEEEECCCC----CCCHHHCCEEEEECCCCCCHH
Q ss_conf             4679999999988988999954124899989999999999807774126504644----352100636688328862247
Q gi|254780696|r   22 DSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEK----IIDLSQMDVILIRQDPPFNMH   97 (316)
Q Consensus        22 DTT~~Lm~eAq~RGheV~~~~~~dL~~~~g~v~A~~~~i~i~~~~~~~f~~~~~~----~~~L~~fD~i~iR~dPp~d~~   97 (316)
T Consensus       574 Y~~v~a~~alk~~G~~~imIN~NPETVSTD----------~d~sDrLYFEplt~E~V~~I~~~E~p~gvi~q------fG  637 (1063)
T PRK05294        574 YCCVHAALALREAGYETIMVNCNPETVSTD----------YDTSDRLYFEPLTLEDVLEIIEKEKPKGVIVQ------FG  637 (1063)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCCCCCC----------CCCCCEEEECCCCHHHHHHHHHHHCCCEEEEE------CC
T ss_conf             679999999996598158953781111156----------56676145436889999999997589879997------38


Q ss_pred             HHHHHHHHHHHC-CCCEEE-CCHHHHHHCCCHHHHHHHH----HHCCCCEEECCHHHHHHHHHHHH-HHHHHCCCCCCCC
Q ss_conf             999999998623-585041-1748875256503433454----30443100037245568888521-4331116885434
Q gi|254780696|r   98 YITSTYLLEKIN-PETLIV-NNPFWIRNSPEKIFVTEFS----ELMPPTLISRDITQITRFYLEMK-DIIIKPLYGNGGT  170 (316)
Q Consensus        98 yi~~~~~Le~~~-~~~~vi-N~p~~i~~~~eKl~~~~~~----~~~P~T~vt~~~~~~~~f~~~~~-~vViKPl~g~~G~  170 (316)
T Consensus       638 GQt~~nla~~L~~~g~~ilGts~~~Id~aEDR~~F~~~l~~l~i~qp~~~~a~s~~ea~~~a~~iGyPvlvRPSyVLGG~  717 (1063)
T PRK05294        638 GQTPLKLAKALEAAGVPILGTSPDAIDLAEDRERFQKLLEKLGIKQPPNGTATSVEEALEIAEEIGYPVLVRPSYVLGGR  717 (1063)
T ss_pred             CCCHHHHHHHHHHCCCCEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEECCHHHHHHHHHHCCCCEEECCCCCCCCC
T ss_conf             83678999999987994777887887878758889999986599999970766899999999864986684343102577


Q ss_pred             CEEEECCCCCCHHHHHHHHHHHC-CCCCCEEECCCCCCCCCEEEEEECCE-E-EE-EEEEECCCCCCCCCCCCCCCEE--
Q ss_conf             46874488711588999998400-13340021053445682699998998-8-63-2122045686000000147311--
Q gi|254780696|r  171 GVFRITLGDRNFSSLIEMLFEKY-PEPLMIQSYLPQIRDGDKRILLLNGK-P-VG-AVNRIPSEVDNRSNIHAGGKAE--  244 (316)
Q Consensus       171 gV~~i~~~~~~~~~~~e~~~~~~-~~~ii~Qefi~~~~~gD~Rv~vi~g~-~-v~-a~~R~~~~~~~r~Nl~~Gg~~~--  244 (316)
T Consensus       718 ~M~iv-~~~~eL~~yl~~a~~vs~~~pvlIdkfl~ga~E~eVDai~-Dg~~v~I~gImEHIE-----~AGVHSGDS~~V~  790 (1063)
T PRK05294        718 AMEIV-YDEEELERYMREAVKVSPDHPVLIDRFLEDAIEVDVDAIC-DGEDVLIGGIMEHIE-----EAGVHSGDSACSL  790 (1063)
T ss_pred             CEEEE-CCHHHHHHHHHHHHHHCCCCCEEEEHHHHHCHHHHHHEEE-CCCEEEEEEEEEECC-----CCCCCCCCCEEEE
T ss_conf             14785-6999999999999863899977863543202454430231-488489999872001-----4575667842881


Q ss_pred             -EEECCHHHH----HHHHHHHHHHHHCCCEEEEEEEE--CC--EEEEEECCCCHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             -100778999----99999999999849879999511--78--7889836883037889975199989999999
Q gi|254780696|r  245 -LTKLTKIDL----DICKRIGESLRERGLFFTGIDVI--GD--YITEINVTSPTCIREIHRNGGENVASLFWDG  309 (316)
Q Consensus       245 -~~~lt~~~~----~i~~~~~~~L~~~gl~~~GiDii--g~--~i~EvNvtsP~g~~~~~~~~~~~i~~~i~d~  309 (316)
T Consensus       791 Pp~~Ls~~~~~~i~~~t~~ia~~l~v~G~~--NiQf~vk~~~vyVIE~NpRaSRtvPfvSKatg~pl~~iAtk~  862 (1063)
T PRK05294        791 PPYTLSEEIIDEIREQTKKLALELNVVGLM--NVQFAVKDDEVYVIEVNPRASRTVPFVSKATGVPLAKIAARV  862 (1063)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCCCCC--EEEEEECCCEEEEEEECCCCCCCCHHHHHHCCCCHHHHHHHH
T ss_conf             685589999999999999999855666642--033554098389999447444530445764199799999999