HHsearch results for GI: 254780696 and protein with PDBid: 2dzd_A

>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans}
Probab=99.41  E-value=6.7e-11  Score=90.42  Aligned_cols=275  Identities=15%  Similarity=0.154  Sum_probs=152.4

Q ss_pred             CCCCCEEEEEECCHHHCCCCCCCHHHHHHHHHHCCCEEEEEEH-HHE-EEECCEEEEEEEEEEEECCCCCEEEECCC---
Q ss_conf             9653318997099888484764679999999988988999954-124-89998999999999980777412650464---
Q gi|254780696|r    1 MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTP-DQL-YMRDSKIYANTQPLSLDEKKEQYYSLGEE---   75 (316)
Q Consensus         1 mkk~~kI~fimDpi~~i~~~~DTT~~Lm~eAq~RGheV~~~~~-~dL-~~~~g~v~A~~~~i~i~~~~~~~f~~~~~---   75 (316)
                      +|+++||++. +       ..---++++++|++.|++.-.... .|- +..          +   ...+..|.++..   
T Consensus         3 ~~~~kkvLia-n-------rGeia~ri~ra~relGi~tVav~s~~D~~s~~----------~---~~AD~~~~i~~~~~~   61 (461)
T 2dzd_A            3 TRRIRKVLVA-N-------RGEIAIRVFRACTELGIRTVAIYSKEDVGSYH----------R---YKADEAYLVGEGKKP   61 (461)
T ss_dssp             CCCCSEEEEC-S-------CHHHHHHHHHHHHHHTCEEEEEECGGGTTCTH----------H---HHSSSEEECSTTSCT
T ss_pred             CCCCCEEEEE-C-------CCHHHHHHHHHHHHCCCEEEEEECHHHHCCCC----------H---HHCCEEEEECCCCCC
T ss_conf             8766689998-9-------72999999999998799699992847737899----------8---789999991898873


Q ss_pred             --CCCC---------HHHCCEEEEECCCCCCHHHHHHHHHHHHHCCCC-EEECCHHHHHHCCCHHHHHHHHH----HCCC
Q ss_conf             --4352---------100636688328862247999999998623585-04117488752565034334543----0443
Q gi|254780696|r   76 --KIID---------LSQMDVILIRQDPPFNMHYITSTYLLEKINPET-LIVNNPFWIRNSPEKIFVTEFSE----LMPP  139 (316)
Q Consensus        76 --~~~~---------L~~fD~i~iR~dPp~d~~yi~~~~~Le~~~~~~-~viN~p~~i~~~~eKl~~~~~~~----~~P~  139 (316)
                        .-++         -...|+|++=-.  |-.+-......++.  .+. ++-.+|.+|+.+.||...-++..    ++|+
T Consensus        62 ~~sYld~e~Ii~ia~~~~~daIhPgyG--flsEna~~a~~~~~--~gi~~iGps~~~i~~~gdK~~~r~~~~~~gvp~~p  137 (461)
T 2dzd_A           62 IEAYLDIEGIIEIAKAHDVDAIHPGYG--FLSENIQFAKRCRE--EGIIFIGPNENHLDMFGDKVKARHAAVNAGIPVIP  137 (461)
T ss_dssp             TGGGTCHHHHHHHHHHTTCCEEECCSS--SSTTCHHHHHHHHH--TTCEESSCCHHHHHHTTSHHHHHHHHHHTTCCBCC
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEECCHH--HHHHCHHHHHHHHH--CCCEEECCCHHHHHHCCCHHHHHHHHHHCCCCCCC
T ss_conf             322269999999999978699985876--76329899999997--69778579999998636989989999986998356


Q ss_pred             --CEEECCHHHHHHHHHHHH-HHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHH-----HCCCCCCEEECCCCCCCCCE
Q ss_conf             --100037245568888521-4331116885434468744887115889999984-----00133400210534456826
Q gi|254780696|r  140 --TLISRDITQITRFYLEMK-DIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFE-----KYPEPLMIQSYLPQIRDGDK  211 (316)
Q Consensus       140 --T~vt~~~~~~~~f~~~~~-~vViKPl~g~~G~gV~~i~~~~~~~~~~~e~~~~-----~~~~~ii~Qefi~~~~~gD~  211 (316)
                        ....++.+++.++.++.| |+++||.+|.||+|+..+. +..++...++...+     .+..++++.+||+...  .+
T Consensus       138 ~~~~~~~~~eea~~~a~~iGyPviiKps~ggGGrGm~vV~-~~~el~~a~~~a~~ea~~~fg~~~v~vEk~i~~~r--hi  214 (461)
T 2dzd_A          138 GSDGPVDGLEDVVAFAEAHGYPIIIKAALGGGGRGMRIVR-SKSEVKEAFERAKSEAKAAFGSDEVYVEKLIENPK--HI  214 (461)
T ss_dssp             BCSSCCSSHHHHHHHHHHHCSCEEEEESTTCSSSSEEEEC-CGGGHHHHHHHHHHHHHHHTSCCCEEEEECCCSCE--EE
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCEEEC-CHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCE--EE
T ss_conf             6355689999999988751985897402478998725758-99999999999999888746998689998439974--99


Q ss_pred             EEEEE-C--CEEEEEEEEECCCCCCCCCCCCCCCEEEEECCHHHH----HHHHHHHHHHHHCCCEEEEEEEE--CC--EE
Q ss_conf             99998-9--988632122045686000000147311100778999----99999999999849879999511--78--78
Q gi|254780696|r  212 RILLL-N--GKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDL----DICKRIGESLRERGLFFTGIDVI--GD--YI  280 (316)
Q Consensus       212 Rv~vi-~--g~~v~a~~R~~~~~~~r~Nl~~Gg~~~~~~lt~~~~----~i~~~~~~~L~~~gl~~~GiDii--g~--~i  280 (316)
                      -|-++ |  |.+++...|.-+-+  |.+--.-..+-...|+++.+    +.+.++++.|.-.|  ...|.++  ++  |+
T Consensus       215 EVqvl~D~~g~~i~l~er~csiq--r~~qk~ie~aP~~~L~~~~~~~i~~~A~kia~~lgy~G--~~tVEflv~~~~~yf  290 (461)
T 2dzd_A          215 EVQILGDYEGNIVHLYERDCSVQ--RRHQKVVEVAPSVSLSDELRQRICEAAVQLMRSVGYVN--AGTVEFLVSGDEFYF  290 (461)
T ss_dssp             EEEEEECTTCCEEEEEEEEEEEE--ETTEEEEEEESCTTSCHHHHHHHHHHHHHHHHHTTCCE--EEEEEEEEETTEEEE
T ss_pred             EEEEEECCCCCEEEEECCCCCCC--CCCCCCCEECCCCCCCHHHHHHHHHHHHHHHHHCCCCC--CCEEEEEECCCEEEE
T ss_conf             99999838881999735346677--66886505579998989999999999999999859655--515899852866999


Q ss_pred             EEEECCCCHH-HHHHHHHCCCCHHHHHHH
Q ss_conf             8983688303-788997519998999999
Q gi|254780696|r  281 TEINVTSPTC-IREIHRNGGENVASLFWD  308 (316)
Q Consensus       281 ~EvNvtsP~g-~~~~~~~~~~~i~~~i~d  308 (316)
                      +|+| +=+.. -.=.+.+||+|+.+.-+.
T Consensus       291 lEvN-pR~qveh~vte~~tGidlv~~qi~  318 (461)
T 2dzd_A          291 IEVN-PRIQVEHTITEMITGIDIVQSQIL  318 (461)
T ss_dssp             EEEE-SSCCGGGHHHHHHHCCCHHHHHHH
T ss_pred             EEEE-CCCCCCCCEEEEECCCCHHHHHHH
T ss_conf             9863-232687651120108857999999