HHsearch alignment for GI: 254780696 and conserved domain: PRK13790

>PRK13790 phosphoribosylamine--glycine ligase; Provisional.
Probab=98.62  E-value=9.2e-06  Score=58.18  Aligned_cols=218  Identities=16%  Similarity=0.180  Sum_probs=131.5

Q ss_pred             HCCEEEEECCCCCCHHHHHHHHHHHHHC-CCCEEECCHH-HHHHCCCHHHHHHHHH----HCCCCEEECCHHHHHHHHHH
Q ss_conf             0636688328862247999999998623-5850411748-8752565034334543----04431000372455688885
Q gi|254780696|r   82 QMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPF-WIRNSPEKIFVTEFSE----LMPPTLISRDITQITRFYLE  155 (316)
Q Consensus        82 ~fD~i~iR~dPp~d~~yi~~~~~Le~~~-~~~~viN~p~-~i~~~~eKl~~~~~~~----~~P~T~vt~~~~~~~~f~~~  155 (316)
T Consensus        63 ~iDLvvvGPE~PL~-~G-----ivD~l~~~gi~vfGP~k~aA~LE~SK~faK~~m~~~~IPTa~~~~f~~~~~A~~~l~~  136 (415)
T PRK13790         63 NVDWVVIGPEQPLI-DG-----LADILRANGFKVFGPNKQAAQIEGSKLFAKKIMEKYNIPTADYKEVERKKDALTYIEN  136 (415)
T ss_pred             CCCEEEECCCHHHH-HH-----HHHHHHCCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHH
T ss_conf             99999989607866-34-----8888643897598949799515126999999999829797772550879999999861


Q ss_pred             HH-HHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHH-HCCCCCCEEECCCCCCCCCEEEEEE-CCEEEE---E----EE
Q ss_conf             21-4331116885434468744887115889999984-0013340021053445682699998-998863---2----12
Q gi|254780696|r  156 MK-DIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFE-KYPEPLMIQSYLPQIRDGDKRILLL-NGKPVG---A----VN  225 (316)
Q Consensus       156 ~~-~vViKPl~g~~G~gV~~i~~~~~~~~~~~e~~~~-~~~~~ii~Qefi~~~~~gD~Rv~vi-~g~~v~---a----~~  225 (316)
T Consensus       137 ~~~p~VIKaDGLAaGKGV~-V~~~~~eA~~al~~i~~~~~~g~VvIEE~L~---G~E~S~~a~~DG~~~~p~~~~aQDhK  212 (415)
T PRK13790        137 CELPVVVKKDGLAAGKGVI-IADTIEAARSAIEIMYGDEEEGTVVFETFLE---GEEFSLMTFVNGDLAVPFDCIAQDHK  212 (415)
T ss_pred             CCCCEEEECCCCCCCCCEE-EECCHHHHHHHHHHHHCCCCCCEEEEEEECC---CCCEEEEEEECCCEEEECCCCCCCCC
T ss_conf             7998899668667899569-9799999999999985555476599987157---86348999973997995775432120


Q ss_pred             EECCCCCCCCCCCCCCCEEEEE-CCHHH-----HHHHHHHHHHHHHCCCEEEEEEEE-------CCEEEEEECC--CCHH
Q ss_conf             2045686000000147311100-77899-----999999999999849879999511-------7878898368--8303
Q gi|254780696|r  226 RIPSEVDNRSNIHAGGKAELTK-LTKID-----LDICKRIGESLRERGLFFTGIDVI-------GDYITEINVT--SPTC  290 (316)
Q Consensus       226 R~~~~~~~r~Nl~~Gg~~~~~~-lt~~~-----~~i~~~~~~~L~~~gl~~~GiDii-------g~~i~EvNvt--sP~g  290 (316)
T Consensus       213 R~-~dgD~GPNTGGMGaysp~p~~~~~~~~~~~~~I~~p~~~~l~~eg~~y~GvLy~GlMlt~~GpkVlEyN~RfGDPE-  290 (415)
T PRK13790        213 RA-FDHDEGPNTGGMGAYCPVPHISDDVLKLTNETIAQPIAKAMLNEGYQFFGVLYIGAILTKDGPKVIEFNARFGDPE-  290 (415)
T ss_pred             CC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEECCCCEEEEEEEECCCCH-
T ss_conf             24-6899999999875667774469899999998708999999985599848998877998689866999874118922-


Q ss_pred             HHHHHHHCCCCHHHHHHHHHH
Q ss_conf             788997519998999999998
Q gi|254780696|r  291 IREIHRNGGENVASLFWDGIE  311 (316)
Q Consensus       291 ~~~~~~~~~~~i~~~i~d~ie  311 (316)
T Consensus       291 ~q~iLp~L~~Dl~~~~~~~~~  311 (415)
T PRK13790        291 AQVLLSRMESDLMQHIIDLDE  311 (415)
T ss_pred             HHHHHHHCCCHHHHHHHHHHC
T ss_conf             888987605519999999975