HHsearch alignment for GI: 254780696 and conserved domain: PRK10446

>PRK10446 ribosomal protein S6 modification protein; Provisional.
Probab=100.00  E-value=0  Score=444.30  Aligned_cols=282  Identities=22%  Similarity=0.293  Sum_probs=247.4

Q ss_pred             CEEEEEECCHHHCCCCCCCHHHHHHHHHHCCCEEEEEEHHHEEEECCEEEEEEEEEEEECCCCCEEEECCCCCCCHHHCC
Q ss_conf             31899709988848476467999999998898899995412489998999999999980777412650464435210063
Q gi|254780696|r    5 RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMD   84 (316)
Q Consensus         5 ~kI~fimDpi~~i~~~~DTT~~Lm~eAq~RGheV~~~~~~dL~~~~g~v~A~~~~i~i~~~~~~~f~~~~~~~~~L~~fD   84 (316)
T Consensus         1 mki~iL-----s~~~~~yst~RL~eaa~~rGh~v~vidp~~~~~~i~------------~~~~~v~~~g----~~L~~~D   59 (300)
T PRK10446          1 MKIAIL-----SRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNIN------------PAASSIHYKG----RKLPHFD   59 (300)
T ss_pred             CEEEEE-----ECCCCCCHHHHHHHHHHHCCCEEEEEEHHHCEEEEC------------CCCCEEEECC----EECCCCC
T ss_conf             979999-----369976079999999998799599961489189824------------8986499898----0868788


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHCCCHHHHHHHHH----HCCCCEEECCHHHHHHHHHHH-H-H
Q ss_conf             668832886224799999999862358504117488752565034334543----044310003724556888852-1-4
Q gi|254780696|r   85 VILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSE----LMPPTLISRDITQITRFYLEM-K-D  158 (316)
Q Consensus        85 ~i~iR~dPp~d~~yi~~~~~Le~~~~~~~viN~p~~i~~~~eKl~~~~~~~----~~P~T~vt~~~~~~~~f~~~~-~-~  158 (316)
T Consensus        60 avipR~g~~~t~~~~~vLr~lE~~--Gv~viN~~~aI~~~~DKl~t~qlL~~~gip~P~T~~~~~~~~~~~~i~~~gg~P  137 (300)
T PRK10446         60 AVIPRIGTAITFYGTAALRQFEML--GSYPLNESVAIARARDKLRSMQLLARQGIDLPVTGIAHSPDDTSDLIDMVGGAP  137 (300)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHC--CCCEECCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHHCCCC
T ss_conf             899826777455899999999988--991864899999857699999999875979998898369999999999808997


Q ss_pred             HHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEECCCCCCCCCEEEEEECCEEEEEEEEECCCCCCCCCCC
Q ss_conf             33111688543446874488711588999998400133400210534456826999989988632122045686000000
Q gi|254780696|r  159 IIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIH  238 (316)
Q Consensus       159 vViKPl~g~~G~gV~~i~~~~~~~~~~~e~~~~~~~~~ii~Qefi~~~~~gD~Rv~vi~g~~v~a~~R~~~~~~~r~Nl~  238 (316)
T Consensus       138 vViKpl~Gs~G~GV~l~e-~~~~~~~i~~~~~~~-~~~~~iQeyI~~~~g~D~Rv~vvgg~vvaam~R~~~~g~~rtN~~  215 (300)
T PRK10446        138 LVVKLVEGTQGIGVVLAE-TRQAAESVIDAFRGL-NAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLH  215 (300)
T ss_pred             EEEEECCCCCCCCEEEEE-CHHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCEEEEEECCEEHHHEEEECCCCCEEEEEE
T ss_conf             899967898860369973-789999999988622-873775220255579867999999862443899737883477770


Q ss_pred             CCCCEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEEEE----CCEEEEEECCCCHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             14731110077899999999999999849879999511----78788983688303788997519998999999998863
Q gi|254780696|r  239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVI----GDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIK  314 (316)
Q Consensus       239 ~Gg~~~~~~lt~~~~~i~~~~~~~L~~~gl~~~GiDii----g~~i~EvNvtsP~g~~~~~~~~~~~i~~~i~d~ie~~~  314 (316)
T Consensus       216 ~Gg~~~~~~l~~e~~~la~~a~~~l---gl~~~GVDii~~~~g~~v~EVN-~~P-g~~gi~~~tgvdiA~~Ii~~ie~~~  290 (300)
T PRK10446        216 RGGAASVASITPQEREIAIKAARTM---ALDVAGVDILRANRGPLVMEVN-ASP-GLEGIEKTTGIDIAGKMIRWIERHA  290 (300)
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHHH---CCCEEEEEEEEECCCCEEEEEC-CCH-HHHHHHHHHCCCHHHHHHHHHHHHC
T ss_conf             3977653289999999999999986---9968999998828998899993-874-2788988759898999999999767


Q ss_pred             CC
Q ss_conf             39
Q gi|254780696|r  315 ET  316 (316)
Q Consensus       315 ~~  316 (316)
T Consensus       291 ~~  292 (300)
T PRK10446        291 TT  292 (300)
T ss_pred             CC
T ss_conf             84