HHsearch results for GI: 254780696 and protein with PDBid: 3mjf_A

>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A
Probab=98.77  E-value=3.3e-07  Score=66.24  Aligned_cols=280  Identities=13%  Similarity=0.170  Sum_probs=154.3

Q ss_pred             CCEEEEEECCHHHCCCCCCCHHHHHHHHHH--CCCEEEEEEHHHEEEECCEEEEEEEEEEEECCC-CCEEEECCCCCCCH
Q ss_conf             331899709988848476467999999998--898899995412489998999999999980777-41265046443521
Q gi|254780696|r    4 IRNIAIQMNHISTVKVKEDSTFAIALEAQV--RGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK-EQYYSLGEEKIIDL   80 (316)
Q Consensus         4 ~~kI~fimDpi~~i~~~~DTT~~Lm~eAq~--RGheV~~~~~~dL~~~~g~v~A~~~~i~i~~~~-~~~f~~~~~~~~~L   80 (316)
                      .|||+++.+-=.        --||++...+  +..++|++ |.+-...   ..+.+..+.+.... ..-.+..+     -
T Consensus         3 ~MkvLviGsGgR--------EhAia~~l~~s~~~~~v~~~-pgN~g~~---~~~~~~~~~~~~~d~~~i~~~~~-----~   65 (431)
T 3mjf_A            3 AMNILIIGNGGR--------EHALGWKAAQSPLADKIYVA-PGNAGTA---LEPTLENVDIAATDIAGLLAFAQ-----S   65 (431)
T ss_dssp             CEEEEEEECSHH--------HHHHHHHHTTCTTEEEEEEE-ECCHHHH---HCTTCEECCCCTTCHHHHHHHHH-----H
T ss_pred             CCEEEEECCCHH--------HHHHHHHHHHCCCCCEEEEE-CCCHHHH---HHCCCEEECCCCCCHHHHHHHHH-----H
T ss_conf             778999897899--------99999999759898979996-8972665---30665452468669999999999-----8


Q ss_pred             HHCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEECCH-HHHHHCCCHHHHHHHHH----HCCCCEEECCHHHHHHHHHH
Q ss_conf             00636688328862247999999998623585041174-88752565034334543----04431000372455688885
Q gi|254780696|r   81 SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNP-FWIRNSPEKIFVTEFSE----LMPPTLISRDITQITRFYLE  155 (316)
Q Consensus        81 ~~fD~i~iR~dPp~d~~yi~~~~~Le~~~~~~~viN~p-~~i~~~~eKl~~~~~~~----~~P~T~vt~~~~~~~~f~~~  155 (316)
                      ...|.+++=-.-|.- .++.-  .|+.  .+..|+=.+ .+-+.-.+|.|+-+|-+    ++|+-...+|.+++.+|+++
T Consensus        66 ~~idlvivgpe~pL~-~Gl~D--~l~~--~gi~vfGP~~~aA~lE~sK~fak~~m~~~~IPta~~~~~~~~~~a~~~~~~  140 (431)
T 3mjf_A           66 HDIGLTIVGPEAPLV-IGVVD--AFRA--AGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQ  140 (431)
T ss_dssp             TTEEEEEECSHHHHH-TTHHH--HHHH--TTCCEESCCHHHHHHHHCHHHHHHHHHHTTCSBCCEEEESCHHHHHHHHHH
T ss_pred             CCCCEEEECCCHHHH-HHHHH--HHHH--CCCCEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHC
T ss_conf             299989989748988-77999--9974--799333877888787761999999987526588746995899999987525


Q ss_pred             HH-HHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHH-----CCCCCCEEECCCCCCCCCEEEEEE-CCE-EEE--E--
Q ss_conf             21-43311168854344687448871158899999840-----013340021053445682699998-998-863--2--
Q gi|254780696|r  156 MK-DIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEK-----YPEPLMIQSYLPQIRDGDKRILLL-NGK-PVG--A--  223 (316)
Q Consensus       156 ~~-~vViKPl~g~~G~gV~~i~~~~~~~~~~~e~~~~~-----~~~~ii~Qefi~~~~~gD~Rv~vi-~g~-~v~--a--  223 (316)
                      ++ |+|+||-.-++|+||+... +.......++.+...     ....+++|||+.   +-++-++.+ ||+ ++.  .  
T Consensus       141 ~~~p~VIK~dgla~GKGV~v~~-~~~ea~~a~~~~~~~~~~g~~g~~vvIEE~L~---G~E~S~~a~~dG~~~~~lp~~q  216 (431)
T 3mjf_A          141 KGAPIVIKADGLAAGKGVIVAM-TQEEAETAVNDMLAGNAFGDAGHRIVVEEFLD---GEEASFIVMVDGENVLPMATSQ  216 (431)
T ss_dssp             HCSSEEEEESSSCTTCSEEEEC-SHHHHHHHHHHHHTTHHHHCCCCCEEEEECCC---SEEEEEEEEEESSCEEECCCBE
T ss_pred             CCCCEEEEECCCCCCCCCEEEE-CHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC---CEEEEEEEEECCCEEEEEECCC
T ss_conf             6987799716667877626752-11688998999875113456455576212067---5389999997799599532300


Q ss_pred             -EEEECCCCCCCCCCCCCCCEEEEEC-CHHH-----HHHHHHHHHHHHHCCCEEEEEEEE-------C-CEEEEEECC--
Q ss_conf             -1220456860000001473111007-7899-----999999999999849879999511-------7-878898368--
Q gi|254780696|r  224 -VNRIPSEVDNRSNIHAGGKAELTKL-TKID-----LDICKRIGESLRERGLFFTGIDVI-------G-DYITEINVT--  286 (316)
Q Consensus       224 -~~R~~~~~~~r~Nl~~Gg~~~~~~l-t~~~-----~~i~~~~~~~L~~~gl~~~GiDii-------g-~~i~EvNvt--  286 (316)
                       +.|. -+||.=-|.--=|...+.+. +++.     .++...+.+.|++.|+.|.|+=.+       | +||+|.|+-  
T Consensus       217 DhKR~-~dgD~GPNTGGMGa~sp~p~~~~~l~~~i~~~ii~p~~~~l~~~g~~y~GvLy~glMlt~~G~pkViEyN~RfG  295 (431)
T 3mjf_A          217 DHKRV-GDGDTGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFG  295 (431)
T ss_dssp             ECCEE-ETTTEEEECSCSEEEESCTTSCHHHHHHHHHHTHHHHHHHHHHTTCCCEEEEEEEEEECTTSCEEEEEECGGGS
T ss_pred             CCCCC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHCCCCCCCEEEEEEEECCCCCEEEEEEEEECC
T ss_conf             15222-47999998898864688987898999999875001177788635995212353115883689878999873037


Q ss_pred             CCHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             8303788997519998999999998
Q gi|254780696|r  287 SPTCIREIHRNGGENVASLFWDGIE  311 (316)
Q Consensus       287 sP~g~~~~~~~~~~~i~~~i~d~ie  311 (316)
                      .|. .+-+--..+.|+...+.+...
T Consensus       296 DPE-~q~ll~~l~~dl~e~~~~~~~  319 (431)
T 3mjf_A          296 DPE-TQPIMLRMRSDLVELCLAGTQ  319 (431)
T ss_dssp             TTT-HHHHHHHBCSCHHHHHHHHHT
T ss_pred             CCC-HHHHHHHCCCCHHHHHHHHHC
T ss_conf             840-445565316748999999863