HHsearch alignment for GI: 254780696 and conserved domain: PRK06524

>PRK06524 biotin carboxylase-like protein; Validated.
Probab=96.70  E-value=0.01  Score=38.18  Aligned_cols=159  Identities=19%  Similarity=0.397  Sum_probs=98.1

Q ss_pred             CCEEECCHHHHHH-CCCHHHHHHHHH-----HCCCCEE-ECCHHHHHHHHHHHH---HHHHHCCCCCCCCCEEEECCCCC
Q ss_conf             8504117488752-565034334543-----0443100-037245568888521---43311168854344687448871
Q gi|254780696|r  111 ETLIVNNPFWIRN-SPEKIFVTEFSE-----LMPPTLI-SRDITQITRFYLEMK---DIIIKPLYGNGGTGVFRITLGDR  180 (316)
Q Consensus       111 ~~~viN~p~~i~~-~~eKl~~~~~~~-----~~P~T~v-t~~~~~~~~f~~~~~---~vViKPl~g~~G~gV~~i~~~~~  180 (316)
T Consensus       112 Gl~v~~P~a~LR~~ldsKi~t~Rlgn~AGvpsVPnvl~~v~sY~~L~~~~~~aglG~DLVvQt~~GdsG~tTFFi~-~e~  190 (480)
T PRK06524        112 GLEVMHPPAELRHRLDSKIVMTRLADEAGVPSVPHVIGRVDSYEELSALAHEAGLGDDLVVQTAYGDAGSTTFFVR-GER  190 (480)
T ss_pred             CCCEECCHHHHHHHHCCEEEEEEECCCCCCCCCCCEEECCCCHHHHHHHHHHCCCCCCEEEECCCCCCCCEEEEEE-CHH
T ss_conf             9727558299997743611467521115887676300035669999999887088863588425678874169972-565


Q ss_pred             CHHHHHHHHHHHCCCCCCEEECCCCCCCCCEEE------EEECCEEEE-EEE-------EECCCCCCCCCCCCCCCEEEE
Q ss_conf             158899999840013340021053445682699------998998863-212-------204568600000014731110
Q gi|254780696|r  181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRI------LLLNGKPVG-AVN-------RIPSEVDNRSNIHAGGKAELT  246 (316)
Q Consensus       181 ~~~~~~e~~~~~~~~~ii~Qefi~~~~~gD~Rv------~vi~g~~v~-a~~-------R~~~~~~~r~Nl~~Gg~~~~~  246 (316)
T Consensus       191 D~~k--------~a~eIvge~eiKiMKRI~~~~~aiEac~T~~GTivgP~MTelvGf~ELTPykGgWCGN-----ei~~~  257 (480)
T PRK06524        191 DWDK--------YAGEIVGQPEIKVMKRIRNVEVCIEACVTRHGTVIGPAMTSLVGYPELTPYRGAWCGN-----DIWRG  257 (480)
T ss_pred             HHHH--------HHHHHHCCCHHHHHHHHCCCCCCEEEEECCCCEEECHHHHHHCCCCCCCCCCCCCCCC-----CCCCC
T ss_conf             6767--------5776406631534434247641111220038736324677542841167667764355-----45502


Q ss_pred             ECCHHH----HHHHHHHHHHHHHCCC--EEEEEEEE-----CC-EEEEEE
Q ss_conf             077899----9999999999998498--79999511-----78-788983
Q gi|254780696|r  247 KLTKID----LDICKRIGESLRERGL--FFTGIDVI-----GD-YITEIN  284 (316)
Q Consensus       247 ~lt~~~----~~i~~~~~~~L~~~gl--~~~GiDii-----g~-~i~EvN  284 (316)
T Consensus       258 ~~~p~~r~kare~~~k~Gd~L~~eGYrGyFe-vDfLiD~dt~evyLGElN  306 (480)
T PRK06524        258 ALPPAQTRAAREMVAKLGDVLSREGYRGYFE-VDLLHDLDADELYLGEVN  306 (480)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCEEE-EEEEEECCCCCEEEECCC
T ss_conf             2891366999999999879987445663589-999885577847540367