HHsearch results for GI: 254780696 and protein with PDBid: 2qf7_A

>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42}
Probab=98.63  E-value=5.6e-07  Score=64.72  Aligned_cols=189  Identities=14%  Similarity=0.212  Sum_probs=112.0

Q ss_pred             CCEEE-CCHHHHHHCCCHHHHHHHHH----H-CCCC-EEECCHHHHHHHHHHHH-HHHHHCCCCCCCCCEEEECCCCCCH
Q ss_conf             85041-17488752565034334543----0-4431-00037245568888521-4331116885434468744887115
Q gi|254780696|r  111 ETLIV-NNPFWIRNSPEKIFVTEFSE----L-MPPT-LISRDITQITRFYLEMK-DIIIKPLYGNGGTGVFRITLGDRNF  182 (316)
Q Consensus       111 ~~~vi-N~p~~i~~~~eKl~~~~~~~----~-~P~T-~vt~~~~~~~~f~~~~~-~vViKPl~g~~G~gV~~i~~~~~~~  182 (316)
                      |..+| =+|++|+.+.+|..+-.+.+    + +|-| -+..|.+++.++.++.| ||++|+..|.||+|+..+ .+..++
T Consensus       118 g~~figp~~~~~~~~g~k~~~r~~a~~~~vp~~~g~~~~~~~~~~~~~~~~~ig~pv~~k~~~gggg~g~~~~-~~~~~~  196 (1165)
T 2qf7_A          118 GIIFIGPKADTMRQLGNKVAARNLAISVGVPVVPATEPLPDDMAEVAKMAAAIGYPVMLKASWGGGGRGMRVI-RSEADL  196 (1165)
T ss_dssp             TCEESSCCHHHHHHHHSHHHHHHHHHHTTCCBC-----------------------------------------------
T ss_pred             CCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCEEE-CCHHHH
T ss_conf             9989997999999832999999999985989888978888999999999986499789997888997752697-899999


Q ss_pred             HHHHHHHH-----HHCCCCCCEEECCCCCCCCCEEEEEE-C--CEEEEEEEEECCCCCCCCCCCCCCCEEEEECCHHHHH
Q ss_conf             88999998-----40013340021053445682699998-9--9886321220456860000001473111007789999
Q gi|254780696|r  183 SSLIEMLF-----EKYPEPLMIQSYLPQIRDGDKRILLL-N--GKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDLD  254 (316)
Q Consensus       183 ~~~~e~~~-----~~~~~~ii~Qefi~~~~~gD~Rv~vi-~--g~~v~a~~R~~~~~~~r~Nl~~Gg~~~~~~lt~~~~~  254 (316)
                      .+.++...     ..+...+++.+||+..++  +-|-++ |  |.+++-..|.-+-  =|.|-..=..+-...|+++.++
T Consensus       197 ~~~~~~~~~~~~~~f~~~~v~~e~~~~~~rh--ievq~~~d~~g~~~~~~~r~cs~--q~~~qk~ie~~p~~~l~~~~~~  272 (1165)
T 2qf7_A          197 AKEVTEAKREAMAAFGKDEVYLEKLVERARH--VESQILGDTHGNVVHLFERDCSV--QRRNQKVVERAPAPYLSEAQRQ  272 (1165)
T ss_dssp             -----------------------CCCSSEEE--EEEEEEECTTSCEEEEEEEEEEE--EETTEEEEEEESCTTCCHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCEE--EEEEEEECCCCCEEEEECCCCCC--CCCCCEEEEECCCCCCCHHHHH
T ss_conf             9999999999997269985899985288708--99999971889889971788888--7588623567779889999999


Q ss_pred             ----HHHHHHHHHHHCCCE-EEEEEEE----CC--EEEEEECCCCHHHH-HHHHHCCCCHHHHHHH
Q ss_conf             ----999999999984987-9999511----78--78898368830378-8997519998999999
Q gi|254780696|r  255 ----ICKRIGESLRERGLF-FTGIDVI----GD--YITEINVTSPTCIR-EIHRNGGENVASLFWD  308 (316)
Q Consensus       255 ----i~~~~~~~L~~~gl~-~~GiDii----g~--~i~EvNvtsP~g~~-~~~~~~~~~i~~~i~d  308 (316)
                          .|.++++.+   |.. -..|.++    .+  |++||| |=+.-=. =-+.++|+|+.+.-+.
T Consensus       273 ~~~~~a~~~~~~~---~y~~~gtvef~~~~~~~~~~f~E~n-~R~qveh~vte~~~g~dlv~~~~~  334 (1165)
T 2qf7_A          273 ELAAYSLKIAGAT---NYIGAGTVEYLMDADTGKFYFIEVN-PRIQVEHTVTEVVTGIDIVKAQIH  334 (1165)
T ss_dssp             HHHHHHHHHHHHT---TCCEEEEEEEEEETTTTEEEEEEEE-CSCCTTHHHHHHHHCCCHHHHHHH
T ss_pred             HHHHHHHHHHHHC---CCEEEEEEEEEEECCCCCEEEEEEE-CCCCCCCCCEEEEECCHHHHHHHH
T ss_conf             9999999999864---9535306999998689968999966-898866532354546506899999