HHsearch results for GI: 254780696 and protein with PDBid: 3jrx_A

>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A*
Probab=99.01  E-value=5.4e-08  Score=71.38  Aligned_cols=212  Identities=17%  Similarity=0.158  Sum_probs=123.5

Q ss_pred             HHCCEEEEECCC-CCCHHHHHHHHHHHHHCCCCEE-ECCHHHHHHCCCHHHHHHHHH-----HCCCC-------------
Q ss_conf             006366883288-6224799999999862358504-117488752565034334543-----04431-------------
Q gi|254780696|r   81 SQMDVILIRQDP-PFNMHYITSTYLLEKINPETLI-VNNPFWIRNSPEKIFVTEFSE-----LMPPT-------------  140 (316)
Q Consensus        81 ~~fD~i~iR~dP-p~d~~yi~~~~~Le~~~~~~~v-iN~p~~i~~~~eKl~~~~~~~-----~~P~T-------------  140 (316)
                      ...|+|++-=.- .-|..+-   ..++.  .|..+ -=+|.+|+.+.||..+-++..     .+|-|             
T Consensus       138 ~~~daIhPGyGflSEna~fA---~~~~~--~Gi~fIGPs~~~i~~~GDK~~ar~la~~agVPvvPgs~~~~~~~~~~~~~  212 (587)
T 3jrx_A          138 IPVQAVWAGWGHASENPKLP---ELLCK--NGVAFLGPPSEAMWALGDKIASTVVAQTLQVPTLPWSGSGLTVEWTEDDL  212 (587)
T ss_dssp             TTCSEEECCSSTTTTCTHHH---HHHHT--TTCEESSCCHHHHHHHCSHHHHHHHHHHTTCCBCCBTTTTCCCCC-----
T ss_pred             HCCCEEECCCCCCCCCHHHH---HHHHH--CCCEEECCCHHHHHHHHCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHH
T ss_conf             69199975866445599999---99998--78979995999999863979999999980899479888766521110134


Q ss_pred             ---------------EEECCHHHHHHHHHHHH-HHHHHCCCCCCCCCEEEECCCCCCHHHHHHHH-HHHCCCCCCEEECC
Q ss_conf             ---------------00037245568888521-43311168854344687448871158899999-84001334002105
Q gi|254780696|r  141 ---------------LISRDITQITRFYLEMK-DIIIKPLYGNGGTGVFRITLGDRNFSSLIEML-FEKYPEPLMIQSYL  203 (316)
Q Consensus       141 ---------------~vt~~~~~~~~f~~~~~-~vViKPl~g~~G~gV~~i~~~~~~~~~~~e~~-~~~~~~~ii~Qefi  203 (316)
                                     -..++.+++.++.++.| ||++||.+|.||+|+.++.. ..++...++.. ...+..++++.+|+
T Consensus       213 ~~~~~~~~~~~~~~~g~v~s~eEa~~~A~~IGyPVmVKps~ggGGrGmriv~~-~eel~~a~~~A~~~~~~~~vliEk~i  291 (587)
T 3jrx_A          213 QQGKRISVPEDVYDKGCVKDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAES-AEDFPILFRQVQSEIPGSPIFLMKLA  291 (587)
T ss_dssp             -CCCCCCCCHHHHHTTSCCSHHHHHHHHHHHCSSEEEEETTCCSSSSEEEECS-TTTHHHHHHHHHHHSTTCCEEEEECC
T ss_pred             HHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCEEEEECC-HHHHHHHHHHHHHCCCCCCEEEEEEE
T ss_conf             43210134322233343489999999998549988999667789843378368-58999999999841888856999840


Q ss_pred             CCCCCCCEEEEEE---CCEEEEEEEEECCCCCCCCCCCCCCCEEEEECCHHHH----HHHHHHHHHHHHCCCEEE-EEEE
Q ss_conf             3445682699998---9988632122045686000000147311100778999----999999999998498799-9951
Q gi|254780696|r  204 PQIRDGDKRILLL---NGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDL----DICKRIGESLRERGLFFT-GIDV  275 (316)
Q Consensus       204 ~~~~~gD~Rv~vi---~g~~v~a~~R~~~~~~~r~Nl~~Gg~~~~~~lt~~~~----~i~~~~~~~L~~~gl~~~-GiDi  275 (316)
                      +...+  +-|-++   .|.++....|.-+-  =|.+-.....+-...++++.+    +.+.+++..+   |..-+ -|.+
T Consensus       292 ~~~rh--iEVqvl~D~~G~~i~l~erdcsi--qrr~qk~ieeaPa~~l~~~~r~~m~~~a~~la~al---gy~g~gtvEf  364 (587)
T 3jrx_A          292 QHARH--LEVQILADQYGNAVSLFGRDCSI--QRRHQKIVEEAPATIAPLAIFEFMEQCAIRLAKTV---GYVSAGTVEY  364 (587)
T ss_dssp             CSCEE--EEEEEEECSSSCEEEEEEEEEEE--ESSSCEEEEEESCCSSCHHHHHHHHHHHHHHHHHH---TCCEEEEEEE
T ss_pred             HHHHH--CCEEEEEECCCCEEEEEEEECCC--CCCCCCCCEECCCCCCCHHHHHHHHHHHHHHHHHC---CCCCCCEEEE
T ss_conf             12210--20257872589489997135365--55688874234787563889988999999999975---9756756899


Q ss_pred             E----CC-EEEEEE----CCCCHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             1----78-788983----6883037889975199989999999
Q gi|254780696|r  276 I----GD-YITEIN----VTSPTCIREIHRNGGENVASLFWDG  309 (316)
Q Consensus       276 i----g~-~i~EvN----vtsP~g~~~~~~~~~~~i~~~i~d~  309 (316)
                      +    |. |++|+|    ++.|    =.+.+||+|+.+.-+..
T Consensus       365 lv~~dg~~yfiEvNpRlqvehp----vte~vTGvDLV~~qi~i  403 (587)
T 3jrx_A          365 LYSQDGSFHFLELNPRLQVEHP----CTEMIADVNLPAAQLQI  403 (587)
T ss_dssp             EECSSSCEEEEEEESSCCTTHH----HHHHHHTCCHHHHHHHH
T ss_pred             EECCCCCEEEEEECCCCCCCCH----HHHHHCCCCHHHHHHHH
T ss_conf             8879996899994177566621----47765199889999998