HHsearch results for GI: 254780696 and protein with PDBid: 3k5i_A

>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A*
Probab=99.19  E-value=3e-09  Score=79.63  Aligned_cols=267  Identities=13%  Similarity=0.099  Sum_probs=149.1

Q ss_pred             CCEEEEEECCHHHCCCCCCCHHHHHHHHHHCCCEEEEEEHHHEEE---E--CCEEEEEEEEEEEECCCCCEEEECCCCCC
Q ss_conf             331899709988848476467999999998898899995412489---9--98999999999980777412650464435
Q gi|254780696|r    4 IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYM---R--DSKIYANTQPLSLDEKKEQYYSLGEEKII   78 (316)
Q Consensus         4 ~~kI~fimDpi~~i~~~~DTT~~Lm~eAq~RGheV~~~~~~dL~~---~--~g~v~A~~~~i~i~~~~~~~f~~~~~~~~   78 (316)
                      .+||+++..-        --..+|++||++.|+++.++++.+.--   .  +..+.+     . ..+.+       ....
T Consensus        24 ~k~IgIlG~G--------QLg~ml~~aA~~LGi~v~vld~~~~pa~~va~ad~~i~~-----~-~~D~~-------al~~   82 (403)
T 3k5i_A           24 SRKVGVLGGG--------QLGRMLVESANRLNIQVNVLDADNSPAKQISAHDGHVTG-----S-FKERE-------AVRQ   82 (403)
T ss_dssp             CCEEEEECCS--------HHHHHHHHHHHHHTCEEEEEESTTCTTGGGCCSSCCEES-----C-TTCHH-------HHHH
T ss_pred             CCEEEEECCC--------HHHHHHHHHHHHCCCEEEEEECCCCCHHHCCCCCEEEEC-----C-CCCHH-------HHHH
T ss_conf             9889998687--------999999999997899899996899986651005206977-----8-89999-------9999


Q ss_pred             CHHHCCEEEEE-CCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHCCCHHHHHHHHH----HCCCC--EEECCHHHHHH
Q ss_conf             21006366883-2886224799999999862358504117488752565034334543----04431--00037245568
Q gi|254780696|r   79 DLSQMDVILIR-QDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSE----LMPPT--LISRDITQITR  151 (316)
Q Consensus        79 ~L~~fD~i~iR-~dPp~d~~yi~~~~~Le~~~~~~~viN~p~~i~~~~eKl~~~~~~~----~~P~T--~vt~~~~~~~~  151 (316)
                      -....|+|-.= -+-|++        .|+.++..+.|.=+|.+++.+.||+..=+|.+    ++|+-  .+.++.+++.+
T Consensus        83 ~a~~~DvIT~E~Eni~~~--------~l~~l~~~~~v~P~~~al~~~qdR~~eK~~l~~~gipt~~~~~~~~~s~~dl~~  154 (403)
T 3k5i_A           83 LAKTCDVVTAEIEHVDTY--------ALEEVASEVKIEPSWQAIRTIQNKFNQKEHLRKYGIPMAEHRELVENTPAELAK  154 (403)
T ss_dssp             HHTTCSEEEESSSCSCHH--------HHHHHTTTSEESSCHHHHHHHTSHHHHHHHHHTTTCCBCCEEEESSCCHHHHHH
T ss_pred             HHHCCCEEEECCCCCCHH--------HHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHH
T ss_conf             986199999830307788--------999871888317998999988779999998886599988750336689999999


Q ss_pred             HHHHHH-HHHHHCC-CCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEECCCCCCCCCEEEEEECCE-EEEEEEEEC
Q ss_conf             888521-4331116-8854344687448871158899999840013340021053445682699998998-863212204
Q gi|254780696|r  152 FYLEMK-DIIIKPL-YGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGK-PVGAVNRIP  228 (316)
Q Consensus       152 f~~~~~-~vViKPl-~g~~G~gV~~i~~~~~~~~~~~e~~~~~~~~~ii~Qefi~~~~~gD~Rv~vi~g~-~v~a~~R~~  228 (316)
                      +.++.| |+|+||. .|++|+|.++++.. .++...+..   ....++++.+|++  ....+-++++.+. -+..+.+  
T Consensus       155 ~~~~iG~P~vlK~~~~Gydg~gq~~i~~~-~d~~~~~~~---~~~~~~i~E~~v~--~~~Eisviv~r~~~~i~~~p~--  226 (403)
T 3k5i_A          155 VGEQLGYPLMLKSKTMAYDGRGNFRVNSQ-DDIPEALEA---LKDRPLYAEKWAY--FKMELAVIVVKTKDEVLSYPT--  226 (403)
T ss_dssp             HHHHHCSSEEEEESSSCCTTTTEEEECST-TSHHHHHHH---TTTSCEEEEECCC--EEEEEEEEEEECSSCEEECCC--
T ss_pred             HHHHCCCCEEEEECEECCCCCCCEECCCH-HHHHHHHHH---CCCCEEEEEEEEE--EEEEEEEEEEECCCCEEEECC--
T ss_conf             99971898899964056688773301422-457888751---3785489875665--776543789861586599478--


Q ss_pred             CCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHC--CCEEEEEEEE----CC-EEEEEECCCCH--HHHHHHHHCC
Q ss_conf             56860000001473111007789999999999999984--9879999511----78-78898368830--3788997519
Q gi|254780696|r  229 SEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRER--GLFFTGIDVI----GD-YITEINVTSPT--CIREIHRNGG  299 (316)
Q Consensus       229 ~~~~~r~Nl~~Gg~~~~~~lt~~~~~i~~~~~~~L~~~--gl~~~GiDii----g~-~i~EvNvtsP~--g~~~~~~~~~  299 (316)
                      .++..+.+.-.-..+-+..++++..+-+.+++..+.+.  +.-..+|.+.    |. |+.|+| +-|.  |..- ...++
T Consensus       227 ~e~~~~~~~~~~~~~p~~~i~~~~~~~a~~~a~~i~~~l~~vGv~~vEff~~~~g~~~vnEia-PR~hnsgh~T-~~~~~  304 (403)
T 3k5i_A          227 VETVQEDSICKLVYAPARNVSDAINQKAQELARKAVAAFDGKGVFGVEMFLLEDDSIMLCEIA-SRIHNSGHYT-IEGCA  304 (403)
T ss_dssp             EEEEEETTEEEEEEESCSSCCHHHHHHHHHHHHHHHHTSCCSEEEEEEEEEETTSCEEEEEEE-SSCCGGGTTH-HHHBS
T ss_pred             CEEECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCEEEEEEEC-CCCCCCCCEE-ECCCC
T ss_conf             460404897058985797676689999999999999854788637999999469809999924-8877773466-43654


Q ss_pred             CCHHHHHHHH
Q ss_conf             9989999999
Q gi|254780696|r  300 ENVASLFWDG  309 (316)
Q Consensus       300 ~~i~~~i~d~  309 (316)
                      ++.=+.-+..
T Consensus       305 ~sqfe~hiRa  314 (403)
T 3k5i_A          305 LSQFDAHLRA  314 (403)
T ss_dssp             SCHHHHHHHH
T ss_pred             CCHHHHHHHH
T ss_conf             6799999999