HHsearch results for GI: 254780696 and protein with PDBid: 1pk8_A

>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A*
Probab=99.96  E-value=1.5e-29  Score=212.68  Aligned_cols=220  Identities=14%  Similarity=0.117  Sum_probs=159.1

Q ss_pred             CCEEEEECCCCC---CHHHHHHHHHHHHHCCCCEEECCHHHHHHCCCHHHHHHHH----H--HCCCCEEECCHH--HHHH
Q ss_conf             636688328862---2479999999986235850411748875256503433454----3--044310003724--5568
Q gi|254780696|r   83 MDVILIRQDPPF---NMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFS----E--LMPPTLISRDIT--QITR  151 (316)
Q Consensus        83 fD~i~iR~dPp~---d~~yi~~~~~Le~~~~~~~viN~p~~i~~~~eKl~~~~~~----~--~~P~T~vt~~~~--~~~~  151 (316)
                      =|+||+|+-++.   +..|-+.+..|+.+  |+.++|+|.+|.+|.||.++....    .  ..|+|.+.....  ....
T Consensus       181 PD~Vlvr~~~~~~~e~~d~r~lL~~Le~~--Gip~vNs~~sI~~~~DK~~~~~~L~~~~~~l~~p~~~li~~~~~~~~~~  258 (422)
T 1pk8_A          181 PDFVLIRQHAFSMARNGDYRSLVIGLQYA--GIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKE  258 (422)
T ss_dssp             CSEEEECSCSBCSSTTCBCHHHHHHHHHT--TCCEESCHHHHHHTSSHHHHHHHHHHHHHHHCTTTSCBCCCEEESSGGG
T ss_pred             CCEEEECCCCCCCCCCCHHHHHHHHHHHC--CCCCCCCHHHHHHHHCHHHHHHHHHHHCCCCCCCCEEECCCCCHHHHHH
T ss_conf             98899866666633241699999999973--9870499999998605299999999732779999600035321256777


Q ss_pred             HHHH-HHHHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEECCCCCCCCCEEEEEECCEEEEEEEEECCC
Q ss_conf             8885-214331116885434468744887115889999984001334002105344568269999899886321220456
Q gi|254780696|r  152 FYLE-MKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSE  230 (316)
Q Consensus       152 f~~~-~~~vViKPl~g~~G~gV~~i~~~~~~~~~~~e~~~~~~~~~ii~Qefi~~~~~gD~Rv~vi~g~~v~a~~R~~~~  230 (316)
                      +... ..|+|+||.+|++|.||++++ +...+..+++.+.. +...+++||||+.  ..|+|++++||+++++++|. ..
T Consensus       259 ~~~~~~~PvVVKp~~g~~G~Gv~~V~-~~~el~~~~~~~~~-~~~~v~vEefI~~--~~dirv~vig~~v~a~~~~~-~~  333 (422)
T 1pk8_A          259 MLSSTTYPVVVKMGHAHSGMGKVKVD-NQHDFQDIASVVAL-TKTYATAEPFIDA--KYDVRVQKIGQNYKAYMRTS-VS  333 (422)
T ss_dssp             CCCCSSSSEEEEESSCCTTTTEEEEC-SHHHHHHHHHHHHH-HTSCEEEEECCCE--EEEEEEEEETTEEEEEEEEE-SS
T ss_pred             HHHCCCCEEEEEECCCCCCCCEEEEC-CCCHHHHHHHHHHH-HCCEEEEEECCCC--CEEEEEEEECCEEEEEEEEE-CC
T ss_conf             65414872999757878778889977-92179999999986-1884999962578--67999999899899999982-68


Q ss_pred             CCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEEEE----C-CEEEEEECCCCHHH-HHHHHHCCCCHHH
Q ss_conf             8600000014731110077899999999999999849879999511----7-87889836883037-8899751999899
Q gi|254780696|r  231 VDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVI----G-DYITEINVTSPTCI-REIHRNGGENVAS  304 (316)
Q Consensus       231 ~~~r~Nl~~Gg~~~~~~lt~~~~~i~~~~~~~L~~~gl~~~GiDii----g-~~i~EvNvtsP~g~-~~~~~~~~~~i~~  304 (316)
                      ++|++|. .||..+.++++++.+++|.++++.|.  |+.++|||+|    | .||+||| .||.++ .+........|++
T Consensus       334 ~~~k~n~-~~g~~~~~~l~e~~k~~a~~a~~alg--g~~i~gVD~i~~kdG~~yilEVN-~sp~~l~~~~~~~d~~~i~d  409 (422)
T 1pk8_A          334 GNWKTNT-GSAMLEQIAMSDRYKLWVDTCSEIFG--GLDICAVEALHGKDGRDHIIEVV-GSSMPLIGDHQDEDKQLIVE  409 (422)
T ss_dssp             SCSSTTS-SCEEEEEECCCHHHHHHHHHHTTGGG--CCSEEEEEEEEETTSCEEEEEEE-CTTCCCCTTCHHHHHHHHHH
T ss_pred             CCCEECC-CCCCCCCCCCCHHHHHHHHHHHHHHC--CCCEEEEEEEECCCCCEEEEEEC-CCCCCCCCHHHHHHHHHHHH
T ss_conf             8756223-47644314879999999999999818--98679999999279988999967-99743443126678889999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999886
Q gi|254780696|r  305 LFWDGIEKI  313 (316)
Q Consensus       305 ~i~d~ie~~  313 (316)
                      .+++.+.+.
T Consensus       410 lv~~~~~~~  418 (422)
T 1pk8_A          410 LVVNKMTQA  418 (422)
T ss_dssp             HHHHHHHCC
T ss_pred             HHHHHHHHH
T ss_conf             999999987