HHsearch alignment for GI: 254780696 and conserved domain: PRK07206

>PRK07206 hypothetical protein; Provisional.
Probab=99.60  E-value=2e-12  Score=101.80  Aligned_cols=283  Identities=16%  Similarity=0.145  Sum_probs=162.5

Q ss_pred             CCEEEEEECCHHHCCCCCCCHHHHHHHHHHCCCEEEEEEHHHEEEECCEEEEEEEEEEEECCC--CCEEEEC-CCCCCCH
Q ss_conf             331899709988848476467999999998898899995412489998999999999980777--4126504-6443521
Q gi|254780696|r    4 IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK--EQYYSLG-EEKIIDL   80 (316)
Q Consensus         4 ~~kI~fimDpi~~i~~~~DTT~~Lm~eAq~RGheV~~~~~~dL~~~~g~v~A~~~~i~i~~~~--~~~f~~~-~~~~~~L   80 (316)
T Consensus         1 ~~~~vviVDp~S-------tG~~la~a~~~~G~~~v~V~S~~~-~~--~~~~----~~f~~~~~~~~~~~~~~~~~~~~~   66 (415)
T PRK07206          1 MMKKVVIVDPFS-------SGKFLAPAFKKRGIELIAVTSACD-LD--PLYY----AGFDENIYRQQRIIKHIDETIEFL   66 (415)
T ss_pred             CCCEEEEECCCC-------CHHHHHHHHHHCCCEEEEEEECCC-CC--HHHH----CCCCHHHHHHHHCCCCHHHHHHHH
T ss_conf             985599986765-------187999999973982899983798-84--3544----232434343321057899999999


Q ss_pred             H--HCCEEEEECCCCCCHHHHHHHH-HHHHHCCCCEEECCHHHHHHCCCHHHHHHHHH----HCCCCEEECCHHHHHHHH
Q ss_conf             0--0636688328862247999999-99862358504117488752565034334543----044310003724556888
Q gi|254780696|r   81 S--QMDVILIRQDPPFNMHYITSTY-LLEKINPETLIVNNPFWIRNSPEKIFVTEFSE----LMPPTLISRDITQITRFY  153 (316)
Q Consensus        81 ~--~fD~i~iR~dPp~d~~yi~~~~-~Le~~~~~~~viN~p~~i~~~~eKl~~~~~~~----~~P~T~vt~~~~~~~~f~  153 (316)
T Consensus        67 ~~~~~~aVi~g-----~E~gV~lAd~La~~L--gLp~~N~~~~~~aRRdK~~m~~~L~~aGl~~~~~~~~~~~~e~~~~~  139 (415)
T PRK07206         67 RQLGPDAVIAG-----AESGVELADRLAERL--GLCYANAPALSSARRNKYEMINALANAGLPAIRQIDTADWEEASAWI  139 (415)
T ss_pred             HHCCCCEEEEC-----CHHHHHHHHHHHHHH--CCCCCCCHHHHHHHCCHHHHHHHHHHCCCCCCCEEECCCHHHHHHHH
T ss_conf             86297299978-----556599999999986--89989955688774599999999997599855388529999999999


Q ss_pred             HHHH----HHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHH------CCCCCCEEECCCCCCCCCEEEEEECCEE-EE
Q ss_conf             8521----43311168854344687448871158899999840------0133400210534456826999989988-63
Q gi|254780696|r  154 LEMK----DIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEK------YPEPLMIQSYLPQIRDGDKRILLLNGKP-VG  222 (316)
Q Consensus       154 ~~~~----~vViKPl~g~~G~gV~~i~~~~~~~~~~~e~~~~~------~~~~ii~Qefi~~~~~gD~Rv~vi~g~~-v~  222 (316)
T Consensus       140 ~~~~~~~~PvVvKP~~gagS~gV~~c~-~~~el~~a~~~i~~~~n~~g~~~~~vLveEyl~G~E-ysVe~vs~~G~h~v~  217 (415)
T PRK07206        140 RVNNLWDSPVVIKPLESAGSDGVFFCP-DKQDAYHAFNAILGKANKLGLVNESVLVQEFLIGTE-YVVNTVSINGNHLVT  217 (415)
T ss_pred             HHCCCCCCCEEEECCCCCCCCCEEEEC-CHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCE-EEEEEEEECCCEEEE
T ss_conf             860557999899589999879989979-999999999998566543578675388754146857-899999878968999


Q ss_pred             EEEEECCCCCCCCCCCCCCCEEEEECCH-HHHHHHHHHHHHHHHCCCEEEE--EEEE----CCEEEEEECCCCHHH--HH
Q ss_conf             2122045686000000147311100778-9999999999999984987999--9511----787889836883037--88
Q gi|254780696|r  223 AVNRIPSEVDNRSNIHAGGKAELTKLTK-IDLDICKRIGESLRERGLFFTG--IDVI----GDYITEINVTSPTCI--RE  293 (316)
Q Consensus       223 a~~R~~~~~~~r~Nl~~Gg~~~~~~lt~-~~~~i~~~~~~~L~~~gl~~~G--iDii----g~~i~EvNvtsP~g~--~~  293 (316)
T Consensus       218 ~i~~y~k~~-~~~~~~~~~~~~~~p~~~~~~~~l~~y~~~~l~ALGi~~G~~H~Ev~lt~~gp~liE~~~R~~G~~~~~~  296 (415)
T PRK07206        218 EIVRYHKTS-LNRGSVVYDYDELLPCTSPEYQELVDYTKKALDALGIKNGPAHAEIMLTSDGPVLIETGARLDGGLHPDA  296 (415)
T ss_pred             EEEEECCCC-CCCCCEEEECCEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCEEEEECCCCCCCCCHHH
T ss_conf             999972556-8998656532035699848999999999999998387757721899982898289996787789864789


Q ss_pred             HHHHCCCCHHHHHHHHH
Q ss_conf             99751999899999999
Q gi|254780696|r  294 IHRNGGENVASLFWDGI  310 (316)
Q Consensus       294 ~~~~~~~~i~~~i~d~i  310 (316)
T Consensus       297 ~~~~~g~~~~~~~v~~~  313 (415)
T PRK07206        297 ARVATGFSQLDLTAQSL  313 (415)
T ss_pred             HHHCCCCCHHHHHHHHH
T ss_conf             98705879999999985