HHsearch alignment for GI: 254780696 and conserved domain: pfam02222

>pfam02222 ATP-grasp ATP-grasp domain. This family does not contain all known ATP-grasp domain members. This family includes a diverse set of enzymes that possess ATP-dependent carboxylate-amine ligase activity.
Probab=99.08  E-value=1.5e-09  Score=83.00  Aligned_cols=135  Identities=18%  Similarity=0.367  Sum_probs=91.6

Q ss_pred             HCCCCEEECCHHHHHHHHHHHH-HHHHHCCC-CCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEECCCCCCCCCEEE
Q ss_conf             0443100037245568888521-43311168-854344687448871158899999840013340021053445682699
Q gi|254780696|r  136 LMPPTLISRDITQITRFYLEMK-DIIIKPLY-GNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRI  213 (316)
Q Consensus       136 ~~P~T~vt~~~~~~~~f~~~~~-~vViKPl~-g~~G~gV~~i~~~~~~~~~~~e~~~~~~~~~ii~Qefi~~~~~gD~Rv  213 (316)
T Consensus         7 ptp~~~~i~~~~d~~~~~~~iGyP~vvKp~~~G~~g~G~~~v~~-~~el~~a~~~~---~~~~~liE~~I~--~~~Ei~~   80 (171)
T pfam02222         7 PTPRFMAAESLEELIEAGQELGYPCVLKARRGGYDGKGQYVVRS-EADIPQAWEEL---GGGPVIVEEFVP--FDKELSV   80 (171)
T ss_pred             CCCCCEEECCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEECC-HHHHHHHHHHC---CCCCEEEEEECC--CCEEEEE
T ss_conf             99995498999999999997099789996110258985289889-99999999855---899579986046--7579998


Q ss_pred             EEE---CCEEEE--EEEEECCCCCCCCCCCCCCCEEEEECCHHH----HHHHHHHHHHHHHCCCEEEEEEEE----CC-E
Q ss_conf             998---998863--212204568600000014731110077899----999999999999849879999511----78-7
Q gi|254780696|r  214 LLL---NGKPVG--AVNRIPSEVDNRSNIHAGGKAELTKLTKID----LDICKRIGESLRERGLFFTGIDVI----GD-Y  279 (316)
Q Consensus       214 ~vi---~g~~v~--a~~R~~~~~~~r~Nl~~Gg~~~~~~lt~~~----~~i~~~~~~~L~~~gl~~~GiDii----g~-~  279 (316)
T Consensus        81 ~~~r~~~g~~~~~~~~e~~~~~g~~~~~------~~Pa~~~~~~~~~i~~~a~ki~~aLg~~G--~~~veff~~~dG~~~  152 (171)
T pfam02222        81 LVVRSVDGETAFYPPVETIQEDGICHES------VAPARVPDSQQAKAQEIAKKIVDELGGVG--IFGVELFVLPDGDLL  152 (171)
T ss_pred             EEEECCCCCEEECCCEEEEEECCEEEEE------ECCCCCCHHHHHHHHHHHHHHHHHCCCCC--EEEEEEEECCCCCEE
T ss_conf             7434499989980354668867818987------42888898999999999999999839704--599999993999799


Q ss_pred             EEEEE
Q ss_conf             88983
Q gi|254780696|r  280 ITEIN  284 (316)
Q Consensus       280 i~EvN  284 (316)
T Consensus       153 v~Evn  157 (171)
T pfam02222       153 VNELA  157 (171)
T ss_pred             EEEEC
T ss_conf             99964