BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780696|ref|YP_003065109.1| glutathione synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (316 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|83952478|ref|ZP_00961209.1| glutathione synthetase [Roseovarius nubinhibens ISM]
 gi|83836151|gb|EAP75449.1| glutathione synthetase [Roseovarius nubinhibens ISM]
          Length = 311

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 159/310 (51%), Positives = 223/310 (71%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  + +  DSTF IALEAQ RG+++F+YTPD+L   + ++ A   PL +  
Sbjct: 1   MKIAFQMDPIGPININADSTFRIALEAQARGHELFYYTPDRLAYDEGRVTARGWPLRVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +  +YSLGEE+++DLS+ DV+ +RQDPPF+M YIT+T+LL+++ P TL+VN+PFW+RN 
Sbjct: 61  VEGDHYSLGEEQVVDLSEFDVVWLRQDPPFDMFYITTTHLLDRLAPGTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ + +F +LMPPT I+RDI  +  F     D+I+KPLYGNGG GVF +   DRN +S
Sbjct: 121 PEKLLILDFPDLMPPTTIARDIETLRAFKERHGDVILKPLYGNGGAGVFLLRKEDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E       EPL++Q YLP +  GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHETFASFSREPLIVQKYLPDVSKGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              L++ D +IC RIG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G NVA 
Sbjct: 241 KIALSERDREICARIGPLLREKGQVFVGIDVIGDYLTEINVTSPTGIQELERFDGTNVAE 300

Query: 305 LFWDGIEKIK 314
           + W+ IE+ +
Sbjct: 301 IIWEAIERKR 310


>gi|23015835|ref|ZP_00055601.1| COG0189: Glutathione synthase/Ribosomal protein S6 modification
           enzyme (glutaminyl transferase) [Magnetospirillum
           magnetotacticum MS-1]
          Length = 314

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 168/309 (54%), Positives = 230/309 (74%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+AIQM+ I ++ +  DSTF +ALEAQ RG+ +FHY P  L +R+ ++ A  +PLS+
Sbjct: 1   MSLNVAIQMDPIESIDIDADSTFVLALEAQKRGHTLFHYLPRDLALRNGRVLARIRPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
              K  +++LGE +++DL+ MDV+L+RQDPPF+M YIT+T+LL+ I+P TL+VN+P  +R
Sbjct: 61  RRAKGDHFTLGEARLVDLASMDVVLMRQDPPFDMAYITATHLLDHIHPHTLVVNDPTHVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEK+ VT F +LMPPTLI+ D  QI  F  E KDII+KPL+GNGG GVF +  GD N 
Sbjct: 121 NSPEKLLVTHFGDLMPPTLITSDREQIMDFREEHKDIIVKPLFGNGGAGVFHLVPGDENL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + Y EP+M+Q YLP++R GDKRI+L++G  VGAVNR+P+E + RSN+H GG 
Sbjct: 181 NSLLEMFTQIYREPVMVQRYLPEVRQGDKRIILVDGVAVGAVNRVPAEGEARSNLHVGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A+ + LT+ + +IC  IG +L+ERGL F GIDVIGDY+TEINVTSPT I++I R  G  +
Sbjct: 241 AKPSTLTEREREICAAIGPTLKERGLIFVGIDVIGDYLTEINVTSPTGIQQIDRFDGVCI 300

Query: 303 ASLFWDGIE 311
             L WD IE
Sbjct: 301 EGLIWDAIE 309


>gi|310814761|ref|YP_003962725.1| glutathione synthetase [Ketogulonicigenium vulgare Y25]
 gi|308753496|gb|ADO41425.1| glutathione synthetase [Ketogulonicigenium vulgare Y25]
          Length = 314

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 158/312 (50%), Positives = 224/312 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +AIQM+ I ++ +  DSTF IALEAQ RG+ +F+YTPD+L  ++ +I A   P++L
Sbjct: 1   MALKVAIQMDPIESINIDGDSTFRIALEAQARGHSLFYYTPDKLAFQEGRITARGWPITL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             +K  + + G+E  +DL+  DV+ +RQDPPF+M YIT+T+LL+ I+P+TL+VN+PFW+R
Sbjct: 61  RREKGNHVTKGDEVEVDLADYDVVWLRQDPPFDMGYITTTHLLDMIHPKTLVVNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N PEK+ V  F EL PPT I+RD+  +  F  +  D+I+KPL+GNGG GVF++T  D N 
Sbjct: 121 NYPEKLLVLNFPELTPPTAIARDLDTLRAFRAKHGDVILKPLFGNGGAGVFKLTADDSNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL EM      EPL++Q YLP +R GDKR++L++G+PVGA+NR+P+  + RSN+H GG+
Sbjct: 181 ASLHEMFTSISREPLIVQKYLPDVRKGDKRVILVDGEPVGAINRVPASGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E  +LT  DL+IC +IG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N 
Sbjct: 241 PEKVELTARDLEICAKIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGTNT 300

Query: 303 ASLFWDGIEKIK 314
           A   W+ IE+ +
Sbjct: 301 AEKIWEAIERRR 312


>gi|83944330|ref|ZP_00956785.1| glutathione synthetase [Sulfitobacter sp. EE-36]
 gi|83844874|gb|EAP82756.1| glutathione synthetase [Sulfitobacter sp. EE-36]
          Length = 311

 Score =  325 bits (834), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 157/310 (50%), Positives = 221/310 (71%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+ +F+YTPD L  ++ +I A    L++  
Sbjct: 1   MKIAFQMDPIGDVNINADSSFRLAEEAQARGHALFYYTPDHLAYQEGRITARGHDLTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +  + +LG E+ +DL+  DV+ +RQDPPF+MHYITST+LL+++   TL+VN+PFW+RN 
Sbjct: 61  VQGDHATLGPEREVDLADFDVVWLRQDPPFDMHYITSTHLLDRLKKTTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD+  I  F  + KD+I+KPLYGNGG GVFR+   DRN SS
Sbjct: 121 PEKLLVLDFPQLTPPTTIARDLDTIKAFKAKHKDVILKPLYGNGGAGVFRLDTNDRNLSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP +  GDKR++L++G+PVGA+NR+P+E + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPAVSKGDKRVILVDGEPVGAINRVPAEGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ DL+IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A+
Sbjct: 241 KVGLTERDLEICAAIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGTNIAA 300

Query: 305 LFWDGIEKIK 314
             W+ IE+ +
Sbjct: 301 KIWEAIERKR 310


>gi|85704119|ref|ZP_01035222.1| glutathione synthetase [Roseovarius sp. 217]
 gi|85671439|gb|EAQ26297.1| glutathione synthetase [Roseovarius sp. 217]
          Length = 312

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 153/311 (49%), Positives = 222/311 (71%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  + +  DSTF +A EAQ RG+++F+YTPD+L   + ++ A   PL++  
Sbjct: 1   MKIAFQMDPIGPININGDSTFRLAEEAQARGHELFYYTPDRLAYDEGRVTARGWPLTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +  ++ LGEE+ +DL++ DV+ +RQDPPF+M YIT+T++L++++P TL+VN+PFW+RN 
Sbjct: 61  VQGDHFRLGEEQTVDLAEFDVVWLRQDPPFDMFYITTTHILQRLSPGTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ + +F +LMPPT I+RD+  I  F     D+I+KPLYGNGG GVF +   DRN +S
Sbjct: 121 PEKLLILDFPDLMPPTAIARDLDTIRAFRARHGDVILKPLYGNGGAGVFHLPESDRNLAS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L EM      EPL++Q YLP +  GDKR++L++G+ VGA+NR+P++ + RSN+H GG+AE
Sbjct: 181 LHEMFTGFSREPLIVQKYLPAVSKGDKRVILVDGEAVGAINRVPAQGETRSNMHVGGRAE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ DL+IC  IG  LRE+G  F GIDVIG Y+TEINVTSPT I+E+ R  G N+A+
Sbjct: 241 KVALTERDLEICAAIGPLLREKGQVFVGIDVIGHYLTEINVTSPTGIQELERFDGVNIAT 300

Query: 305 LFWDGIEKIKE 315
             W+ IE  + 
Sbjct: 301 KVWEAIEARRR 311


>gi|296534840|ref|ZP_06897179.1| glutathione synthase [Roseomonas cervicalis ATCC 49957]
 gi|296264831|gb|EFH11117.1| glutathione synthase [Roseomonas cervicalis ATCC 49957]
          Length = 507

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 157/314 (50%), Positives = 224/314 (71%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M K   +A+QM+ I  + +  DSTFA+ LEAQ RG+Q++HY    L +   K+ A  QP+
Sbjct: 194 MAKGLKVAVQMDPIQGINIDGDSTFALMLEAQARGHQLWHYHVKDLTLASGKVLARMQPV 253

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            +  +K  +++LGE  + DLS MDV+L+RQDPPF+M YIT+T++LE I+P+TL+VN+P  
Sbjct: 254 EVRREKGNHFTLGESALHDLSTMDVVLMRQDPPFDMAYITATHILEHIHPKTLVVNDPAH 313

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RN+PEK+FV +F ELMP T+I+ D  ++  F  +  DII+KPL+GNGG GVF +   D 
Sbjct: 314 VRNAPEKLFVMQFPELMPDTIITHDPLEVRAFRKKHGDIIVKPLFGNGGAGVFHLRPDDG 373

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N ++L+E+  E+  EPLMIQ YLP +R GDKRI+L++G  +GA+NR+P+E ++RSN+H G
Sbjct: 374 NLNALLELYAERSREPLMIQQYLPAVRKGDKRIILVDGVAMGAINRVPAEGESRSNMHVG 433

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT  D +IC+RIG  L+ RGL F GIDVIGDY+TEINVTSPT ++E+ R  G 
Sbjct: 434 GRPEAVALTPRDREICERIGPELKARGLIFVGIDVIGDYLTEINVTSPTGLQELARFDGI 493

Query: 301 NVASLFWDGIEKIK 314
           ++    WD IE  +
Sbjct: 494 HLEKAIWDAIESKR 507


>gi|114764204|ref|ZP_01443442.1| glutathione synthetase [Pelagibaca bermudensis HTCC2601]
 gi|114543356|gb|EAU46372.1| glutathione synthetase [Roseovarius sp. HTCC2601]
          Length = 311

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 157/310 (50%), Positives = 220/310 (70%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  + +  DSTF +A EAQ RG+++++Y PD L  ++ +I A  + L +  
Sbjct: 1   MKIAFQMDPIGPIDINADSTFRLAEEAQARGHELYYYLPDHLSFQEGRIMARARTLKVKR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            + ++  LG  ++IDLS++DV+ +RQDPPF+MHYIT+T+LLE++ P+TL+VN+PFW+RNS
Sbjct: 61  VQGEHAELGPLQLIDLSEVDVVWLRQDPPFDMHYITTTHLLERLVPDTLVVNDPFWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V  F EL PPT ++RD+  I  F  +  DII+KPLYGNGG GVFR+   DRN SS
Sbjct: 121 PEKLLVLNFPELTPPTTVARDLETIREFKAKHGDIILKPLYGNGGAGVFRLDENDRNLSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q YLP +  GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LYELFTGFSREPLIVQKYLPAVTKGDKRVILVDGEPVGAINRVPAANEVRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
             +LT+ D +IC  IG  LRE+G  F GIDVIGD++TEINVTSPT I+E+ R  G NVA 
Sbjct: 241 KVELTERDREICAAIGPVLREKGQVFVGIDVIGDWLTEINVTSPTGIQELERFDGVNVAG 300

Query: 305 LFWDGIEKIK 314
             W  IE  +
Sbjct: 301 KIWQAIEAKR 310


>gi|154254020|ref|YP_001414844.1| glutathione synthetase [Parvibaculum lavamentivorans DS-1]
 gi|154157970|gb|ABS65187.1| glutathione synthetase [Parvibaculum lavamentivorans DS-1]
          Length = 312

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 167/312 (53%), Positives = 227/312 (72%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++AIQM+ I ++ +  DSTFA+ LEAQ RG+ +F+Y P  L MRD ++YA  +PL+L
Sbjct: 1   MSLSVAIQMDPIHSININADSTFALGLEAQSRGHTLFYYEPKDLSMRDGRVYARMRPLTL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             +   + SLG  + I L  +DV+L+RQDPPF+M YIT+T+LLE ++P+TL+VN+P  +R
Sbjct: 61  RREVGNHSSLGSLEKIFLEDVDVVLMRQDPPFDMSYITATHLLETVHPKTLVVNDPAEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+F   F  L+PPTLISRD  +I  F  E  DII+KPL+GNGG GVFRI  GD N 
Sbjct: 121 NAPEKLFAVRFKGLLPPTLISRDPEEIRAFRREFSDIIVKPLFGNGGVGVFRIRDGDENL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  +   EP+++Q YLP++R GDKRI+L++GKPVGA+NR+P+E + RSN+H GG+
Sbjct: 181 NSLLEMFGQMNREPVIVQKYLPEVRQGDKRIILVDGKPVGAINRVPAEGEARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LTK + +IC+ IG  L+ RGL F GIDVIGDY+TEINVTSPT I+EI R    N+
Sbjct: 241 PEKWSLTKREEEICETIGPELKARGLIFVGIDVIGDYLTEINVTSPTGIQEIDRFDSANL 300

Query: 303 ASLFWDGIEKIK 314
           A L WD IE  +
Sbjct: 301 AGLVWDAIEARR 312


>gi|83953372|ref|ZP_00962094.1| glutathione synthetase [Sulfitobacter sp. NAS-14.1]
 gi|83842340|gb|EAP81508.1| glutathione synthetase [Sulfitobacter sp. NAS-14.1]
          Length = 311

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 156/310 (50%), Positives = 220/310 (70%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+ +F+YTPD L  ++ +I A    L++  
Sbjct: 1   MKIAFQMDPIGDVNINADSSFRLAEEAQARGHALFYYTPDHLAYQEGRITARGHDLTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +  + +LG E+ +DL+  DV+ +RQDPPF+MHYITST+LL+++   TL+VN+PFW+RN 
Sbjct: 61  VQGDHATLGPEREVDLADFDVVWLRQDPPFDMHYITSTHLLDRLKETTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD+  I  F  + KD+I+KPLYGNGG GVFR+   DRN SS
Sbjct: 121 PEKLLVLDFPQLTPPTTIARDLDTIKAFKAKHKDVILKPLYGNGGAGVFRLDTNDRNLSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP +  GDKR++L++G+ VGA+NR+P+E + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPAVSKGDKRVILVDGEAVGAINRVPAEGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ DL+IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A+
Sbjct: 241 KVGLTERDLEICAAIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGTNIAA 300

Query: 305 LFWDGIEKIK 314
             W+ IE+ +
Sbjct: 301 KIWEAIERKR 310


>gi|260425334|ref|ZP_05779314.1| glutathione synthase [Citreicella sp. SE45]
 gi|260423274|gb|EEX16524.1| glutathione synthase [Citreicella sp. SE45]
          Length = 311

 Score =  322 bits (824), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 159/310 (51%), Positives = 215/310 (69%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  + +  DSTF IA EAQ RG+++F+YTPD L  ++ +I A    L++  
Sbjct: 1   MKIAFQMDPIGPIDINADSTFRIAEEAQARGHELFYYTPDHLSFQEGRIMARGHALTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            K  +  LG  +++DL+  DV+ +RQDPPF+MHYIT+T+LLE++ P TL+VN+PFW+RNS
Sbjct: 61  VKGDHAQLGPLELVDLAAFDVVWLRQDPPFDMHYITTTHLLERLAPATLVVNDPFWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V  F EL PPT ++RD+  I  F     DII+KPLYGNGG GVFR+   DRN SS
Sbjct: 121 PEKLLVLNFPELTPPTTVARDLETIREFKARHGDIILKPLYGNGGAGVFRLDENDRNLSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q YLP +  GDKR++L+ G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LYELFTGFSREPLIVQKYLPAVTKGDKRVILVEGEPVGAINRVPAANEVRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
             +LT  DL+IC  IG  LRE+G  F GIDVIGD++TEINVTSPT I+E+ R  G NVA 
Sbjct: 241 KVELTPRDLEICATIGPVLREKGQVFVGIDVIGDWLTEINVTSPTGIQELERFDGINVAE 300

Query: 305 LFWDGIEKIK 314
             W  +E  +
Sbjct: 301 KIWQAVEARR 310


>gi|294676019|ref|YP_003576634.1| glutathione synthase [Rhodobacter capsulatus SB 1003]
 gi|294474839|gb|ADE84227.1| glutathione synthase [Rhodobacter capsulatus SB 1003]
          Length = 314

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 158/312 (50%), Positives = 225/312 (72%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A QM+ I+ + +  DSTF IALEAQ RG+ +F+YTPD+L  R  ++ A   PL +
Sbjct: 1   MALKVAFQMDPIAAINIDGDSTFRIALEAQARGHMLFYYTPDRLIYRQGRVLARGWPLVV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             +   +++LG+E  +DL++MDV+ +RQDPPF+M YIT+T+LL++I+P+TL+VN+PFW+R
Sbjct: 61  RREPGNHFTLGDEAEVDLAEMDVVWLRQDPPFDMGYITTTHLLDRIHPKTLVVNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N PEK+ V +F +L PPTLI+RD+  I  F  E  D+I+KPLYGNGG GVFR+   DRN 
Sbjct: 121 NYPEKLLVLDFPDLTPPTLIARDLAVIRDFKAEHGDVILKPLYGNGGAGVFRLDPNDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL E+      EP+++Q Y+P +  GDKRI+L++G+PVGA+NR+P+  + RSN+H GG+
Sbjct: 181 ASLHELFTSINREPMIVQKYVPAVVKGDKRIILVDGEPVGAINRVPAAGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E T+LT  + +IC  IG +LRE+G  F GIDVIGD++TEINVTSPT I+E+ R  G NV
Sbjct: 241 PEPTQLTDREREICAVIGPTLREKGQIFVGIDVIGDWLTEINVTSPTGIQELERFDGTNV 300

Query: 303 ASLFWDGIEKIK 314
           A   W  IE  +
Sbjct: 301 AEKIWQVIEAKR 312


>gi|325291744|ref|YP_004277608.1| glutathione synthetase [Agrobacterium sp. H13-3]
 gi|325059597|gb|ADY63288.1| glutathione synthetase [Agrobacterium sp. H13-3]
          Length = 319

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 195/315 (61%), Positives = 254/315 (80%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI+N+AIQM+H+S + +  DSTFA++LEAQ RGY++FHYTP++L MRD KIYA  + +
Sbjct: 1   MAKIKNVAIQMDHVSGINIAGDSTFAMSLEAQARGYRLFHYTPERLSMRDGKIYATVEQM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  ++SL E + +DLS MDVI +RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  ELRDIKGDHFSLSEPERVDLSTMDVIHLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEF++LMP TLI++D+++I RF  EM DII+KPLYGNGG GVF     DR
Sbjct: 121 VRNSPEKIFVTEFADLMPKTLITKDVSEIARFRNEMGDIILKPLYGNGGAGVFHSARDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           NFSSL+EM  + + EP + Q YLP +R GDKRILL++G+PVGA+NR+P+E D RSN+HAG
Sbjct: 181 NFSSLLEMFGQMFREPYIAQEYLPDVRKGDKRILLVDGEPVGAINRVPAENDARSNMHAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E T+LT  + +IC+RIG +LRERG  F GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRPEPTELTAREKEICRRIGPALRERGFLFVGIDVIGDYLTEINVTSPTGIREVQKFGGA 300

Query: 301 NVASLFWDGIEKIKE 315
           +VASL WD IEK +E
Sbjct: 301 DVASLLWDAIEKKRE 315


>gi|149200759|ref|ZP_01877734.1| glutathione synthetase [Roseovarius sp. TM1035]
 gi|149145092|gb|EDM33118.1| glutathione synthetase [Roseovarius sp. TM1035]
          Length = 311

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 154/306 (50%), Positives = 217/306 (70%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  + +  DSTF IA EAQ RGY++F+YTPD+L   + ++ A   PL++  
Sbjct: 1   MKIAFQMDPIGPININGDSTFRIAEEAQARGYELFYYTPDRLAYDEGRVTARGWPLTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +  ++ LG E+ +DLS  DV+ +RQDPPF+M YIT+T++L++++P TL+ N+PFW+RN 
Sbjct: 61  VQGDHFRLGTEQTVDLSTFDVVWLRQDPPFDMFYITTTHILQRLSPGTLVANDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ + +F +LMPPT I+RD+  I  F     D+I+KPLYGNGG GVF +   DRN +S
Sbjct: 121 PEKLLILDFPQLMPPTAIARDLETIRAFRARHGDVILKPLYGNGGAGVFHLPESDRNLAS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L EM      EPL++Q YLP +  GDKR++L++G+P+GA+NR+P++ + RSN+H GG+AE
Sbjct: 181 LHEMFTGFSREPLIVQKYLPAVSKGDKRVILVDGEPIGAINRVPAQGETRSNMHVGGRAE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
             +LT  D +IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT ++E+ R  G N A 
Sbjct: 241 KVELTARDREICATIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGLQELERFDGTNGAG 300

Query: 305 LFWDGI 310
           L WD I
Sbjct: 301 LIWDAI 306


>gi|83313605|ref|YP_423869.1| glutathione synthetase [Magnetospirillum magneticum AMB-1]
 gi|82948446|dbj|BAE53310.1| Glutathione synthase/Ribosomal protein S6 modification enzyme
           [Magnetospirillum magneticum AMB-1]
          Length = 314

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 167/314 (53%), Positives = 230/314 (73%), Gaps = 1/314 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +AIQM+ I ++ +  DSTF +ALEA+ RG+ +FHY P  L +R+ ++ A  +PLS+
Sbjct: 1   MSLAVAIQMDPIESIDIDADSTFVLALEAEKRGHTLFHYLPRDLALREGRVLARVRPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
              K  +++LGE + +DLS MDV+L+RQDPPF+M YIT+T+LL+ I+P TL+VN+P  +R
Sbjct: 61  RRAKGDHFTLGEARTVDLSSMDVVLMRQDPPFDMAYITATHLLDHIHPRTLVVNDPTHVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEK+ VT F +LMPPTLI+ D  QI  F  E KDII+KPL+GNGG GVF +  GD N 
Sbjct: 121 NSPEKLLVTHFGDLMPPTLITSDREQIMDFREEHKDIIVKPLFGNGGAGVFHLVPGDENL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + Y EP+M+Q YLP++R GDKRI+L++G  VGAVNR+P+E + RSN+H GG 
Sbjct: 181 NSLLEMFTQIYREPVMVQRYLPEVRQGDKRIVLVDGVAVGAVNRVPAEGEARSNLHVGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A+ + LT  + +IC  IG +L+ERGL F GIDVIGDY+TEINVTSPT I++I R  G  +
Sbjct: 241 AKPSILTAREHEICAAIGPTLKERGLIFVGIDVIGDYLTEINVTSPTGIQQIDRFDGVCI 300

Query: 303 ASLFWDGIEKIKET 316
             L WD IE ++ +
Sbjct: 301 EGLIWDAIE-LRRS 313


>gi|149915376|ref|ZP_01903903.1| glutathione synthase [Roseobacter sp. AzwK-3b]
 gi|149810665|gb|EDM70506.1| glutathione synthase [Roseobacter sp. AzwK-3b]
          Length = 311

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 159/310 (51%), Positives = 219/310 (70%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I+ V +  DSTF IA EAQ R + +F+YTPD L   + ++ A    L +  
Sbjct: 1   MKIAFQMDPIAPVNIDADSTFRIAEEAQARAHSLFYYTPDHLAYVEGRVTARGCDLEVRR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            K  ++SLGEE   DL+  DV+ +RQDPPF+MHYIT+T+LL+++ P TL+VN+PFW+RN 
Sbjct: 61  VKGDHFSLGEEYEADLADFDVVWLRQDPPFDMHYITTTHLLQRVMPGTLVVNDPFWVRNF 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +LMPPT I+RD+  I  F     D+I+KPLYGNGG GVF +   DRN SS
Sbjct: 121 PEKLLVLDFPQLMPPTAIARDLATIRAFKARHGDVILKPLYGNGGAGVFHLAESDRNLSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q YLP+I+ GDKR++L++G PVGA+NR+P++ + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKYLPEIKHGDKRVILVDGAPVGAINRVPAQGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT  D++IC+ IG  L+E+G  F GIDVIGDY+TEINVTSPT I+E+ R  G NVA+
Sbjct: 241 KIGLTARDIEICETIGPILKEKGQVFVGIDVIGDYLTEINVTSPTGIQELERFDGINVAA 300

Query: 305 LFWDGIEKIK 314
           + W+ IE  +
Sbjct: 301 MIWEVIEAKR 310


>gi|254487499|ref|ZP_05100704.1| glutathione synthase [Roseobacter sp. GAI101]
 gi|214044368|gb|EEB85006.1| glutathione synthase [Roseobacter sp. GAI101]
          Length = 311

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 157/310 (50%), Positives = 218/310 (70%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+ +F+YTPD L  ++ +I A    L++  
Sbjct: 1   MKIAFQMDPIGAVNIDADSSFRLAEEAQARGHSLFYYTPDHLAFQEGRITARGHDLTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +  + +LGEE+ +DL++ DV+ +RQDPPF+MHYITST+LL+++   TL+VN+PFW+RN 
Sbjct: 61  VQGDHATLGEEREVDLAEFDVVWLRQDPPFDMHYITSTHLLDRLRKTTLVVNDPFWVRNF 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD   I  F  +  D+I+KPLYGNGG GVFR+   DRN  S
Sbjct: 121 PEKLLVLDFPDLTPPTTIARDFQTIKAFKAKHSDVILKPLYGNGGAGVFRLDENDRNLGS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP +  GDKRI+L++G+ VGA+NR+P+E + RSN+H GG+ E
Sbjct: 181 LYELFTGFSREPLIVQKFLPAVSKGDKRIILVDGEAVGAINRVPAEGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LTK DL+IC  IG  L+ERG  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A+
Sbjct: 241 KVGLTKRDLEICAAIGPLLKERGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGTNIAA 300

Query: 305 LFWDGIEKIK 314
             W+ IE  +
Sbjct: 301 KIWEAIEARR 310


>gi|163744698|ref|ZP_02152058.1| glutathione synthetase [Oceanibulbus indolifex HEL-45]
 gi|161381516|gb|EDQ05925.1| glutathione synthetase [Oceanibulbus indolifex HEL-45]
          Length = 311

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 152/310 (49%), Positives = 216/310 (69%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+++F YTPD L  ++ +I A     ++  
Sbjct: 1   MKIAFQMDPIGDVNINADSSFRLAEEAQARGHELFFYTPDHLAYQEGRITARGYDFTVKR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +  +   GEE+ +DL+  DV+ +RQDPPF+MHYITST+LL+++   TL+VN+PFW+RN 
Sbjct: 61  VQGDHAQFGEEREVDLADFDVVWLRQDPPFDMHYITSTHLLDRLKETTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD++ I  F  +  D+I+KPLYGNGG GVFR+   DRN +S
Sbjct: 121 PEKLMVLDFPDLTPPTTIARDLSTIKAFKAKHGDVILKPLYGNGGAGVFRLDANDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP +  GDKR++L++G+ VGA+NR+P+E + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPAVSKGDKRVILVDGEAVGAINRVPAEGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ DL+IC  IG  L+E+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A 
Sbjct: 241 KVGLTERDLEICAAIGPLLKEKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGVNIAG 300

Query: 305 LFWDGIEKIK 314
             W+ IE  +
Sbjct: 301 KIWEAIEARR 310


>gi|84686315|ref|ZP_01014210.1| glutathione synthetase [Maritimibacter alkaliphilus HTCC2654]
 gi|84665842|gb|EAQ12317.1| glutathione synthetase [Rhodobacterales bacterium HTCC2654]
          Length = 313

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 153/312 (49%), Positives = 219/312 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A QM+ I  V +  DSTF IA EAQ RG+++F+YTPD+L  R+ ++ A   P+ L
Sbjct: 1   MALKVAFQMDPIEAVDINADSTFRIAEEAQARGHELFYYTPDRLVFREGRVLATGWPIEL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             +   + + GE+  +DLS+ DV+ +RQDPPF+M YIT+T++L+ I+P+TL++N+PFW+R
Sbjct: 61  RREVGHHVTKGEQTTVDLSEFDVVWLRQDPPFDMGYITTTHILDLIHPDTLVLNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N PEK+ V +F EL PPT+I+R +  +  F  E  DII+KPLYGNGG GVFR+   DRN 
Sbjct: 121 NYPEKLLVLKFPELTPPTMIARSLADLKAFKHEHGDIILKPLYGNGGAGVFRLDPNDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           SSL E+      EPL+ Q +LP +  GDKR++L++G PVGA+NR+P+E + RSN+H GG+
Sbjct: 181 SSLHELFSGINREPLIAQKFLPAVSKGDKRVILVDGAPVGAINRVPAEGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E  +LT  D +IC +IG  L+E+G  F GIDVIGD++TEINVTSPT I+E+ R  G N+
Sbjct: 241 PEKVELTDRDREICAKIGPLLKEKGQIFVGIDVIGDWLTEINVTSPTGIQELERFDGVNI 300

Query: 303 ASLFWDGIEKIK 314
            +  W+ IE  +
Sbjct: 301 TAKIWEAIEARR 312


>gi|150398730|ref|YP_001329197.1| glutathione synthetase [Sinorhizobium medicae WSM419]
 gi|150030245|gb|ABR62362.1| glutathione synthetase [Sinorhizobium medicae WSM419]
          Length = 315

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 191/314 (60%), Positives = 252/314 (80%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M  I N+ +QM+H+S + +  DSTFA++LEAQ RGY++FHYTPD+L +RD K+YA  Q +
Sbjct: 1   MAGIVNVGVQMDHVSGITIAGDSTFAMSLEAQARGYRLFHYTPDKLSLRDGKVYATAQQM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  +++LGE++ IDLS +DVIL+RQDPPF+M YITST+LLE+++P+TL+VN+P W
Sbjct: 61  QLRDVKGDHFTLGEDERIDLSTLDVILLRQDPPFDMAYITSTHLLERLHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEF++LMP TLI+RD  +I RF  EM DII+KPLYGNGG GVF     DR
Sbjct: 121 VRNSPEKIFVTEFADLMPKTLITRDADEIARFRQEMGDIILKPLYGNGGAGVFHSARDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           NFSSL+EM  + + EP + Q YLP++R GDKRILL++G+PVGA+NR+P+E D+RSN+HAG
Sbjct: 181 NFSSLLEMFAQMFREPYIAQEYLPEVRKGDKRILLVDGEPVGAINRVPAEHDSRSNMHAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +IC RIG +L+ERG  F GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATELTAREREICTRIGPALKERGFLFVGIDVIGDYLTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           +VA L WD IEK +
Sbjct: 301 DVAGLLWDAIEKKR 314


>gi|163797081|ref|ZP_02191036.1| Glutathione synthase/Ribosomal protein S6 modification enzyme
           [alpha proteobacterium BAL199]
 gi|159177597|gb|EDP62150.1| Glutathione synthase/Ribosomal protein S6 modification enzyme
           [alpha proteobacterium BAL199]
          Length = 312

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 161/309 (52%), Positives = 225/309 (72%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +AIQM+ I TV +  DS+FA+ALEAQ RG++++HY P  L  RD K+ A   PL +
Sbjct: 1   MALEVAIQMDPIETVSINGDSSFALALEAQKRGHRLYHYLPRHLTFRDRKVTARVAPLEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
              +  +++LG  + +DL  M+V+L+RQDPPF+M YIT+T++LE I+P+TL+VN+P  +R
Sbjct: 61  RRVQGDHFTLGPREAVDLKTMNVVLLRQDPPFDMSYITTTHVLEHIHPKTLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FVT F  LMPPTLI+ D  +I  F  E KDII+KPL+GNGG GVF I   D N 
Sbjct: 121 NAPEKLFVTHFEGLMPPTLITHDPEEIKTFRDEYKDIIVKPLFGNGGAGVFHIKPDDENL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+E+  + Y EP+++Q YLP +R GDKR++L++GK VGA+NRIP++ + RSN+H GG+
Sbjct: 181 NSLLELFTQFYREPVIVQQYLPAVRQGDKRVILVDGKGVGAINRIPAQGEARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A   ++TK D  IC+ IG  L+  GL F GIDVIGD++TEINVTSPT I+E+ R  G +V
Sbjct: 241 AVKCEMTKRDHAICEAIGPELKRLGLVFVGIDVIGDFLTEINVTSPTGIQELSRFDGIDV 300

Query: 303 ASLFWDGIE 311
           A++ WD IE
Sbjct: 301 AAMLWDAIE 309


>gi|209966143|ref|YP_002299058.1| glutathione synthetase [Rhodospirillum centenum SW]
 gi|209959609|gb|ACJ00246.1| glutathione synthase [Rhodospirillum centenum SW]
          Length = 321

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 156/310 (50%), Positives = 226/310 (72%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +AIQM+ I ++ +  DSTF +ALEAQ RG+ ++HY P  L +R ++++A  + L +
Sbjct: 1   MSLAVAIQMDPIESINIDTDSTFMMALEAQRRGHALWHYLPRDLALRHNRLFARARRLEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             ++  +++LG  + ++L+ MDV+L+RQDPPF+M YIT+T+LLE I+P+TL+VN+P  +R
Sbjct: 61  RRERGNHFTLGPAEELELAGMDVVLMRQDPPFDMAYITATHLLEHIHPKTLVVNDPAAVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FVT F++LMPPTLI+    ++  F  E +DII+KPL+GNGG GVF +  GD N 
Sbjct: 121 NAPEKLFVTHFADLMPPTLITSSKEEVLAFRREYRDIIVKPLFGNGGAGVFHLKPGDENL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            +L+E   + Y EP+++Q YLP+IR GDKRI+L++G+P GAV+RIP+E + R+N HAGG 
Sbjct: 181 GALLETFTQLYREPVIVQKYLPEIRQGDKRIILVDGEPAGAVSRIPAEGEARANFHAGGS 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T LT  + DIC  IG +LR +GL F GIDVIGD++TEINVTSPT I+EI+R  G  +
Sbjct: 241 AGRTALTARERDICAAIGPTLRRQGLVFVGIDVIGDWLTEINVTSPTGIQEINRLDGIAI 300

Query: 303 ASLFWDGIEK 312
               WD IE+
Sbjct: 301 ERGLWDAIER 310


>gi|222147290|ref|YP_002548247.1| glutathione synthetase [Agrobacterium vitis S4]
 gi|221734280|gb|ACM35243.1| glutathione synthase [Agrobacterium vitis S4]
          Length = 315

 Score =  318 bits (816), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 187/315 (59%), Positives = 250/315 (79%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M +IRN+A+QM+H+S++ +  DSTFA++LEAQ RGY++FHYTPD+L MRD ++YA  +P+
Sbjct: 1   MAQIRNVAVQMDHVSSINISGDSTFAMSLEAQARGYKLFHYTPDRLTMRDGRVYATVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  +++LG  + +DLS MDV+L+RQDPPF+M YIT+T++LE+I+P+TL+VN+P W
Sbjct: 61  ELRDVKGDHFTLGSPERVDLSTMDVVLLRQDPPFDMAYITATHMLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTE+++LMPPTLI+RD  +I  F  E  DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEYADLMPPTLITRDPAEIAAFRAEQGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           NFSSL+EM  + + EP + Q YLP +R GDKRI+L++G+PVGA+NR+P+E D RSN+HAG
Sbjct: 181 NFSSLMEMFGQMFREPFIAQGYLPAVRKGDKRIILVDGEPVGAINRVPAEHDARSNMHAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           GK E T+LT  + +IC RIG +LRERG    GIDVIGDY+TEINVTSPT IRE+   GG 
Sbjct: 241 GKPEPTELTTREREICARIGPALRERGFLLVGIDVIGDYMTEINVTSPTGIREVKNFGGA 300

Query: 301 NVASLFWDGIEKIKE 315
           ++A L WD IEK + 
Sbjct: 301 DIAGLLWDAIEKKRS 315


>gi|288959650|ref|YP_003449991.1| glutathione synthase [Azospirillum sp. B510]
 gi|288911958|dbj|BAI73447.1| glutathione synthase [Azospirillum sp. B510]
          Length = 320

 Score =  318 bits (816), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 161/314 (51%), Positives = 226/314 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A QM+ I ++ +  DS+F +ALEAQ RG++++HY P  L +  +++ A  + +++
Sbjct: 1   MSLAVAFQMDPIESINIDTDSSFMMALEAQKRGHRLYHYHPRDLILTGNRLTARVREMTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             ++  +Y+LGE    DLS MDVIL+RQDPPF+M YITST+LLE + P+ L+VN+P  +R
Sbjct: 61  VRQRGAHYTLGEPVPTDLSTMDVILLRQDPPFDMAYITSTHLLEHVQPKVLVVNDPAEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+F+T F ELMPPTLI+ D   I  F  E KDII+KPL+GNGG GVF +   D N 
Sbjct: 121 NAPEKLFITRFPELMPPTLITSDKQAILDFRAEHKDIIVKPLFGNGGAGVFHLKPDDENL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL+E+  + Y EP+++Q YLP+IR GDKRI+L++G+PVGAV+R+P E + R+N HAGG 
Sbjct: 181 GSLLELFTQLYREPVIVQKYLPEIRQGDKRIILVDGEPVGAVSRMPLEGEARANFHAGGS 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T+LT  + ++C  IG  LRE+GL F GIDVIGDY+TEINVTSPT I+EI+R  G  +
Sbjct: 241 ARKTELTAREREMCAAIGPVLREKGLVFVGIDVIGDYMTEINVTSPTGIQEINRLDGVAL 300

Query: 303 ASLFWDGIEKIKET 316
            +L WD IE+ + T
Sbjct: 301 EALLWDAIERRRAT 314


>gi|294085194|ref|YP_003551954.1| glutathione synthetase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664769|gb|ADE39870.1| glutathione synthetase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 330

 Score =  318 bits (815), Expect = 7e-85,   Method: Composition-based stats.
 Identities = 168/314 (53%), Positives = 228/314 (72%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
           K  +IAIQM+ +  + +  D++FA  LEAQ RG+ +++YTPD+L +  S+I A  Q L L
Sbjct: 9   KNLSIAIQMDPVEAIAIAGDTSFAFGLEAQKRGHSLWYYTPDKLSLNASRIEARGQSLQL 68

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++++ ++++G  +I  L+  DV+L+RQDPPF+M YIT+T+LLE + P T++VNNP  +R
Sbjct: 69  FDRQDDHFAVGALEIRPLTDFDVVLMRQDPPFDMAYITATHLLEMLPPTTMVVNNPAEVR 128

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+ VT F ELMPPTLISRD   I  F    +DII+KPL+GNGG GVFR+   D+N 
Sbjct: 129 NAPEKLLVTLFPELMPPTLISRDPATIAAFRATHRDIIVKPLFGNGGAGVFRLREDDQNL 188

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           SSL+EM FE   EP+M+Q+Y+P +  GDKR++L++G+PVGAVNRIP + + RSN H GG 
Sbjct: 189 SSLLEMFFETNREPVMVQAYIPAVTKGDKRVILVDGEPVGAVNRIPQKGEARSNFHVGGS 248

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T LT  DL+IC+ IG  LR R L F GID+IGDYITEINVTSPT IREI R    ++
Sbjct: 249 AAATDLTARDLEICQAIGPELRRRQLLFVGIDIIGDYITEINVTSPTGIREILRLSNIDI 308

Query: 303 ASLFWDGIEKIKET 316
           A+L WD IE+I  T
Sbjct: 309 AALTWDAIERIHPT 322


>gi|126734874|ref|ZP_01750620.1| glutathione synthetase [Roseobacter sp. CCS2]
 gi|126715429|gb|EBA12294.1| glutathione synthetase [Roseobacter sp. CCS2]
          Length = 312

 Score =  318 bits (814), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 153/312 (49%), Positives = 218/312 (69%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IA QM+ I  + +  DSTF IA EAQ RG+Q+F+YTPD+L     ++ A   PL++
Sbjct: 1   MSLKIAFQMDPIGPIDIDADSTFRIAEEAQARGHQLFYYTPDKLAYDQGRVTAKGWPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
              K  +++LG+E+++DLS  DVI +RQDPPF+M YIT+T++L+ ++P+TL+VN+PFW+R
Sbjct: 61  KRVKGDHFALGDEQVVDLSDYDVIWLRQDPPFDMSYITTTHILDMVHPDTLVVNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N PEK+ V +F +L PPT+I+RD+  +  F     D+I+KPLYGNGG GVF++  GD N 
Sbjct: 121 NYPEKLLVLDFPDLTPPTMIARDLETLKTFRETHGDVILKPLYGNGGAGVFKLKQGDSNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL E+      EPL++Q +LP +  GDKR++L++G PVGA+NR+P+  + RSN+H GG+
Sbjct: 181 ASLHELFAGINREPLIMQQFLPDVAKGDKRVILVDGAPVGAINRVPAAGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT  D +IC RIG  LRE+G  F GIDVIGD++TEINVTSPT I+E+ R    N+
Sbjct: 241 PEKVDLTDRDREICARIGPLLREKGQIFVGIDVIGDWLTEINVTSPTGIQELERFDNVNI 300

Query: 303 ASLFWDGIEKIK 314
           A   W  IE  +
Sbjct: 301 AEKIWQAIEAKR 312


>gi|254700764|ref|ZP_05162592.1| glutathione synthetase [Brucella suis bv. 5 str. 513]
 gi|261751272|ref|ZP_05994981.1| glutathione synthetase [Brucella suis bv. 5 str. 513]
 gi|261741025|gb|EEY28951.1| glutathione synthetase [Brucella suis bv. 5 str. 513]
          Length = 312

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 179/312 (57%), Positives = 240/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHYTPD+L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARVEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNLHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEARR 312


>gi|163735271|ref|ZP_02142706.1| glutathione synthetase [Roseobacter litoralis Och 149]
 gi|161391485|gb|EDQ15819.1| glutathione synthetase [Roseobacter litoralis Och 149]
          Length = 313

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 149/307 (48%), Positives = 214/307 (69%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+ +F YTPD L  ++ +I A  Q L +  
Sbjct: 1   MKIAFQMDPIDAVDINADSSFRLAEEAQARGHTLFFYTPDHLAYQEGRITAKGQDLQVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +  + +LG+ + ++L+  DV+ +RQDPPF+M+YITST+LL+++   TL+VN+PFW+RN 
Sbjct: 61  VQGAHATLGDMREVNLADFDVVWLRQDPPFDMNYITSTHLLDRLASTTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD+  I  F  + +D+I+KPLYGNGG GVFR+   DRN +S
Sbjct: 121 PEKLLVLDFPDLTPPTTIARDLDTIKAFKEKHRDVILKPLYGNGGAGVFRLDANDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT  D +IC  IG  L+E+G  F GIDVIGDY+TEINVTSPT I+E+ R    N+A+
Sbjct: 241 KVGLTARDKEICAAIGPLLKEKGQVFVGIDVIGDYLTEINVTSPTGIQELERFDQVNIAA 300

Query: 305 LFWDGIE 311
             W  IE
Sbjct: 301 QIWQAIE 307


>gi|259416262|ref|ZP_05740182.1| glutathione synthase [Silicibacter sp. TrichCH4B]
 gi|259347701|gb|EEW59478.1| glutathione synthase [Silicibacter sp. TrichCH4B]
          Length = 311

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 154/307 (50%), Positives = 213/307 (69%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+++F+Y PDQL  ++ +I A    + +  
Sbjct: 1   MKIAFQMDPIMGVDINADSSFRLAEEAQKRGHELFYYGPDQLAYQEGRITARGHDMVVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
                  LGE + +DL+  DV+ +RQDPPF+MHYITST+LL+++  + L+VN+PFW+RN 
Sbjct: 61  VAGTPAKLGELREVDLADFDVVWLRQDPPFDMHYITSTHLLDRLKDDVLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F EL PPT I+RD+  I  F  +  D+I+KPLYGNGG GVFR+   DRN SS
Sbjct: 121 PEKLLVLDFPELTPPTTIARDLDTIKAFKAKHGDVILKPLYGNGGAGVFRLDANDRNLSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT  DL+IC  IG  L+ERG  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A 
Sbjct: 241 KIGLTDRDLEICAAIGPLLKERGQVFVGIDVIGDYLTEINVTSPTGIQELERFNGVNIAE 300

Query: 305 LFWDGIE 311
             W+ IE
Sbjct: 301 KVWEAIE 307


>gi|15964091|ref|NP_384444.1| glutathione synthetase [Sinorhizobium meliloti 1021]
 gi|307301235|ref|ZP_07580997.1| glutathione synthetase [Sinorhizobium meliloti BL225C]
 gi|307317906|ref|ZP_07597343.1| glutathione synthetase [Sinorhizobium meliloti AK83]
 gi|20138273|sp|Q92SN3|GSHB_RHIME RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|15073267|emb|CAC41775.1| Glutathione synthetase GshB [Sinorhizobium meliloti 1021]
 gi|306896308|gb|EFN27057.1| glutathione synthetase [Sinorhizobium meliloti AK83]
 gi|306903691|gb|EFN34278.1| glutathione synthetase [Sinorhizobium meliloti BL225C]
          Length = 315

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 190/314 (60%), Positives = 249/314 (79%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M  I N+ +QM+H+S + +  DSTFA++LEAQ RGY++FHYTPD+L +RD ++YA  Q +
Sbjct: 1   MAGIVNVGVQMDHVSGITIAGDSTFAMSLEAQARGYRLFHYTPDKLSLRDGRVYATAQQM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + +  +++LGE++ IDLS MDVIL+RQDPPF+M YITST+LLE+++P+TL+VN+P W
Sbjct: 61  QLRDVRGDHFTLGEDERIDLSTMDVILLRQDPPFDMAYITSTHLLERLHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEF +LMP TLI+RD  +I RF  EM DII+KPLYGNGG GVF     DR
Sbjct: 121 VRNSPEKIFVTEFPDLMPKTLITRDPDEIARFRQEMGDIILKPLYGNGGAGVFHSARDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           NFSSL+EM  + + EP + Q YLP +R GDKRILL++G+PVGA+NR+P+E D+RSN+H G
Sbjct: 181 NFSSLLEMFAQMFREPYIAQEYLPAVRKGDKRILLVDGEPVGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T LT  + +IC RIG +L+ERG  F GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATDLTAREREICTRIGPALKERGFLFVGIDVIGDYLTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           +VASL WD IEK +
Sbjct: 301 DVASLLWDAIEKKR 314


>gi|84515918|ref|ZP_01003279.1| glutathione synthetase [Loktanella vestfoldensis SKA53]
 gi|84510360|gb|EAQ06816.1| glutathione synthetase [Loktanella vestfoldensis SKA53]
          Length = 317

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 153/312 (49%), Positives = 212/312 (67%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A QM+ I  + +  DSTF IA EAQ RG+++F+YTPD L     ++ A   PL +
Sbjct: 1   MALKVAFQMDPIGPINIDADSTFRIAEEAQARGHELFYYTPDMLAYDRGRVTARGWPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
              K  ++ LG    +DL  MDV+ +RQDPPF+M YIT+T++L+ I+P TL+VN+PFW+R
Sbjct: 61  QRVKGDHFRLGAPAELDLRAMDVVWLRQDPPFDMGYITTTHILDMIHPATLVVNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEK+ V  F +L PPT+I+RD+  +  F  E  D+I+KPLYGNGG GVF+++ GD N 
Sbjct: 121 NSPEKLLVLNFPDLTPPTMIARDLQTLRAFREEYGDVILKPLYGNGGAGVFKLSAGDANL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL E+      EPL++Q +LP +  GDKRI+L++G P GA+NR+P+  + RSN+H GG+
Sbjct: 181 ASLHELFAGINREPLIMQQFLPAVSKGDKRIILVDGDPAGAINRVPAAGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT  D +IC RIG  LRE+G  F GIDVIGD++TEINVTSPT I+E+ R  G N+
Sbjct: 241 PEKVALTDRDREICARIGPVLREKGQVFVGIDVIGDWLTEINVTSPTGIQELERFDGVNI 300

Query: 303 ASLFWDGIEKIK 314
           A   W  IE  +
Sbjct: 301 AEKIWQAIESRR 312


>gi|163740698|ref|ZP_02148092.1| glutathione synthetase [Phaeobacter gallaeciensis 2.10]
 gi|161386556|gb|EDQ10931.1| glutathione synthetase [Phaeobacter gallaeciensis 2.10]
          Length = 310

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 152/307 (49%), Positives = 210/307 (68%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I+ V +  DS+F +A EAQ RG+ +F Y PDQL  ++ +I A    +++  
Sbjct: 1   MKIAFQMDPITDVDINADSSFRLAEEAQARGHSLFFYGPDQLAYQEGRITARGHDMTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
                  LG  +  DLS  DV+ +RQDPPF+MHYITST+LL+++  +TL+VN+PFW+RN 
Sbjct: 61  VAGTPAELGPRREADLSDFDVVWLRQDPPFDMHYITSTHLLDRLKGQTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F EL PPT ++RD+  I  F  +  DII+KPLYGNGG GVFR+   DRN +S
Sbjct: 121 PEKLLVLDFPELTPPTTVARDLDTIKAFKEKHGDIILKPLYGNGGAGVFRLDANDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              L+  D +IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A 
Sbjct: 241 KISLSDRDREICAAIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGVNIAE 300

Query: 305 LFWDGIE 311
             W  IE
Sbjct: 301 KIWQAIE 307


>gi|239833179|ref|ZP_04681508.1| glutathione synthase [Ochrobactrum intermedium LMG 3301]
 gi|239825446|gb|EEQ97014.1| glutathione synthase [Ochrobactrum intermedium LMG 3301]
          Length = 312

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 180/312 (57%), Positives = 242/312 (77%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG++++HYTPD+L MRD  + A  + L +
Sbjct: 1   MALKVAVQMDHISTVNIAGDTTFALSLEAQKRGHELYHYTPDRLSMRDGVVSARLEKLEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DLS+MDV+L+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDIKGDHYTLGEPIRRDLSEMDVVLLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFKEPFIAQRYLKDVRAGDKRIILIDGEPVGAINRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE +KLT  + +IC+RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 AEQSKLTPREREICERIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIQRFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEAKR 312


>gi|256060096|ref|ZP_05450278.1| glutathione synthetase [Brucella neotomae 5K33]
 gi|256370529|ref|YP_003108040.1| glutathione synthetase [Brucella microti CCM 4915]
 gi|261324071|ref|ZP_05963268.1| glutathione synthetase [Brucella neotomae 5K33]
 gi|294851360|ref|ZP_06792033.1| glutathione synthase [Brucella sp. NVSL 07-0026]
 gi|306843551|ref|ZP_07476152.1| glutathione synthase [Brucella sp. BO1]
 gi|256000692|gb|ACU49091.1| glutathione synthetase [Brucella microti CCM 4915]
 gi|261300051|gb|EEY03548.1| glutathione synthetase [Brucella neotomae 5K33]
 gi|294819949|gb|EFG36948.1| glutathione synthase [Brucella sp. NVSL 07-0026]
 gi|306276242|gb|EFM57942.1| glutathione synthase [Brucella sp. BO1]
          Length = 312

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 179/312 (57%), Positives = 240/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHYTPD+L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARVEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEARR 312


>gi|163736880|ref|ZP_02144298.1| glutathione synthetase [Phaeobacter gallaeciensis BS107]
 gi|161389484|gb|EDQ13835.1| glutathione synthetase [Phaeobacter gallaeciensis BS107]
          Length = 310

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 152/310 (49%), Positives = 211/310 (68%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I+ V +  DS+F +A EAQ RG+ +F Y PDQL  ++ +I A    +++  
Sbjct: 1   MKIAFQMDPITDVDINADSSFRLAEEAQARGHSLFFYGPDQLAYQEGRITARGHDMTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
                  LG  + +DLS  DV+ +RQDPPF+MHYITST+LL+++  +TL+VN+PFW+RN 
Sbjct: 61  VAGTPAELGPRREVDLSDFDVVWLRQDPPFDMHYITSTHLLDRLKGQTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F EL PPT ++RD+  I  F  +  DII+KPLYGNGG GVFR+   DRN +S
Sbjct: 121 PEKLLVLDFPELTPPTTVARDLDTIKAFKEKHGDIILKPLYGNGGAGVFRLDANDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              L+  D +IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A 
Sbjct: 241 KISLSDRDREICAAIGPLLREKGQVFVGIDVIGDYLTEINVTSPTGIQELERFDGVNIAE 300

Query: 305 LFWDGIEKIK 314
             W  IE   
Sbjct: 301 KIWQAIESKL 310


>gi|254477425|ref|ZP_05090811.1| glutathione synthase [Ruegeria sp. R11]
 gi|214031668|gb|EEB72503.1| glutathione synthase [Ruegeria sp. R11]
          Length = 310

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 155/310 (50%), Positives = 215/310 (69%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ IS V +  DS+F +A EAQ RG+++F Y PDQL  ++ +I A  Q +++  
Sbjct: 1   MKIAFQMDPISAVDINADSSFRLAEEAQARGHELFFYGPDQLAYQEGRITARGQDMTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
                  LG E+ +DL+  DV+ +RQDPPF+MHYITST+LL+++   TL+VN+PFW+RN 
Sbjct: 61  VPGTPAVLGPEREVDLADFDVVWLRQDPPFDMHYITSTHLLDRLKGTTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD+  I  F  +  DII+KPLYGNGG GVFR+   DRN +S
Sbjct: 121 PEKLLVLDFPDLTPPTTIARDLQTIKAFKEKHGDIILKPLYGNGGAGVFRLDANDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              L++ DL+IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A 
Sbjct: 241 KIGLSERDLEICAAIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGVNIAE 300

Query: 305 LFWDGIEKIK 314
             W  IE   
Sbjct: 301 KIWQAIEAKV 310


>gi|254718174|ref|ZP_05179985.1| glutathione synthetase [Brucella sp. 83/13]
 gi|265983129|ref|ZP_06095864.1| glutathione synthetase [Brucella sp. 83/13]
 gi|306837689|ref|ZP_07470558.1| glutathione synthase [Brucella sp. NF 2653]
 gi|264661721|gb|EEZ31982.1| glutathione synthetase [Brucella sp. 83/13]
 gi|306407247|gb|EFM63457.1| glutathione synthase [Brucella sp. NF 2653]
          Length = 312

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 179/312 (57%), Positives = 240/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHYTPD+L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARVEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRCDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEMMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFKEPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEARR 312


>gi|110678521|ref|YP_681528.1| glutathione synthetase [Roseobacter denitrificans OCh 114]
 gi|109454637|gb|ABG30842.1| glutathione synthase [Roseobacter denitrificans OCh 114]
          Length = 313

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 149/307 (48%), Positives = 213/307 (69%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+ +F YTPD L  ++ +I A  Q L +  
Sbjct: 1   MKIAFQMDPIDAVDINADSSFRLAEEAQARGHTLFFYTPDHLAYQEGRITAKGQDLQVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +  + +LG  + ++L++ DV+ +RQDPPF+MHYITST+LL+++   TL+VN+PFW+RN 
Sbjct: 61  VQGAHATLGAMREVNLAEFDVVWLRQDPPFDMHYITSTHLLDRLASTTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD+  I  F  +  D+I+KPLYGNGG GVFR+   DRN +S
Sbjct: 121 PEKLLVLDFPDLTPPTTIARDLDTIKAFKAKHGDVILKPLYGNGGAGVFRLDANDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              L+  D +IC  IG  L+E+G  F GIDVIGDY+TEINVTSPT I+E+ R    N+A+
Sbjct: 241 KVGLSARDKEICAAIGPLLKEKGQVFVGIDVIGDYLTEINVTSPTGIQELERFDQVNIAA 300

Query: 305 LFWDGIE 311
             W  IE
Sbjct: 301 HIWQAIE 307


>gi|89069002|ref|ZP_01156383.1| glutathione synthetase [Oceanicola granulosus HTCC2516]
 gi|89045371|gb|EAR51436.1| glutathione synthetase [Oceanicola granulosus HTCC2516]
          Length = 313

 Score =  316 bits (809), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 153/312 (49%), Positives = 222/312 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+AIQM+ I  + ++ DSTF IA EAQ RG+++F+YTPD++   + ++ A   PL++
Sbjct: 1   MPLNVAIQMDPIEPIDIEADSTFRIAEEAQARGHRLFYYTPDRIAYDEGRVTARGWPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
              +  ++ LGEE+ +DL++ DV+ +RQDPPF+M YIT+T+LL+++   TL+VN PFW+R
Sbjct: 61  QRVEGDHFRLGEEQEVDLAEFDVVWLRQDPPFDMGYITTTHLLDRLRDTTLVVNEPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N PEK+ V +F +L PPT+I+RD+  + RF     DII+KPLYGNGG GVF++   D N 
Sbjct: 121 NYPEKLLVLDFPDLTPPTMIARDLAALRRFRDRHGDIILKPLYGNGGAGVFKLHRDDGNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL E+      EPL+ Q +LP +  GDKR++L++G P+GA+NR+P+  + RSN+H GG+
Sbjct: 181 ASLYELFTSMSREPLIAQKFLPDVTRGDKRVILVDGVPIGAINRVPAAGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE  +LT  D +ICKRIG  LRE+G  F GIDVIGDY+TEINVTSPT ++E+ R  G N 
Sbjct: 241 AEKVELTARDREICKRIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGLQELERFDGTNG 300

Query: 303 ASLFWDGIEKIK 314
           A+  W+ IE  +
Sbjct: 301 AAKIWEAIEARR 312


>gi|17988279|ref|NP_540913.1| glutathione synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|256045738|ref|ZP_05448616.1| glutathione synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563035|ref|ZP_05833521.1| glutathione synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|265992154|ref|ZP_06104711.1| glutathione synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|25008524|sp|Q8YE82|GSHB_BRUME RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|17984049|gb|AAL53177.1| glutathione synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|260153051|gb|EEW88143.1| glutathione synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|263003220|gb|EEZ15513.1| glutathione synthetase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 312

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 179/312 (57%), Positives = 239/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHYTPD L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDWLSMRDGVVSARVEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPTWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEARR 312


>gi|221638218|ref|YP_002524480.1| glutathione synthetase [Rhodobacter sphaeroides KD131]
 gi|221158999|gb|ACL99978.1| Glutathione synthase [Rhodobacter sphaeroides KD131]
          Length = 316

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 158/315 (50%), Positives = 216/315 (68%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M+   N+A+QM+ I +V +  DSTF IALEAQ RG+++F YTPD L   D ++ A    +
Sbjct: 1   MRMSLNVALQMDPIGSVNIDADSTFRIALEAQARGHRLFFYTPDHLAYDDGRVTARGSWI 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L  +K  + S GE   +DL   DV+ +RQDPPF+M YIT+T++LE + PE L+VN+PFW
Sbjct: 61  ELRREKGNHVSYGETTTVDLGGFDVVWLRQDPPFDMGYITTTHILELLMPEVLVVNDPFW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RN+PEK+ V  F +L+PPT I+RD+T I  F     DII+KPLYGNGG GVFR+   DR
Sbjct: 121 VRNAPEKLLVLRFPDLIPPTTIARDLTTIRAFKERHGDIILKPLYGNGGAGVFRLDPNDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL E+      EPL+ Q +LP +  GDKRI+L++G+P+GA+NR+P   + RSN+H G
Sbjct: 181 NLSSLHELFTSMSREPLIAQKFLPAVEKGDKRIILVDGEPIGAINRVPQAGETRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE   LT  D +IC  +G  LRE+G  F GIDVIGD++TEINVTSPT ++E+ R  G 
Sbjct: 241 GRAEKVNLTDRDREICAALGPVLREKGQIFVGIDVIGDWLTEINVTSPTGLQELERFDGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N A+  W+ IE  + 
Sbjct: 301 NGAARIWEVIEARRR 315


>gi|225626502|ref|ZP_03784541.1| glutathione synthase [Brucella ceti str. Cudo]
 gi|254709109|ref|ZP_05170920.1| glutathione synthetase [Brucella pinnipedialis B2/94]
 gi|254713465|ref|ZP_05175276.1| glutathione synthetase [Brucella ceti M644/93/1]
 gi|254716179|ref|ZP_05177990.1| glutathione synthetase [Brucella ceti M13/05/1]
 gi|256030635|ref|ZP_05444249.1| glutathione synthetase [Brucella pinnipedialis M292/94/1]
 gi|256254041|ref|ZP_05459577.1| glutathione synthetase [Brucella ceti B1/94]
 gi|260169539|ref|ZP_05756350.1| glutathione synthetase [Brucella sp. F5/99]
 gi|261217951|ref|ZP_05932232.1| glutathione synthetase [Brucella ceti M13/05/1]
 gi|261221180|ref|ZP_05935461.1| glutathione synthetase [Brucella ceti B1/94]
 gi|261316608|ref|ZP_05955805.1| glutathione synthetase [Brucella pinnipedialis B2/94]
 gi|261321199|ref|ZP_05960396.1| glutathione synthetase [Brucella ceti M644/93/1]
 gi|261759065|ref|ZP_06002774.1| glutathione synthetase [Brucella sp. F5/99]
 gi|265987680|ref|ZP_06100237.1| glutathione synthetase [Brucella pinnipedialis M292/94/1]
 gi|225618159|gb|EEH15202.1| glutathione synthase [Brucella ceti str. Cudo]
 gi|260919764|gb|EEX86417.1| glutathione synthetase [Brucella ceti B1/94]
 gi|260923040|gb|EEX89608.1| glutathione synthetase [Brucella ceti M13/05/1]
 gi|261293889|gb|EEX97385.1| glutathione synthetase [Brucella ceti M644/93/1]
 gi|261295831|gb|EEX99327.1| glutathione synthetase [Brucella pinnipedialis B2/94]
 gi|261739049|gb|EEY27045.1| glutathione synthetase [Brucella sp. F5/99]
 gi|264659877|gb|EEZ30138.1| glutathione synthetase [Brucella pinnipedialis M292/94/1]
          Length = 312

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 179/312 (57%), Positives = 240/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHYTPD+L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARMEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEARR 312


>gi|77462359|ref|YP_351863.1| glutathione synthetase [Rhodobacter sphaeroides 2.4.1]
 gi|77386777|gb|ABA77962.1| glutathione synthase [Rhodobacter sphaeroides 2.4.1]
          Length = 316

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 157/315 (49%), Positives = 215/315 (68%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M+   N+A+QM+ I +V +  DSTF IALEAQ RG+++F YTPD L   D ++ A    +
Sbjct: 1   MRMSLNVALQMDPIGSVNIDADSTFRIALEAQARGHRLFFYTPDHLAYDDGRVTARGAWI 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L  +K  + S GE   +DL   DV+ +RQDPPF+M YIT+T++LE + PE L+VN+PFW
Sbjct: 61  ELRREKGNHVSYGETTTVDLGDFDVVWLRQDPPFDMGYITTTHILELLMPEVLVVNDPFW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RN+PEK+ V  F +L+PPT I+RD+  I  F     DII+KPLYGNGG GVFR+   DR
Sbjct: 121 VRNAPEKLLVLRFPDLIPPTTIARDLATIRAFKERHGDIILKPLYGNGGAGVFRLDPNDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL E+      EPL+ Q +LP +  GDKRI+L++G+P+GA+NR+P   + RSN+H G
Sbjct: 181 NLSSLHELFTSMSREPLIAQKFLPAVEKGDKRIILVDGEPIGAINRVPQAGETRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE   LT  D +IC  +G  LRE+G  F GIDVIGD++TEINVTSPT ++E+ R  G 
Sbjct: 241 GRAEKVSLTDRDREICAALGPVLREKGQIFVGIDVIGDWLTEINVTSPTGLQELERFDGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N A+  W+ IE  + 
Sbjct: 301 NGAARIWEVIEARRR 315


>gi|153008119|ref|YP_001369334.1| glutathione synthetase [Ochrobactrum anthropi ATCC 49188]
 gi|151560007|gb|ABS13505.1| glutathione synthetase [Ochrobactrum anthropi ATCC 49188]
          Length = 312

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 179/312 (57%), Positives = 242/312 (77%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG++++HYTPD+L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNIAGDTTFALSLEAQKRGHELYHYTPDRLSMRDGVVSARLEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DLS+MDV+L+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPIRRDLSEMDVVLLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFKEPFIAQRYLKDVRAGDKRIILIDGEPVGAINRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE +KLT  + +IC+RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 AEQSKLTPREREICERIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIQRFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEAKR 312


>gi|225853559|ref|YP_002733792.1| glutathione synthetase [Brucella melitensis ATCC 23457]
 gi|256112458|ref|ZP_05453379.1| glutathione synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|256262956|ref|ZP_05465488.1| glutathione synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|265993891|ref|ZP_06106448.1| glutathione synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|225641924|gb|ACO01838.1| glutathione synthase [Brucella melitensis ATCC 23457]
 gi|262764872|gb|EEZ10793.1| glutathione synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|263092831|gb|EEZ17006.1| glutathione synthetase [Brucella melitensis bv. 2 str. 63/9]
          Length = 312

 Score =  315 bits (808), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 179/312 (57%), Positives = 239/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHYTPD L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDWLSMRDGVVSARVEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEARR 312


>gi|56695316|ref|YP_165664.1| glutathione synthetase [Ruegeria pomeroyi DSS-3]
 gi|56677053|gb|AAV93719.1| glutathione synthetase [Ruegeria pomeroyi DSS-3]
          Length = 310

 Score =  315 bits (807), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 156/307 (50%), Positives = 212/307 (69%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+++F+Y PDQL  ++ +I A    +++  
Sbjct: 1   MKIAFQMDPIGAVNINADSSFRLAEEAQARGHELFYYGPDQLAYQEGRITARGHDMTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
                  LG  + +DL++ DV+ +RQDPPF+MHYITST+LL+++  +TL+VN+PFW+RN 
Sbjct: 61  VAGDPAVLGPLREVDLAEFDVVWLRQDPPFDMHYITSTHLLDRLKGQTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V  F EL PPT I+RD+  I  F     DII+KPLYGNGG GVFR+   DRN SS
Sbjct: 121 PEKLLVLNFPELTPPTTIARDLDTIRAFKARHGDIILKPLYGNGGAGVFRLDENDRNLSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q YLP +R GDKR++L++G+ VGA+NR+P+E + RSN+H GG+ E
Sbjct: 181 LHELFVGFSREPLIVQKYLPDVRKGDKRVILVDGEAVGAINRVPAEGEVRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT  D +IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A 
Sbjct: 241 KIGLTDRDREICTAIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGGNIAG 300

Query: 305 LFWDGIE 311
             W+ IE
Sbjct: 301 RIWEAIE 307


>gi|300024723|ref|YP_003757334.1| glutathione synthetase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526544|gb|ADJ25013.1| glutathione synthetase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 316

 Score =  315 bits (807), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 160/312 (51%), Positives = 226/312 (72%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IA+QM+ I  + +K DSTFAI LEAQ RG+ IF+YTP  L +   K+ A  Q L++
Sbjct: 1   MPLRIAVQMDPIDRIDIKGDSTFAILLEAQKRGHDIFYYTPADLSLHGDKLLARGQSLNV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
           ++K   +++L   ++ +L  +DV+L+RQDPPF+M YIT+T+LLE+I+P+TL+VN+P  +R
Sbjct: 61  EDKHGAHFALSNARVENLGDLDVVLLRQDPPFDMAYITTTHLLERIHPKTLVVNDPAHVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F +LMPPTL++R +  +  F  E KDIIIKPLYGNGG  VFRI   D N 
Sbjct: 121 NAPEKLFVLDFLDLMPPTLVTRSLADVQAFRKEYKDIIIKPLYGNGGAAVFRIKPDDGNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+E+    + EP M+Q + P+++DGDKRI+L++G+  GA+NR+P   + RSN+H GG 
Sbjct: 181 ASLVELFQTVFREPFMVQEFRPEVKDGDKRIILVDGEVAGALNRVPQAGETRSNLHVGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A   KLTK D +IC R+   L++RGL FTGIDVIG Y+TEINVTSPT IR++   GG ++
Sbjct: 241 AVAAKLTKRDEEICARLKPELKKRGLIFTGIDVIGPYLTEINVTSPTGIRQVKAFGGNDI 300

Query: 303 ASLFWDGIEKIK 314
           A++ WD IEK K
Sbjct: 301 AAMIWDVIEKKK 312


>gi|159184250|ref|NP_353341.2| glutathione synthetase [Agrobacterium tumefaciens str. C58]
 gi|25008523|sp|Q8UII5|GSHB_AGRT5 RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|159139577|gb|AAK86126.2| glutathione synthetase [Agrobacterium tumefaciens str. C58]
          Length = 319

 Score =  315 bits (806), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 195/315 (61%), Positives = 254/315 (80%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI+N+AIQM+H+S + +  DSTFAI+LEAQ RGY++FHYTP++L MRD KIYA  + +
Sbjct: 1   MAKIKNVAIQMDHVSGINIAGDSTFAISLEAQARGYRLFHYTPERLSMRDGKIYATVEQM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  ++SL E + +DLS MDVI +RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  ELRDIKGDHFSLSEPERVDLSTMDVIHLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEF++LMP TLI++D+++I RF  EM DII+KPLYGNGG GVF     DR
Sbjct: 121 VRNSPEKIFVTEFADLMPKTLITKDVSEIARFRNEMGDIILKPLYGNGGAGVFHSARDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           NFSSL+EM  + + EP + Q YLP +R GDKRILL++G+PVGA+NR+P+E D RSN+HAG
Sbjct: 181 NFSSLLEMFGQMFREPYIAQEYLPDVRKGDKRILLVDGEPVGAINRVPAENDARSNMHAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E T+LT  + +IC+RIG +LRERG  F GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRPEPTELTAREQEICRRIGPALRERGFLFVGIDVIGDYMTEINVTSPTGIREVRKFGGA 300

Query: 301 NVASLFWDGIEKIKE 315
           +VASL WD IEK ++
Sbjct: 301 DVASLLWDAIEKKRD 315


>gi|62290971|ref|YP_222764.1| glutathione synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82700882|ref|YP_415456.1| glutathione synthetase [Brucella melitensis biovar Abortus 2308]
 gi|189025185|ref|YP_001935953.1| glutathione synthetase [Brucella abortus S19]
 gi|237816476|ref|ZP_04595469.1| glutathione synthase [Brucella abortus str. 2308 A]
 gi|254690267|ref|ZP_05153521.1| glutathione synthetase [Brucella abortus bv. 6 str. 870]
 gi|254694754|ref|ZP_05156582.1| glutathione synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|254696383|ref|ZP_05158211.1| glutathione synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731297|ref|ZP_05189875.1| glutathione synthetase [Brucella abortus bv. 4 str. 292]
 gi|256258520|ref|ZP_05464056.1| glutathione synthetase [Brucella abortus bv. 9 str. C68]
 gi|260546236|ref|ZP_05821976.1| glutathione synthetase [Brucella abortus NCTC 8038]
 gi|260755805|ref|ZP_05868153.1| GSH synthetase [Brucella abortus bv. 6 str. 870]
 gi|260759028|ref|ZP_05871376.1| GSH synthetase [Brucella abortus bv. 4 str. 292]
 gi|260760753|ref|ZP_05873096.1| GSH synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884830|ref|ZP_05896444.1| glutathione synthetase [Brucella abortus bv. 9 str. C68]
 gi|261215079|ref|ZP_05929360.1| GSH synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|297247357|ref|ZP_06931075.1| glutathione synthase [Brucella abortus bv. 5 str. B3196]
 gi|62197103|gb|AAX75403.1| GshB, glutathione synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82616983|emb|CAJ12091.1| Prokaryotic glutathione synthetase, N-terminal:Prokaryotic
           glutathione synthetase ATP-binding domain:Glutathione
           synthetase [Brucella melitensis biovar Abortus 2308]
 gi|189020757|gb|ACD73479.1| glutathione synthetase [Brucella abortus S19]
 gi|237788543|gb|EEP62758.1| glutathione synthase [Brucella abortus str. 2308 A]
 gi|260096343|gb|EEW80219.1| glutathione synthetase [Brucella abortus NCTC 8038]
 gi|260669346|gb|EEX56286.1| GSH synthetase [Brucella abortus bv. 4 str. 292]
 gi|260671185|gb|EEX58006.1| GSH synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675913|gb|EEX62734.1| GSH synthetase [Brucella abortus bv. 6 str. 870]
 gi|260874358|gb|EEX81427.1| glutathione synthetase [Brucella abortus bv. 9 str. C68]
 gi|260916686|gb|EEX83547.1| GSH synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|297174526|gb|EFH33873.1| glutathione synthase [Brucella abortus bv. 5 str. B3196]
          Length = 312

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 178/312 (57%), Positives = 240/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHYTPD+L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARVEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFW+ +E  +
Sbjct: 301 AALFWNAVEARR 312


>gi|89053392|ref|YP_508843.1| glutathione synthetase [Jannaschia sp. CCS1]
 gi|88862941|gb|ABD53818.1| glutathione synthase [Jannaschia sp. CCS1]
          Length = 314

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 150/307 (48%), Positives = 217/307 (70%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+ +  YTPD L+ R+ K+ A  + +S+  
Sbjct: 1   MLIAFQMDPIEDVDIDADSSFRLAEEAQARGHDLMVYTPDDLFYREDKVCARARRISVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            K  +      +I+DL+++DVI +RQDPPF+M YIT+T+LL+++  +TL+VN+PFW+RNS
Sbjct: 61  VKGDHVVAQAPEIVDLAEVDVIWLRQDPPFDMGYITTTHLLDRLRDKTLVVNDPFWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V ++ +L PPT+I+RDI  +  F  E  D+I+KPLYGNGG GVFR+T  DRN +S
Sbjct: 121 PEKLMVLDYPDLTPPTMIARDIDMLKAFKEEHGDVILKPLYGNGGAGVFRLTPEDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP +  GDKR++L++G+PVG +NR+P++ + RSN+H GG+ E
Sbjct: 181 LHELFTGINREPLIMQKFLPDVSAGDKRVILVDGEPVGGINRVPAKGEVRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
            T LT+ + +IC  IG  L+E G  F GIDVIG ++TEINVTSPT I+E+ R  G N+A+
Sbjct: 241 ATALTEREREICAIIGPRLKEMGQVFVGIDVIGGWLTEINVTSPTGIQELERFDGVNIAA 300

Query: 305 LFWDGIE 311
             WD IE
Sbjct: 301 RIWDAIE 307


>gi|99080291|ref|YP_612445.1| glutathione synthetase [Ruegeria sp. TM1040]
 gi|99036571|gb|ABF63183.1| glutathione synthase [Ruegeria sp. TM1040]
          Length = 311

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 154/307 (50%), Positives = 216/307 (70%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V V  DS+F +A EAQ RG+++F+Y+PDQL  ++ +I A    + +  
Sbjct: 1   MKIAFQMDPIMGVDVNADSSFRLAEEAQKRGHELFYYSPDQLAYQEGRITARGHDMVVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +    +LGE + +DL+  DVI +RQDPPF+MHYITST+LL+++  + L+VN+PFW+RN 
Sbjct: 61  VEGTPATLGELREVDLADFDVIWLRQDPPFDMHYITSTHLLDRLKGQALVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V  F +L PPT I+RD+  I  F  +  D+I+KPLYGNGG GVFR+   DRN SS
Sbjct: 121 PEKLLVLNFPDLTPPTTIARDLETIKAFKAKHGDVILKPLYGNGGAGVFRLDANDRNLSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ DL+IC  IG  L+E+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A 
Sbjct: 241 KIGLTERDLEICAAIGPLLKEKGQVFVGIDVIGDYLTEINVTSPTGIQELERFNGVNIAE 300

Query: 305 LFWDGIE 311
             W+ IE
Sbjct: 301 KVWEAIE 307


>gi|126724983|ref|ZP_01740826.1| glutathione synthetase [Rhodobacterales bacterium HTCC2150]
 gi|126706147|gb|EBA05237.1| glutathione synthetase [Rhodobacterales bacterium HTCC2150]
          Length = 313

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 153/309 (49%), Positives = 215/309 (69%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IA+QM+ +  + +  DS+F IA EAQ RG+ +F+YTPD++  +  KI A  Q ++L
Sbjct: 1   MALKIALQMDPLGPIDINADSSFRIAEEAQARGHSLFYYTPDKISFQSGKIMARGQDITL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             +   +++ GE + ++L+  DVI +RQDPPF+M YIT+T+LL+ +  ETL+VN+PFW+R
Sbjct: 61  RREVGNHFTAGEMREVNLADWDVIWLRQDPPFDMGYITTTHLLDFLEGETLVVNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N PEK+ V  F +L PPT I+RD+  +  F  E  DII+KPLYGNGG GVFR+   DRN 
Sbjct: 121 NYPEKLLVLHFPDLTPPTTIARDLDTLKAFKEEHGDIILKPLYGNGGAGVFRLGPDDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL E+      EPL+ Q +LP +  GDKR++L++G+PVGA+NR+P+  + RSN+H GG+
Sbjct: 181 NSLHELFTSINNEPLIAQKFLPDVSKGDKRVILIDGEPVGAINRVPAAGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT+ DL+IC  IG  LRE+G  F GIDVIG ++TEINVTSPT I+E+ R  G NV
Sbjct: 241 PEKVDLTERDLEICAAIGPLLREKGQVFVGIDVIGGWLTEINVTSPTGIQELERFDGINV 300

Query: 303 ASLFWDGIE 311
           A+  WD IE
Sbjct: 301 AATIWDAIE 309


>gi|312114388|ref|YP_004011984.1| glutathione synthetase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219517|gb|ADP70885.1| glutathione synthetase [Rhodomicrobium vannielii ATCC 17100]
          Length = 318

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 155/314 (49%), Positives = 224/314 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
                 +QM+ I  + +  DSTFA+ LEAQ R + IF+YTPD+L +R  + +A    L +
Sbjct: 1   MRLKTGVQMDPIEKINIWGDSTFALLLEAQKRQHSIFYYTPDKLILRGGRAFAEGHELRV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  ++ LG  + + L ++DVI +RQDPPF+M YIT+T++L+ ++P+TL+VN+P  +R
Sbjct: 61  HDIEGAHFELGARQKLALDELDVIHLRQDPPFDMAYITTTHILDSVHPKTLVVNDPTSVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FVT+F +LMPPTLI+R +  +T F  E  DII+KPLYGNGG  VFRI   D N 
Sbjct: 121 NAPEKLFVTQFPDLMPPTLIARTLGDVTAFREEFGDIIVKPLYGNGGAAVFRIKPDDTNT 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL+E+    + EP ++Q YLP +R GDKRI+L++G+PVGA+NR+P+  + RSN+H GG+
Sbjct: 181 GSLVELFQTVFREPFVVQRYLPDVRAGDKRIILVDGEPVGAINRVPAANETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E T+LT  + +IC  IG  L++RGL F GIDVIGDY+TEINVTSPT IRE+ R GG ++
Sbjct: 241 PEATELTPREREICAAIGPELKKRGLIFVGIDVIGDYLTEINVTSPTGIREVKRFGGADI 300

Query: 303 ASLFWDGIEKIKET 316
           A+L WD +E+   +
Sbjct: 301 AALVWDVVEEKVRS 314


>gi|23502979|ref|NP_699106.1| glutathione synthetase [Brucella suis 1330]
 gi|161620043|ref|YP_001593930.1| glutathione synthetase [Brucella canis ATCC 23365]
 gi|163844147|ref|YP_001628552.1| glutathione synthetase [Brucella suis ATCC 23445]
 gi|254705135|ref|ZP_05166963.1| glutathione synthetase [Brucella suis bv. 3 str. 686]
 gi|260567397|ref|ZP_05837867.1| glutathione synthetase [Brucella suis bv. 4 str. 40]
 gi|261755837|ref|ZP_05999546.1| glutathione synthetase [Brucella suis bv. 3 str. 686]
 gi|29611773|sp|Q8FXW6|GSHB_BRUSU RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|23349017|gb|AAN31021.1| glutathione synthetase [Brucella suis 1330]
 gi|161336854|gb|ABX63159.1| glutathione synthase [Brucella canis ATCC 23365]
 gi|163674870|gb|ABY38981.1| glutathione synthase [Brucella suis ATCC 23445]
 gi|260156915|gb|EEW91995.1| glutathione synthetase [Brucella suis bv. 4 str. 40]
 gi|261745590|gb|EEY33516.1| glutathione synthetase [Brucella suis bv. 3 str. 686]
          Length = 312

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 178/312 (57%), Positives = 239/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHY PD+L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYAPDRLSMRDGVVSARVEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEARR 312


>gi|148560652|ref|YP_001259930.1| glutathione synthetase [Brucella ovis ATCC 25840]
 gi|148371909|gb|ABQ61888.1| glutathione synthase [Brucella ovis ATCC 25840]
          Length = 312

 Score =  313 bits (803), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 179/312 (57%), Positives = 239/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHYTPD+L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARVEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT    +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPRKREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEARR 312


>gi|114326776|ref|YP_743933.1| glutathione synthetase [Granulibacter bethesdensis CGDNIH1]
 gi|114314950|gb|ABI61010.1| glutathione synthetase [Granulibacter bethesdensis CGDNIH1]
          Length = 329

 Score =  313 bits (803), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 157/324 (48%), Positives = 223/324 (68%), Gaps = 10/324 (3%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDS--------- 51
           M     +A+QM+ + ++ +  DS+FA+ LEAQ RG+ ++HY    + +R+          
Sbjct: 1   MAGGLRVAVQMDPMDSINIAGDSSFALMLEAQARGHALWHYEVRHMALREGGQWQDGSTG 60

Query: 52  -KIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP 110
            ++ A   P+S+      YY+ G  +I+DL+ MDV+L+RQDPPF+M YIT+T++LE I+P
Sbjct: 61  ARLLARAHPVSVRRIDAAYYTFGPTEILDLATMDVVLMRQDPPFDMAYITATHMLEHIHP 120

Query: 111 ETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGT 170
            TL+VN+P  +RN+PEKI VT F +LMPPTL++ D+  I  F  E +DI++KPLYGNGG 
Sbjct: 121 HTLVVNDPAGVRNAPEKILVTHFPDLMPPTLVTWDVEAIRAFRAEHRDIVVKPLYGNGGA 180

Query: 171 GVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSE 230
           GVFR+   D N  SL+EM F +  EPLM+Q Y   +R GDKRI+L++G+PVGA+NR+P+ 
Sbjct: 181 GVFRVKEDDENLGSLLEMFFSRSREPLMVQRYEAAVRQGDKRIILIDGEPVGAINRVPAA 240

Query: 231 VDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTC 290
            ++RSN+H GG+ E   LT  D +IC  IG  L+ERGL F GIDVIG+++TEINVTSPT 
Sbjct: 241 GESRSNMHVGGRPEAAGLTARDREICAAIGPVLKERGLIFAGIDVIGNWLTEINVTSPTG 300

Query: 291 IREIHRNGGENVASLFWDGIEKIK 314
           ++EI R  G N+A+  WD IE  K
Sbjct: 301 LQEIGRFDGVNLAARIWDAIESRK 324


>gi|288939956|ref|YP_003442196.1| glutathione synthetase [Allochromatium vinosum DSM 180]
 gi|288895328|gb|ADC61164.1| glutathione synthetase [Allochromatium vinosum DSM 180]
          Length = 323

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 123/310 (39%), Positives = 187/310 (60%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               I   M+ I ++++K+DSTFA+ L AQ RG+ +++     L + D +  A  + + +
Sbjct: 1   MNIRIGFVMDPIGSIRIKKDSTFAMLLAAQRRGWSLWYMEVGDLSLLDGQAMARMRAVEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            +    ++ LGEE    L  +D +L+R+DPPF+M Y+ +TYLLE+      L+VN+P  +
Sbjct: 61  VDDPLGWFRLGEEVERPLDWLDTLLMRKDPPFDMEYVYTTYLLERAQQAGCLVVNDPRSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   F +  PPTL++R    I  F  E  +I+IKPL+G GG  +FR+   D N
Sbjct: 121 RDANEKVFTAVFPQCAPPTLVTRQARDIRAFQAEHGEIVIKPLHGMGGASIFRLRPDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S +IE L +      M+Q ++P+I  GDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVVIETLTQHGRTFCMVQRFIPEIETGDKRILMVDGEPVPYCLARIPAPGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
             AE   L+  D  I +++G  LR RG+ F G+DVIGDY+TEINVTSPTCIRE+      
Sbjct: 241 ASAEARPLSARDRWIAEQVGPELRARGILFAGLDVIGDYLTEINVTSPTCIRELDAAYDL 300

Query: 301 NVASLFWDGI 310
           ++A    D I
Sbjct: 301 DIAGDLMDCI 310


>gi|254707348|ref|ZP_05169176.1| glutathione synthetase [Brucella pinnipedialis M163/99/10]
 gi|261314833|ref|ZP_05954030.1| glutathione synthetase [Brucella pinnipedialis M163/99/10]
 gi|261303859|gb|EEY07356.1| glutathione synthetase [Brucella pinnipedialis M163/99/10]
          Length = 312

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 178/312 (57%), Positives = 240/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHYTPD+L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARMEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFW+ +E  +
Sbjct: 301 AALFWNAVEARR 312


>gi|260431481|ref|ZP_05785452.1| glutathione synthase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415309|gb|EEX08568.1| glutathione synthase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 310

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 157/310 (50%), Positives = 217/310 (70%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+Q+F+Y PDQL  ++ +I A    +++  
Sbjct: 1   MKIAFQMDPIGAVDINADSSFRLAEEAQARGHQLFYYGPDQLAYQEGRITARGHDMTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
             +Q   LG E+ +DL+  DV+ +RQDPPF+MHYITST+LL+++  + L+VN+PFW+RN 
Sbjct: 61  VADQPAVLGPEREVDLADFDVVWLRQDPPFDMHYITSTHLLDRLRGQALVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD+  I  F  +  DII+KPLYGNGG GVFR+   DRN +S
Sbjct: 121 PEKLLVLDFPDLTPPTTIARDLRTIKAFKEKHGDIILKPLYGNGGAGVFRLDADDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP +R+GDKR++L++G+PVGA+NR+P+E + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPDVRNGDKRVILVDGEPVGAINRVPAEGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT  DL+IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A 
Sbjct: 241 KIGLTDRDLEICAAIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQELERFNGTNIAE 300

Query: 305 LFWDGIEKIK 314
             W  IE   
Sbjct: 301 KIWQAIEAKV 310


>gi|146276525|ref|YP_001166684.1| glutathione synthetase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554766|gb|ABP69379.1| glutathione synthase [Rhodobacter sphaeroides ATCC 17025]
          Length = 314

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 156/314 (49%), Positives = 214/314 (68%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+A+QM+ I +V +  DSTF IALEAQ RG+++F YTP+ L   D ++ A    + L
Sbjct: 1   MSLNVALQMDPIGSVNIDADSTFRIALEAQARGHRLFFYTPEHLAYDDGRVTARGFWIEL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             +K  + +  EE ++DL   DV+ +RQDPPF+M YIT+T++LE + P+ L+ N+PFW+R
Sbjct: 61  RREKGNHVTYSEETLVDLGDFDVVWLRQDPPFDMGYITTTHILELLMPKVLVANDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEK+ V  F +L+PPT I+RD+  I  F     DII+KPLYGNGG GVFR+   DRN 
Sbjct: 121 NSPEKLLVLRFPDLIPPTTIARDLATIRAFKERHGDIILKPLYGNGGAGVFRLDPQDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           SSL E+      EP++ Q +LP +  GDKRI+L++G+P+GA+NR+P   + RSN+HAGG+
Sbjct: 181 SSLHELFTSMSREPMIAQKFLPAVERGDKRIILVDGEPIGAINRVPQAGETRSNMHAGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT  D +IC  IG  LRE+GL F GIDVIGD +TEINVTSPT ++E+ R  G N 
Sbjct: 241 PERVGLTDRDREICAAIGPLLREKGLIFVGIDVIGDRLTEINVTSPTGLQELERFDGTNG 300

Query: 303 ASLFWDGIEKIKET 316
           A+L W  IE  + T
Sbjct: 301 AALIWQAIESKRRT 314


>gi|308048317|ref|YP_003911883.1| glutathione synthase [Ferrimonas balearica DSM 9799]
 gi|307630507|gb|ADN74809.1| glutathione synthase [Ferrimonas balearica DSM 9799]
          Length = 314

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 130/311 (41%), Positives = 193/311 (62%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IST+ +K+D++FA  LEAQ RGY +F+     LY+   +  A  QPLS++
Sbjct: 1   MIKLGIVMDPISTINIKKDTSFAFLLEAQRRGYALFYMEMADLYLDQGEARAKMQPLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E  +Q+Y  GE K   L+++DVIL+R+DPPF+  YI +TY+LE+      L+VN P  +R
Sbjct: 61  ENPQQWYQFGEAKDAPLAELDVILMRKDPPFDTEYIYATYMLERAEEQGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F+E  P TL++R   +I  F+ E  DII+KPL G GG  +F +     N 
Sbjct: 121 DCNEKLFTAWFAEHTPTTLVTRSAERIRAFHAEHGDIILKPLDGMGGASIFHVREDGSNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE+L        MIQ ++P+I++GDKRIL+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIIEVLTNHGQNYAMIQKFIPEIKEGDKRILVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +     L++ D  I + +   L++RGL F G+DVIGD +TE+NVTSPTC+REI      N
Sbjct: 241 RGVAQPLSESDRRIAEAVAPELKKRGLIFVGLDVIGDRLTEVNVTSPTCVREIEAAFDIN 300

Query: 302 VASLFWDGIEK 312
           +A    D IE+
Sbjct: 301 IAGRLMDAIEQ 311


>gi|90420669|ref|ZP_01228575.1| glutathione synthetase [Aurantimonas manganoxydans SI85-9A1]
 gi|90334960|gb|EAS48721.1| glutathione synthetase [Aurantimonas manganoxydans SI85-9A1]
          Length = 312

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 168/312 (53%), Positives = 239/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+H+S++ +K DSTFA+ LEAQ RG+ +FHYTPD+L +RD +  A  + L L
Sbjct: 1   MALKVAVQMDHVSSISIKGDSTFALCLEAQNRGHSLFHYTPDRLSLRDGRATARGEALEL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            E++  ++SLG ++ +DL++MDV+L+RQDPPF+M YITST++L++I+P+TL+VN+P  +R
Sbjct: 61  REEEGNHFSLGPQEKVDLAEMDVVLLRQDPPFDMAYITSTHILDRIHPKTLVVNDPTSVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEKIFVTEF++LMP TLI++D  ++  F  E  DI++KPLYGNGG GVF IT  DRN 
Sbjct: 121 NAPEKIFVTEFADLMPETLITKDPEEVMAFRAEFGDIVMKPLYGNGGAGVFHITPDDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +S +E     + EP ++Q YL  +R GDKRI+L++G+  GA+NR+P+E D RSN+H GG+
Sbjct: 181 TSFLETFGLLFREPFIVQRYLKDVRKGDKRIILVDGEFAGAINRVPAETDTRSNMHVGGQ 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T+LT  + +IC+RIG +LRERGL F GIDVIGD +TEINVTSPT IRE+ R GG ++
Sbjct: 241 ATPTELTPREREICERIGPALRERGLIFVGIDVIGDLLTEINVTSPTGIREVKRFGGADI 300

Query: 303 ASLFWDGIEKIK 314
           A++ WD IE  +
Sbjct: 301 AAVLWDAIEAKR 312


>gi|317049424|ref|YP_004117072.1| glutathione synthetase [Pantoea sp. At-9b]
 gi|316951041|gb|ADU70516.1| glutathione synthetase [Pantoea sp. At-9b]
          Length = 314

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 200/311 (64%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+ LEAQ RGY+I +   + L +R    YA T+ LS++
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLLEAQRRGYEIHYMEMNDLSLRGGVTYARTRLLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ ++V+L+R+DPPF+  +I +TYLLE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGSEQEIKLADLNVVLMRKDPPFDTEFIYATYLLERAEEQGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F++L P TL++R   ++  F+ E  D+I+KPL G GG  +FR+   D NF
Sbjct: 121 DCNEKLYTAWFADLTPDTLVTRSKEKLRAFWQEHGDVILKPLDGMGGASIFRVKQDDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L        M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVITETLTNHGQNFCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L+  D +I +R+G +L+ +GL F G+D+IGD +TE+NVTSPTC+REI      +
Sbjct: 241 RGEARPLSDSDWEIARRVGPTLKAKGLIFVGLDIIGDKLTEVNVTSPTCVREIEAAFPIS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|222084604|ref|YP_002543133.1| glutathione synthase [Agrobacterium radiobacter K84]
 gi|221722052|gb|ACM25208.1| glutathione synthase [Agrobacterium radiobacter K84]
          Length = 315

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 188/314 (59%), Positives = 250/314 (79%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI+N+A+QM+H+  + +  DSTFA++LEAQ RGY++FHYTP++L MRD ++YA+ +P+
Sbjct: 1   MAKIKNVAVQMDHVQGINIAGDSTFAMSLEAQNRGYKLFHYTPERLSMRDGRVYASVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  ++ LGE + +DLS MDV+L+RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  ILRDVKGDHFELGEPERVDLSTMDVVLLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEF++LMP TLI+RD  +I RF  EM DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEFADLMPKTLITRDAGEIRRFREEMGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q YLP +R GDKRI+L++G+PVGA+NR+P+E D+RSN+H G
Sbjct: 181 NLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEPVGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +IC RIG SL+ RG    GIDVIGDY+TEINVTSPT IRE+ R GG 
Sbjct: 241 GRAEATELTAREQEICARIGPSLKARGFLLVGIDVIGDYMTEINVTSPTGIREVKRFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           ++ASL WD IE  +
Sbjct: 301 DIASLLWDAIEAKR 314


>gi|254511870|ref|ZP_05123937.1| glutathione synthase [Rhodobacteraceae bacterium KLH11]
 gi|221535581|gb|EEE38569.1| glutathione synthase [Rhodobacteraceae bacterium KLH11]
          Length = 310

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 156/307 (50%), Positives = 215/307 (70%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+Q+F Y+PDQL  ++ ++ A    +S+  
Sbjct: 1   MKIAFQMDPIGAVDITADSSFRLAEEAQARGHQLFFYSPDQLAYQEGRVTARGHDMSVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
                  LG E  +DL+  DV+ +RQDPPF+MHYITST+LL+++  +TL+VN+PFW+RN 
Sbjct: 61  VAGDPAILGPEHEVDLADFDVVWLRQDPPFDMHYITSTHLLDRLKGQTLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F EL PPT I+RD+  +  F  +  DII+KPLYGNGG GVFR+   DRN +S
Sbjct: 121 PEKLLVLDFPELTPPTTIARDLQTLKAFKEKHGDIILKPLYGNGGAGVFRLDENDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL+ Q +LP +R+GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHELFAGFSREPLIAQKFLPDVRNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ D++IC  IG  L+ERG  F GIDVIGDY+TEINVTSPT I+E+ R  GEN+A 
Sbjct: 241 KIGLTERDMEICAAIGPLLKERGQVFVGIDVIGDYLTEINVTSPTGIQELERFNGENIAE 300

Query: 305 LFWDGIE 311
             W  IE
Sbjct: 301 KIWQAIE 307


>gi|126732330|ref|ZP_01748130.1| glutathione synthetase [Sagittula stellata E-37]
 gi|126707199|gb|EBA06265.1| glutathione synthetase [Sagittula stellata E-37]
          Length = 311

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 161/307 (52%), Positives = 217/307 (70%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +K DSTF IA EAQ RG+++F+Y PDQL   + +I A    +++  
Sbjct: 1   MKIAFQMDPILGVDIKADSTFRIAEEAQARGHELFYYGPDQLAFDEGRITATGHWMTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
            +     LGE   +DL++MDV+ +RQDPPF+MHYIT+T+LL+ +  ETL+VN+PFW+RN 
Sbjct: 61  VEGAPAILGERLTVDLAEMDVVWLRQDPPFDMHYITTTHLLDWLKGETLVVNDPFWVRNF 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT+I+RD+  I RF  +  DII+KPLYGNGG GVFR+T  DRN SS
Sbjct: 121 PEKLLVLKFQDLTPPTMIARDLAAIKRFRAKHGDIILKPLYGNGGAGVFRLTADDRNLSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q YLP +  GDKR++L++G+PVGA+NR+P+E + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKYLPAVSKGDKRVILVDGEPVGAINRVPAEGEVRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
             +LT  D +IC  IG +LRE G  F GIDVIG ++TEINVTSPT I+E+ R  G NVA 
Sbjct: 241 KVELTDRDREICAAIGPTLRENGQIFVGIDVIGYWLTEINVTSPTGIQELERFDGINVAE 300

Query: 305 LFWDGIE 311
             W  IE
Sbjct: 301 RIWQAIE 307


>gi|163867534|ref|YP_001608733.1| glutathione synthetase [Bartonella tribocorum CIP 105476]
 gi|161017180|emb|CAK00738.1| glutathione synthetase [Bartonella tribocorum CIP 105476]
          Length = 312

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 182/307 (59%), Positives = 241/307 (78%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IAIQM+HIST++++ D+TFA+AL AQ RG+ +FHYTPD+L + D  + A  +PL++ +
Sbjct: 1   MKIAIQMDHISTIRIQGDTTFALALAAQERGHSLFHYTPDRLSLCDGCVIARLEPLTVHD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           +   +Y LG+    +L+ MDV+L+RQDPPF+++YIT+T+LLE+I+P+TL+VNNP W+RNS
Sbjct: 61  EVGNHYQLGKPVRTELTDMDVVLLRQDPPFDLNYITTTHLLERIHPQTLVVNNPTWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEKIFVTEFS+LMP TLI++DI +IT F     DII+KPLYGNGG+GVF +   DRN +S
Sbjct: 121 PEKIFVTEFSDLMPETLITKDIEEITAFRERFGDIIVKPLYGNGGSGVFYLKQDDRNLAS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L+EM  + Y EP ++Q YL  +R GDKRI+LL+G PVGA+NRIP+  D RSN+H GG+AE
Sbjct: 181 LLEMFADVYREPFIVQRYLEAVRKGDKRIILLDGTPVGAINRIPTRTDVRSNMHVGGRAE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LTK D +IC+RIG +L+ERGL F GIDVIGDYITEINVTSPT IREI R  G ++A 
Sbjct: 241 NVALTKRDYEICERIGPALKERGLLFVGIDVIGDYITEINVTSPTGIREIKRFCGTDIAH 300

Query: 305 LFWDGIE 311
           LFWD +E
Sbjct: 301 LFWDVVE 307


>gi|256158632|ref|ZP_05456519.1| glutathione synthetase [Brucella ceti M490/95/1]
 gi|265997140|ref|ZP_06109697.1| glutathione synthetase [Brucella ceti M490/95/1]
 gi|262551608|gb|EEZ07598.1| glutathione synthetase [Brucella ceti M490/95/1]
          Length = 312

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 178/312 (57%), Positives = 239/312 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HISTV +  D+TFA++LEAQ RG+++FHY PD+L MRD  + A  + + +
Sbjct: 1   MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYMPDRLSMRDGVVSARMEKMEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  +Y+LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+R
Sbjct: 61  RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN 
Sbjct: 121 NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+
Sbjct: 181 TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E +KLT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+
Sbjct: 241 PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEARR 312


>gi|218462416|ref|ZP_03502507.1| glutathione synthetase [Rhizobium etli Kim 5]
          Length = 315

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 185/314 (58%), Positives = 250/314 (79%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI N+A+QM+H++ + +  DSTFA++LEAQ RGY++FHYTPD+L  RD K++A+ +P+
Sbjct: 1   MAKITNVAVQMDHVAGINIAGDSTFAMSLEAQARGYRLFHYTPDRLSFRDGKLFASVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  ++ LG  + IDLS MDV+L+RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  LLRDVKGDHFELGTPERIDLSTMDVVLLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEFS+LMP TLI++D ++I RF  EM DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEFSDLMPKTLITKDPSEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q YLP +R GDKRI+L++G+  GA+NR+P+E D+RSN+H G
Sbjct: 181 NLSSLLEMFGQMFREPFIAQQYLPDVRKGDKRIILVDGEFAGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +IC+RIG +LRERG    GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATELTPREKEICERIGPALRERGFLLVGIDVIGDYMTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           ++A+L WD IE+ +
Sbjct: 301 DIAALLWDAIERKR 314


>gi|227824184|ref|YP_002828157.1| glutathione synthetase [Sinorhizobium fredii NGR234]
 gi|227343186|gb|ACP27404.1| glutathione synthetase [Sinorhizobium fredii NGR234]
          Length = 315

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 187/314 (59%), Positives = 247/314 (78%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M +I N+ +QM+H+S + +  DSTFA++LEAQ RGY++FHYTPD+L +RD K+YA  Q +
Sbjct: 1   MARIVNVGVQMDHVSGITIAGDSTFAMSLEAQARGYRLFHYTPDRLSLRDGKVYATAQQM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
           +L + K  +++L E + IDLS MDVIL+RQDPPF+M YITST+LLE+++P+TL+VN+P W
Sbjct: 61  TLRDVKGDHFTLDEPERIDLSTMDVILLRQDPPFDMAYITSTHLLERLHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEF +LMP TLI+RD  +I RF  E+ DII+KPLYGNGG GVF     DR
Sbjct: 121 VRNSPEKIFVTEFPDLMPRTLITRDAGEIARFRQELGDIILKPLYGNGGAGVFHSARDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q YLP +R GDKRILL++G+PVGA+NR+P+E D RSN+H G
Sbjct: 181 NLSSLLEMFGQMFREPFIAQEYLPAVRKGDKRILLVDGEPVGAINRVPAEHDARSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +IC RIG +L++RG  F GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATELTAREQEICARIGPALKQRGFLFVGIDVIGDYMTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           +VASL WD IE  +
Sbjct: 301 DVASLLWDAIETKR 314


>gi|89074102|ref|ZP_01160601.1| glutathione synthetase [Photobacterium sp. SKA34]
 gi|330446904|ref|ZP_08310555.1| glutathione synthase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|89050038|gb|EAR55564.1| glutathione synthetase [Photobacterium sp. SKA34]
 gi|328491095|dbj|GAA05052.1| glutathione synthase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 316

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 122/311 (39%), Positives = 195/311 (62%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I ++ +K+DS+FA+ LEAQ RG++I +   + L +   K  A T+ +++ 
Sbjct: 1   MIKLGIVMDPIESINIKKDSSFAMMLEAQRRGWEIHYMEMNDLSLEQGKAIARTRVVTVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E ++    E+ I+LS +D +L+R+DPPF+  YI +TY+LE+  +   LIVN P  +R
Sbjct: 61  QDPEHWFDFHSEQEIELSDLDAVLMRKDPPFDTEYIYATYILERAEDNGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   ++  F+ E  D+I+KPL G GG+ +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRRAEKLKAFHQEHGDVILKPLDGMGGSSIFRVMKGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNMGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   +++ D  I + +   L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPISETDRKIAETVAPVLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEK 312
           +     D IE+
Sbjct: 301 ITGKLMDAIER 311


>gi|254780696|ref|YP_003065109.1| glutathione synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040373|gb|ACT57169.1| glutathione synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 316

 Score =  312 bits (799), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 316/316 (100%), Positives = 316/316 (100%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL
Sbjct: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
           SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW
Sbjct: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR
Sbjct: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG
Sbjct: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE
Sbjct: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300

Query: 301 NVASLFWDGIEKIKET 316
           NVASLFWDGIEKIKET
Sbjct: 301 NVASLFWDGIEKIKET 316


>gi|254440611|ref|ZP_05054105.1| glutathione synthase [Octadecabacter antarcticus 307]
 gi|198256057|gb|EDY80371.1| glutathione synthase [Octadecabacter antarcticus 307]
          Length = 317

 Score =  312 bits (799), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 153/314 (48%), Positives = 219/314 (69%)

Query: 2   KKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
           KK   +A QM+ I  + +  DS+F +A EAQ RG+ +F+YTPDQL  ++  + A  Q L 
Sbjct: 4   KKHLTVAFQMDPIGAIDINGDSSFRLAEEAQARGHTLFYYTPDQLSYQEGHVMARGQDLI 63

Query: 62  LDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
           +  +   ++ +G+ +  DL+ +DVI +RQDPPF+M YIT+T++L++I+P TL+VNNPFW+
Sbjct: 64  VRREVGNHFDVGDMREQDLADIDVIWLRQDPPFDMGYITTTHILDRIHPNTLVVNNPFWV 123

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           RN PEK+ V +F +L PPT ++RD+  +  F     D+I+KPLYGNGG GVF++T  D N
Sbjct: 124 RNYPEKLLVLDFPDLTPPTAVARDLATLKAFRARHGDVILKPLYGNGGAGVFKLTRTDSN 183

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
            +SL EM      EPL++Q +LP +  GDKRI+L+NG  VGA+NR+P++ + RSN+H GG
Sbjct: 184 LASLHEMFMGLNREPLIMQKFLPDVSAGDKRIILVNGDAVGAINRVPAKGETRSNMHVGG 243

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LTK D +IC RIG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R    N
Sbjct: 244 RPEPIGLTKRDREICARIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDNVN 303

Query: 302 VASLFWDGIEKIKE 315
           +A+  W+ IE  ++
Sbjct: 304 IAAKIWEAIEAKRQ 317


>gi|209551904|ref|YP_002283821.1| glutathione synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209537660|gb|ACI57595.1| glutathione synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 315

 Score =  311 bits (798), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 185/314 (58%), Positives = 249/314 (79%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI N+A+QM+H++ + +  DSTFA++LEAQ RGY++FHYTP++L  RD K+YA+ +P+
Sbjct: 1   MAKITNVAVQMDHVAGINIAGDSTFAMSLEAQARGYRLFHYTPERLSFRDGKLYASVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  ++ LG  + +DLS MDV+L+RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  LLRDVKGDHFELGAPERVDLSTMDVVLLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEFS+LMP TLI++D  +I RF  EM DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEFSDLMPKTLITKDAAEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q YLP +R GDKRI+L++G+  GA+NR+P+E D+RSN+H G
Sbjct: 181 NLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEFAGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +IC+RIG +LRERG    GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATELTPREKEICERIGPALRERGFLLVGIDVIGDYMTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           ++ASL WD IE+ +
Sbjct: 301 DIASLLWDAIERKR 314


>gi|291618769|ref|YP_003521511.1| GshB [Pantoea ananatis LMG 20103]
 gi|291153799|gb|ADD78383.1| GshB [Pantoea ananatis LMG 20103]
          Length = 314

 Score =  311 bits (798), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 131/311 (42%), Positives = 199/311 (63%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L +R    YA T+ LS++
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMLLEAQRRGYEIHYMEMNDLSLRGGVAYARTRLLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E +Y  G E+ I L+ ++V+L+R+DPPF+  +I  TY+LE+     TLIVN P  +R
Sbjct: 61  QNAESWYQFGSEQQIKLADLNVVLMRKDPPFDTEFIYCTYILERAEEQGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F+E  P TL++R   Q+  F+ E  D+I+KPL G GG  +FR+   D NF
Sbjct: 121 DCNEKLYTAWFAEFTPDTLVTRSKQQLRAFWQEHGDVIMKPLDGMGGASIFRVKQDDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHESRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TE+NVTSPTCIREI      +
Sbjct: 241 RGEARPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEVNVTSPTCIREIEAAFPVS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|308188040|ref|YP_003932171.1| glutathione synthetase [Pantoea vagans C9-1]
 gi|308058550|gb|ADO10722.1| glutathione synthetase [Pantoea vagans C9-1]
          Length = 314

 Score =  311 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 198/311 (63%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +     L MR     A T+ L+++
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMLLEAQRRGYEIHYMEMHDLSMRGGVASARTRLLTVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIR 122
           +  + +Y  G E++I L+ ++V+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNPDNWYQFGSEQVIPLADLNVVLMRKDPPFDTEFIYATYILERAEELGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F+E  P TL++R   Q+  F+ E  DII+KPL G GG  +FR+   D NF
Sbjct: 121 DCNEKLYTAWFAEFTPDTLVTRSKAQLRAFWQEHGDIIMKPLDGMGGASIFRVKKDDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+Y+  I++GDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVITETLTEHESRFCMAQNYIAAIKEGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TE+NVTSPTCIREI      +
Sbjct: 241 RGEARPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDKLTEVNVTSPTCIREIEAAFPIS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|90580290|ref|ZP_01236097.1| glutathione synthetase [Vibrio angustum S14]
 gi|90438592|gb|EAS63776.1| glutathione synthetase [Vibrio angustum S14]
          Length = 316

 Score =  311 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 122/311 (39%), Positives = 195/311 (62%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I ++ +K+DS+FA+ LEAQ RG++I +   + L +   K  A T+ +++ 
Sbjct: 1   MIKLGIVMDPIESINIKKDSSFAMMLEAQRRGWEIHYMEMNDLSLEQGKAIARTRVVTVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  + ++    E+ I+LS +D +L+R+DPPF+  YI +TY+LE+  +   LIVN P  +R
Sbjct: 61  QDPDHWFDFHSEQEIELSDLDAVLMRKDPPFDTEYIYATYILERAEDNGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+I+R   ++  F+ E  D+I+KPL G GG+ +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIITRRAEKLKAFHQEHGDVILKPLDGMGGSSIFRVMKGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNMGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   +++ D  I + +   L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPISETDRKIAETVAPVLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEK 312
           +     D IE+
Sbjct: 301 ITGKLMDAIER 311


>gi|327395102|dbj|BAK12524.1| glutathione synthetase GshB [Pantoea ananatis AJ13355]
          Length = 314

 Score =  311 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 131/311 (42%), Positives = 199/311 (63%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L +R    YA T+ LS++
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMLLEAQRRGYEIHYMEMNDLSLRGGVAYARTRLLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E +Y  G E+ I L+ ++V+L+R+DPPF+  +I  TY+LE+     TLIVN P  +R
Sbjct: 61  QNTESWYQFGSEQQIKLADLNVVLMRKDPPFDTEFIYCTYILERAEEQGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F+E  P TL++R   Q+  F+ E  D+I+KPL G GG  +FR+   D NF
Sbjct: 121 DCNEKLYTAWFAEFTPDTLVTRSKQQLRAFWQEHGDVIMKPLDGMGGASIFRVKQDDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHESRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TE+NVTSPTCIREI      +
Sbjct: 241 RGEARPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEVNVTSPTCIREIEAAFPVS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|86355979|ref|YP_467871.1| glutathione synthetase [Rhizobium etli CFN 42]
 gi|86280081|gb|ABC89144.1| glutathione synthetase protein [Rhizobium etli CFN 42]
          Length = 315

 Score =  311 bits (798), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 183/315 (58%), Positives = 249/315 (79%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI N+A+QM+H++ + +  DSTFA++LEAQ RGY++FHYTP++L  RD K++A+ +P+
Sbjct: 1   MAKITNVAVQMDHVAGINIAGDSTFAMSLEAQARGYRLFHYTPERLSFRDGKLFASVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  ++ LG  + +DLS MDV+L+RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  VLRDVKGDHFELGAPERVDLSTMDVVLLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEFS+LMP TLI++D  +I RF  EM DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEFSDLMPKTLITKDPAEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q YLP +R GDKRI+L++G+  GA+NR+P+E D+RSN+H G
Sbjct: 181 NLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEFAGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +IC+RIG +LRERG    GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATELTAREKEICERIGPALRERGFLLVGIDVIGDYMTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIKE 315
           ++A+L WD IE+ + 
Sbjct: 301 DIAALLWDAIERKRS 315


>gi|54310235|ref|YP_131255.1| glutathione synthetase [Photobacterium profundum SS9]
 gi|46914676|emb|CAG21453.1| putative glutathione synthetase [Photobacterium profundum SS9]
          Length = 315

 Score =  311 bits (798), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I ++ +K+DS+FA+ +EAQ RG++I +   + L +   K  A T+ +SL 
Sbjct: 1   MIKLGIVMDPIESINIKKDSSFAMMMEAQRRGWEIHYMEMNDLSLEQGKAVARTRVVSLK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    ++    E+ I LS +D +L+R+DPPF+  YI +TY+LE+  N   LIVN P  +R
Sbjct: 61  EDPNGWFEFQSEQEIALSDLDAVLMRKDPPFDTEYIYATYILERAENEGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R   ++  F+ E  D+I+KPL G GG+ +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTLVTRRADKLKAFHQEHGDVILKPLDGMGGSSIFRVMKGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTAMGTTYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   +++ D  I + +   L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPISETDRKIAETVAPVLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLK 314


>gi|182680030|ref|YP_001834176.1| glutathione synthetase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182635913|gb|ACB96687.1| glutathione synthetase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 314

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 146/313 (46%), Positives = 215/313 (68%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
            + N+A+QM+ I  +K+  DSTFA+ LEA+ RG+++F+YTPD+L MR + + A   P+ +
Sbjct: 1   MVLNVAVQMDPIEKIKIAGDSTFALMLEAERRGHKLFYYTPDKLSMRGTSLLAKAAPIKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  +++ GE   +DL  MDVIL+RQDPPF++ YITST+LLE + P+ L+VN+P  +R
Sbjct: 61  RDIEGDHFTCGEWVTLDLGSMDVILLRQDPPFDLAYITSTHLLETLQPKVLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV  F  LMPPTLI+RD  +I  F     +I++KPL+G+GG  VF++   D NF
Sbjct: 121 NAPEKLFVMRFPHLMPPTLITRDKAEIEAFRATHGEIVMKPLFGHGGASVFKVAEKDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL ++  + + EP ++Q +LP++ +GDKRI+L++G     VNR+P+E D RSN+  GG 
Sbjct: 181 GSLFDLFADTFREPWVVQRFLPKVSEGDKRIILVDGVAAAGVNRVPAENDIRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T LT  + +IC+ IG  L+  GL F GIDVI   +TEINVTSPT IR I + GG ++
Sbjct: 241 AAATDLTPREREICETIGPELKRLGLLFVGIDVIDGNLTEINVTSPTGIRAIKKVGGPDL 300

Query: 303 ASLFWDGIEKIKE 315
           A   WD IE  ++
Sbjct: 301 AVTIWDAIEAKQK 313


>gi|144897965|emb|CAM74829.1| Glutathione synthetase, prokaryotic [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 325

 Score =  311 bits (797), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 159/305 (52%), Positives = 218/305 (71%)

Query: 7   IAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK 66
           +AIQM+ + ++ +  DSTF +ALEAQ RG+ +FHY P  L +++ ++ A  +PL +  + 
Sbjct: 9   VAIQMDPMDSININADSTFVLALEAQRRGHALFHYLPTDLALKNGRVMAWIRPLQVRREL 68

Query: 67  EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPE 126
             +++L E +++DL+ MDV+L+RQDPPF+M YIT+T+LLE I+P TL+VN+P  +RN+PE
Sbjct: 69  GNHFTLDEPQLVDLATMDVVLMRQDPPFDMAYITATHLLEHIHPATLVVNDPVHVRNAPE 128

Query: 127 KIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLI 186
           K+ VT F  LMPPTLI+ D  QI  F  E KD++IKPL+GNGG GVF +   D N +SL+
Sbjct: 129 KLLVTHFPGLMPPTLITTDRRQIMEFRKEFKDLVIKPLFGNGGAGVFHVKPDDENLNSLL 188

Query: 187 EMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELT 246
           EM  + Y EP+M+Q YLP +R GDKRI+L++GK  GAVNR+P   + RSN+H GG A   
Sbjct: 189 EMFTQLYREPVMVQQYLPAVRQGDKRIILVDGKAAGAVNRVPQAGEARSNLHVGGTAMKA 248

Query: 247 KLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLF 306
           +LT  D +IC  IG +LR RGL F GIDVIG Y+TEINVTSPT I+EI+R     V +  
Sbjct: 249 ELTARDREICDAIGPTLRARGLVFVGIDVIGTYLTEINVTSPTGIQEINRFDDVRVEAQI 308

Query: 307 WDGIE 311
           WD IE
Sbjct: 309 WDAIE 313


>gi|126739152|ref|ZP_01754846.1| glutathione synthetase [Roseobacter sp. SK209-2-6]
 gi|126719769|gb|EBA16477.1| glutathione synthetase [Roseobacter sp. SK209-2-6]
          Length = 336

 Score =  311 bits (797), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 153/309 (49%), Positives = 216/309 (69%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
           +   IA QM+ I  V +  DS+F +A EAQ RG+++F Y+PD L  ++ +I A  Q +++
Sbjct: 24  RPMKIAFQMDPIMGVDINADSSFRLAEEAQKRGHELFFYSPDHLAYQEGRITARGQDMTI 83

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
                    LG+ + +DL+  DV+ +RQDPPF+MHYITST+LL+++  +TL+VN+PFW+R
Sbjct: 84  QRVAGTPAILGQMREVDLADFDVVWLRQDPPFDMHYITSTHLLDRLKGQTLVVNDPFWVR 143

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N PEK+ V +F +L PPT I+RD+  I  F  +  DII+KPLYGNGG GVFR+   DRN 
Sbjct: 144 NYPEKLLVLDFPDLTPPTAIARDLDTIKAFKAKHGDIILKPLYGNGGAGVFRLDANDRNL 203

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL E+      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+
Sbjct: 204 TSLHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGR 263

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT+ DL+IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+
Sbjct: 264 PEKIGLTERDLEICAAIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGVNI 323

Query: 303 ASLFWDGIE 311
           A   W  IE
Sbjct: 324 AEKIWLAIE 332


>gi|183596311|ref|ZP_02958339.1| hypothetical protein PROSTU_00046 [Providencia stuartii ATCC 25827]
 gi|188023915|gb|EDU61955.1| hypothetical protein PROSTU_00046 [Providencia stuartii ATCC 25827]
          Length = 315

 Score =  311 bits (797), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 197/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++K+K+D++FA+ LEAQ RGY+I +   + LY+   +  A T+ ++++
Sbjct: 1   MIKLGIVMDPISSIKIKKDTSFAMMLEAQRRGYEIHYMEMNDLYLYQGEARATTKVVTVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIR 122
           E   ++Y    E+ I L  +D IL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  ENPNKWYEFKSEQDIALGDLDAILMRKDPPFDTEFIYATYILERAEQAGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R   Q+  F+ +  D+I KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPHTLVTRSAKQLREFHQKHGDVIFKPLDGMGGASIFRLKQDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L E      M Q+YLP I+DGDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 GVIIETLTEHASRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I + +  +L+ +GL+F G+D+IGD +TEINVTSPTC REI      +
Sbjct: 241 RGEARPLSESDWEIARTVAPTLKAKGLYFVGLDIIGDRLTEINVTSPTCAREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE+  +
Sbjct: 301 ITGMLMDAIERDIK 314


>gi|110832971|ref|YP_691830.1| glutathione synthetase [Alcanivorax borkumensis SK2]
 gi|110646082|emb|CAL15558.1| glutathione synthetase [Alcanivorax borkumensis SK2]
          Length = 317

 Score =  311 bits (797), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 131/316 (41%), Positives = 204/316 (64%), Gaps = 2/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I+ +K  +D+TFA+ LEAQ RG+ + +  P  LY+RD + +A T+ LS+
Sbjct: 1   MSLRVGVVMDPIAKIKPWKDTTFAMLLEAQRRGWSLLYMEPGDLYIRDGRTFAITRTLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            +  + +Y L +    DL+ +D+IL+RQDPPFN  YI +TYLLEK      ++VN P  +
Sbjct: 61  TDNNDDWYRLADTVNHDLADLDIILMRQDPPFNAEYIYATYLLEKAEQEGVMVVNRPGSV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+S EK+F T+F +   PTL+S   T +  F  E  D ++KPL G GG+ +FR+     N
Sbjct: 121 RDSNEKLFATDFPQCCAPTLVSSQSTLLRDFVQEFGDTVMKPLDGMGGSNIFRVRKDSPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            S +IE+L +    P+M Q ++P+I +GDKRIL++NG+PV   + RIP E + R N+ AG
Sbjct: 181 ISVVIEVLTQHGKTPIMAQRFVPEITEGDKRILMINGEPVPYALARIPKEGELRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G  +  +L+  D  IC+++G +L+ +GL+F G+DVIGDY+TEINVTSPTC+RE+      
Sbjct: 241 GTGQGRELSDRDRWICEQVGPTLKRKGLYFVGLDVIGDYLTEINVTSPTCVRELDAIFDI 300

Query: 301 NVASLFWDGIEKIKET 316
           N+A   +D + +++ T
Sbjct: 301 NIAGQLFDALLELRST 316


>gi|53803465|ref|YP_114754.1| glutathione synthetase [Methylococcus capsulatus str. Bath]
 gi|53757226|gb|AAU91517.1| glutathione synthetase [Methylococcus capsulatus str. Bath]
          Length = 322

 Score =  311 bits (796), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 131/309 (42%), Positives = 205/309 (66%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + I M+ I  +K+ +DS+FA+ LEAQ RG+++F+   + LY+RD + +A  + L ++ 
Sbjct: 1   MKLGIVMDPIGKIKIGKDSSFAMLLEAQARGWELFYMELNDLYLRDGRAHARVRHLQVER 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
              +++   +E+ I L  +DVIL+R+DPPF+  YI +TYLLE   N    +VN P  +R+
Sbjct: 61  DYVRWFEFLDERDIALDTLDVILMRKDPPFDQEYIYATYLLECAENRGVYVVNRPRSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
           + EK+F   F +   PTL++R+  ++  F  E  +I++KPL G GG  +FR+  GD N S
Sbjct: 121 ANEKLFTAWFPQCCAPTLVAREAGRLREFLREHGEIVLKPLDGMGGASIFRVAEGDHNLS 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
            ++E + +     +M Q YLP+IRDGDKRIL++NG+ V   + RIP+  ++R N+ AGG+
Sbjct: 181 VILETMTQHNRRFVMAQRYLPEIRDGDKRILVVNGEAVPYALARIPAHGESRGNLAAGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE  +LT+ D  I  ++G +LR+RGL FTG+DVIGDY+TE+NVTSPTCI+E+    G N+
Sbjct: 241 AEGRELTERDRWIVSQVGPTLRQRGLVFTGLDVIGDYLTEVNVTSPTCIQELDTLFGLNI 300

Query: 303 ASLFWDGIE 311
           +++  D IE
Sbjct: 301 SAMLMDHIE 309


>gi|269101819|ref|ZP_06154516.1| glutathione synthetase [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268161717|gb|EEZ40213.1| glutathione synthetase [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 315

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 125/311 (40%), Positives = 195/311 (62%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I ++ +K+DS+FA+ +EAQ RG++I +   + L +   K  A T+ +SL 
Sbjct: 1   MIKLGIVMDPIESINIKKDSSFAMMMEAQRRGWEIHYMEMNDLSLEQGKAVARTRVVSLK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           E    ++    E+ I LS++D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  EDPNGWFEFQSEQEIALSELDAVLMRKDPPFDTEYIYATYILERAEVEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F+ +  D+I+KPL G GG+ +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTMVTRRADKIKAFHQQHGDVILKPLDGMGGSSIFRVMNGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNMGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPLSETDRRIAEAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEK 312
           +     D IE+
Sbjct: 301 ITGKLMDAIER 311


>gi|19550898|gb|AAL91575.1| glutathione synthetase [Rhizobium tropici]
          Length = 315

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 187/314 (59%), Positives = 249/314 (79%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M  I+N+A+QM+H+ ++ +  DSTFA++LEAQ RGY++FHYTP++L MRD K+YA+ +P+
Sbjct: 1   MAGIKNVAVQMDHVKSINIAGDSTFAMSLEAQNRGYKLFHYTPERLSMRDGKVYASVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  ++ LGE + +DLS MDV+L+RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  ILRDVKGDHFELGEPERVDLSTMDVVLLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEF++LMP TLI+RD  +I RF  EM DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEFADLMPKTLITRDPAEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q  LP +R GDKRI+L++G+ VGA+NR+P+E D RSN+H G
Sbjct: 181 NLSSLLEMFGQLFREPFIAQQILPDVRKGDKRIILVDGEAVGAINRVPAEHDARSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +ICKRIG +L+ERG    GIDVIGDY+TEINVTSPT IRE+ R GG 
Sbjct: 241 GRAEATELTAREQEICKRIGPALKERGFLLVGIDVIGDYMTEINVTSPTGIREVKRFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           ++ASL WD IE  +
Sbjct: 301 DIASLLWDAIEAKR 314


>gi|258625616|ref|ZP_05720498.1| glutathione synthetase [Vibrio mimicus VM603]
 gi|258582118|gb|EEW06985.1| glutathione synthetase [Vibrio mimicus VM603]
          Length = 318

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGVALADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS++D IL+R+DPPF+  YI +TY+LE+  +   L+VN P  +R
Sbjct: 61  EDPSGWYQFKSEQTIALSELDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPITMVTRKTEKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLK 314


>gi|261210045|ref|ZP_05924343.1| glutathione synthetase [Vibrio sp. RC341]
 gi|262403906|ref|ZP_06080463.1| glutathione synthetase [Vibrio sp. RC586]
 gi|260840810|gb|EEX67352.1| glutathione synthetase [Vibrio sp. RC341]
 gi|262349868|gb|EEY99004.1| glutathione synthetase [Vibrio sp. RC586]
          Length = 318

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLEQGVALADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS++D IL+R+DPPF+  YI +TY+LE+  +   L+VN P  +R
Sbjct: 61  EDPNGWYQFKSEQTIALSELDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPITMVTRKAEKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLK 314


>gi|15640495|ref|NP_230122.1| glutathione synthetase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|153819153|ref|ZP_01971820.1| glutathione synthetase [Vibrio cholerae NCTC 8457]
 gi|153823170|ref|ZP_01975837.1| glutathione synthetase [Vibrio cholerae B33]
 gi|227080678|ref|YP_002809229.1| glutathione synthetase [Vibrio cholerae M66-2]
 gi|229507106|ref|ZP_04396612.1| glutathione synthetase [Vibrio cholerae BX 330286]
 gi|229509058|ref|ZP_04398546.1| glutathione synthetase [Vibrio cholerae B33]
 gi|229519726|ref|ZP_04409169.1| glutathione synthetase [Vibrio cholerae RC9]
 gi|229519854|ref|ZP_04409288.1| glutathione synthetase [Vibrio cholerae TM 11079-80]
 gi|229525159|ref|ZP_04414564.1| glutathione synthetase [Vibrio cholerae bv. albensis VL426]
 gi|229606239|ref|YP_002876887.1| glutathione synthetase [Vibrio cholerae MJ-1236]
 gi|254226309|ref|ZP_04919900.1| glutathione synthetase [Vibrio cholerae V51]
 gi|254291179|ref|ZP_04961975.1| glutathione synthetase [Vibrio cholerae AM-19226]
 gi|254850700|ref|ZP_05240050.1| glutathione synthetase [Vibrio cholerae MO10]
 gi|255744285|ref|ZP_05418238.1| glutathione synthetase [Vibrio cholera CIRS 101]
 gi|262147290|ref|ZP_06028089.1| glutathione synthetase [Vibrio cholerae INDRE 91/1]
 gi|298501001|ref|ZP_07010802.1| glutathione synthase [Vibrio cholerae MAK 757]
 gi|20138379|sp|Q9KUP7|GSHB_VIBCH RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|9654894|gb|AAF93641.1| glutathione synthetase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|125621171|gb|EAZ49514.1| glutathione synthetase [Vibrio cholerae V51]
 gi|126510298|gb|EAZ72892.1| glutathione synthetase [Vibrio cholerae NCTC 8457]
 gi|126519296|gb|EAZ76519.1| glutathione synthetase [Vibrio cholerae B33]
 gi|150422873|gb|EDN14824.1| glutathione synthetase [Vibrio cholerae AM-19226]
 gi|227008566|gb|ACP04778.1| glutathione synthetase [Vibrio cholerae M66-2]
 gi|229338740|gb|EEO03757.1| glutathione synthetase [Vibrio cholerae bv. albensis VL426]
 gi|229343142|gb|EEO08126.1| glutathione synthetase [Vibrio cholerae TM 11079-80]
 gi|229344415|gb|EEO09390.1| glutathione synthetase [Vibrio cholerae RC9]
 gi|229353983|gb|EEO18917.1| glutathione synthetase [Vibrio cholerae B33]
 gi|229355851|gb|EEO20771.1| glutathione synthetase [Vibrio cholerae BX 330286]
 gi|229368894|gb|ACQ59317.1| glutathione synthetase [Vibrio cholerae MJ-1236]
 gi|254846405|gb|EET24819.1| glutathione synthetase [Vibrio cholerae MO10]
 gi|255738225|gb|EET93617.1| glutathione synthetase [Vibrio cholera CIRS 101]
 gi|262031284|gb|EEY49899.1| glutathione synthetase [Vibrio cholerae INDRE 91/1]
 gi|297540249|gb|EFH76309.1| glutathione synthase [Vibrio cholerae MAK 757]
          Length = 318

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLEQGVALADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS++D IL+R+DPPF+  YI +TY+LE+  +   L+VN P  +R
Sbjct: 61  EDPSGWYQFKSEQTIALSELDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPITMVTRKAEKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLK 314


>gi|332560243|ref|ZP_08414565.1| glutathione synthetase [Rhodobacter sphaeroides WS8N]
 gi|332277955|gb|EGJ23270.1| glutathione synthetase [Rhodobacter sphaeroides WS8N]
          Length = 314

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 156/313 (49%), Positives = 213/313 (68%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+A+QM+ I +V +  DSTF IALEAQ RG+++F YTPD L   D ++ A    + L
Sbjct: 1   MSLNVALQMDPIGSVNIDADSTFRIALEAQARGHRLFFYTPDHLAYDDGRVTARGAWIEL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             +K  + S GE   +DL   DV+ +RQDPPF+M YIT+T++LE + PE L+VN+PFW+R
Sbjct: 61  RREKGNHVSYGETTTVDLGDFDVVWLRQDPPFDMGYITTTHILELLMPEVLVVNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+ V  F +L+PPT I+RD+  I  F     DII+KPLYGNGG GVFR+   DRN 
Sbjct: 121 NAPEKLLVLRFPDLIPPTTIARDLATIRAFKERHGDIILKPLYGNGGAGVFRLDPNDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           SSL E+      EPL+ Q +LP +  GDKRI+L++G+P+GA+NR+P   + RSN+H GG+
Sbjct: 181 SSLHELFTSMSREPLIAQKFLPAVEKGDKRIILVDGEPIGAINRVPQAGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE   LT  D +IC  +G  LRE+G  F GIDVIGD++TEINVTSPT ++E+ R  G N 
Sbjct: 241 AEKVNLTDRDREICAALGPVLREKGQIFVGIDVIGDWLTEINVTSPTGLQELERFDGTNG 300

Query: 303 ASLFWDGIEKIKE 315
           A+  W+ IE  + 
Sbjct: 301 AARIWEVIEARRR 313


>gi|324115038|gb|EGC09003.1| glutathione synthase [Escherichia fergusonii B253]
          Length = 316

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 129/316 (40%), Positives = 206/316 (65%), Gaps = 3/316 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWQKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEFPVS 300

Query: 302 VASLFWDGIE-KIKET 316
           +  +  D IE +++++
Sbjct: 301 ITGMLIDAIEARLQKS 316


>gi|241207281|ref|YP_002978377.1| glutathione synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240861171|gb|ACS58838.1| glutathione synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 315

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 185/314 (58%), Positives = 248/314 (78%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI N+A+QM+H++ + +  DSTFA++LEAQ RGY++FHYTPD+L  RD K+YA+ +P+
Sbjct: 1   MAKITNVAVQMDHVAGINIAGDSTFAMSLEAQARGYKLFHYTPDRLSFRDGKLYASVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  +Y LG  + +DL+ MDV+L+RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  VLRDVKGDHYELGAPERVDLATMDVVLLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEFS+LMP TLI++D  +I RF  EM DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEFSDLMPKTLITKDAAEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q YLP +R GDKRI+L++G+  GA+NR+P+E D+RSN+H G
Sbjct: 181 NLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEFAGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +IC RIG +LRERG    GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATELTAREQEICARIGPALRERGFLLVGIDVIGDYMTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           ++A+L WD IE+ +
Sbjct: 301 DIAALLWDAIERKR 314


>gi|121728596|ref|ZP_01681617.1| glutathione synthetase [Vibrio cholerae V52]
 gi|147673886|ref|YP_001215994.1| glutathione synthetase [Vibrio cholerae O395]
 gi|153802594|ref|ZP_01957180.1| glutathione synthetase [Vibrio cholerae MZO-3]
 gi|153826573|ref|ZP_01979240.1| glutathione synthetase [Vibrio cholerae MZO-2]
 gi|229512530|ref|ZP_04402001.1| glutathione synthetase [Vibrio cholerae TMA 21]
 gi|229530310|ref|ZP_04419698.1| glutathione synthetase [Vibrio cholerae 12129(1)]
 gi|262167138|ref|ZP_06034852.1| glutathione synthetase [Vibrio cholerae RC27]
 gi|121629152|gb|EAX61595.1| glutathione synthetase [Vibrio cholerae V52]
 gi|124121857|gb|EAY40600.1| glutathione synthetase [Vibrio cholerae MZO-3]
 gi|146315769|gb|ABQ20308.1| glutathione synthetase [Vibrio cholerae O395]
 gi|149739665|gb|EDM53879.1| glutathione synthetase [Vibrio cholerae MZO-2]
 gi|227012321|gb|ACP08531.1| glutathione synthetase [Vibrio cholerae O395]
 gi|229332083|gb|EEN97571.1| glutathione synthetase [Vibrio cholerae 12129(1)]
 gi|229350423|gb|EEO15372.1| glutathione synthetase [Vibrio cholerae TMA 21]
 gi|262024438|gb|EEY43125.1| glutathione synthetase [Vibrio cholerae RC27]
 gi|327483321|gb|AEA77728.1| Glutathione synthetase [Vibrio cholerae LMA3894-4]
          Length = 318

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLEQGVALADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS++D IL+R+DPPF+  YI +TY+LE+  +   L+VN P  +R
Sbjct: 61  EDPNGWYQFKSEQTIALSELDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPITMVTRKAEKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLK 314


>gi|258620732|ref|ZP_05715767.1| glutathione synthetase [Vibrio mimicus VM573]
 gi|258586930|gb|EEW11644.1| glutathione synthetase [Vibrio mimicus VM573]
          Length = 318

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGVALADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS++D IL+R+DPPF+  YI +TY+LE+  +   L+VN P  +R
Sbjct: 61  EDPNGWYQFKSEQTIALSELDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPITMVTRKAEKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLK 314


>gi|153828408|ref|ZP_01981075.1| glutathione synthetase [Vibrio cholerae 623-39]
 gi|262191079|ref|ZP_06049286.1| glutathione synthetase [Vibrio cholerae CT 5369-93]
 gi|297580607|ref|ZP_06942533.1| glutathione synthetase [Vibrio cholerae RC385]
 gi|148876117|gb|EDL74252.1| glutathione synthetase [Vibrio cholerae 623-39]
 gi|262033055|gb|EEY51586.1| glutathione synthetase [Vibrio cholerae CT 5369-93]
 gi|297535023|gb|EFH73858.1| glutathione synthetase [Vibrio cholerae RC385]
          Length = 318

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLEQGVALADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS++D IL+R+DPPF+  YI +TY+LE+  +   L+VN P  +R
Sbjct: 61  EDPSGWYEFKSEQTIALSELDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPITMVTRKAEKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLK 314


>gi|86139305|ref|ZP_01057875.1| glutathione synthetase [Roseobacter sp. MED193]
 gi|85824149|gb|EAQ44354.1| glutathione synthetase [Roseobacter sp. MED193]
          Length = 311

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 154/307 (50%), Positives = 213/307 (69%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ I  V +  DS+F +A EAQ RG+++F Y PDQL  ++ +I A  Q +++  
Sbjct: 1   MKIAFQMDPIMGVDINADSSFRLAEEAQARGHELFFYLPDQLAYQEGRITARGQDMTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
                  LGE + +DL+  DVI +RQDPPF+MHYITST+LL+++  + L+VN+PFW+RN 
Sbjct: 61  VAGTPAILGEMREVDLADFDVIWLRQDPPFDMHYITSTHLLDRLKDDCLVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD+  I  F     DII+KPLYGNGG GVFR+   DRN +S
Sbjct: 121 PEKLLVLDFPDLTPPTAIARDLDTIKAFKARHGDIILKPLYGNGGAGVFRLDANDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ DL+IC  IG  L+E+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+A 
Sbjct: 241 KVGLTERDLEICAAIGPLLKEKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGVNIAE 300

Query: 305 LFWDGIE 311
             W  IE
Sbjct: 301 KIWMAIE 307


>gi|300718243|ref|YP_003743046.1| glutathione synthase/ribosomal protein S6 modification
           enzyme(glutaminyl transferase) [Erwinia billingiae
           Eb661]
 gi|299064079|emb|CAX61199.1| Glutathione synthase/Ribosomal protein S6 modification
           enzyme(Glutaminyl transferase) [Erwinia billingiae
           Eb661]
          Length = 314

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 133/311 (42%), Positives = 203/311 (65%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + LY+R  +  A T+ LS++
Sbjct: 1   MIKLGIVMDPITSINIKKDSSFAMLLEAQRRGYEIHYMEMNDLYLRGGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  ++++  G E+ I L+ ++V+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWFDFGSEQDIALADLNVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F+EL P TL++R   +I  F+ E  DII+KPL G GG  +FRI   D N 
Sbjct: 121 DCNEKLFTAWFAELTPDTLVTRSAQKIREFWQEHGDIILKPLDGMGGASIFRIKKEDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+Y+P I +GDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHGNFYCMAQNYIPAITEGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDKLTEINVTSPTCIREIEAAFPVS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|240849903|ref|YP_002971292.1| glutathione synthetase [Bartonella grahamii as4aup]
 gi|240267026|gb|ACS50614.1| glutathione synthetase [Bartonella grahamii as4aup]
          Length = 312

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 185/307 (60%), Positives = 240/307 (78%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IAIQM+HISTV+++ D+TFA+AL AQ RG+ +FHYTPD+L + D  + A  +PL + +
Sbjct: 1   MKIAIQMDHISTVRIQGDTTFALALAAQERGHSLFHYTPDRLSLCDGCVIARLEPLIVHD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           K+  +Y L +    +L+ MDV+L+RQDPPF+++YIT+T+LLE+I+P+TLIVN+P W+RNS
Sbjct: 61  KEGSHYQLEKPVRTELTDMDVVLLRQDPPFDLNYITTTHLLERIHPKTLIVNDPAWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEKIFVTEFS+LMP TLI++DI +IT F     DII+KPLYGNGG GVF +   DRN +S
Sbjct: 121 PEKIFVTEFSDLMPETLITKDIEEITAFRETFGDIIVKPLYGNGGAGVFYLKQDDRNLAS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L+EM  E Y EP ++Q YL  +R GDKRI+LL+G PVGA+NRIP++ D RSN+H GG+AE
Sbjct: 181 LLEMFAEIYHEPFIVQRYLEAVRKGDKRIILLDGTPVGAINRIPTKTDVRSNMHVGGRAE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
             +LTK D +IC+RI  +L+ERGL F GIDVIGDYITEINVTSPT IREI R  G +VA 
Sbjct: 241 NVELTKRDYEICERIAPALKERGLLFVGIDVIGDYITEINVTSPTGIREIKRFCGTDVAH 300

Query: 305 LFWDGIE 311
           LFWD IE
Sbjct: 301 LFWDVIE 307


>gi|254426855|ref|ZP_05040562.1| glutathione synthase [Alcanivorax sp. DG881]
 gi|196193024|gb|EDX87983.1| glutathione synthase [Alcanivorax sp. DG881]
          Length = 317

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 133/316 (42%), Positives = 204/316 (64%), Gaps = 2/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I+ +K  +DSTFA+ LEAQ RG+ + +  P  LY+RD + +A T+ LS+
Sbjct: 1   MSLRVGVVMDPIAKIKPWKDSTFAMLLEAQRRGWSLLYMEPGDLYVRDGRTFATTRALSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            +  + +Y L +    DL+ +D+IL+RQDPPFN  YI +TYLLEK      L+VN P  +
Sbjct: 61  TDNNDDWYRLADAVNHDLADLDIILMRQDPPFNAEYIYATYLLEKVEREGVLVVNRPGSV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+S EK+F T+F +   PTL+S   T +  F  E  D ++KPL G GG+ +FR+     N
Sbjct: 121 RDSNEKLFATDFPQCCAPTLVSSQSTLLRNFVQEFGDTVMKPLDGMGGSNIFRVRKDSPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            S +IE+L +    P+M Q ++P+I +GDKRIL++NG+PV   + RIP E + R N+ AG
Sbjct: 181 ISVVIEVLTQHGKTPIMAQRFVPEITEGDKRILMINGEPVPYALARIPKEGELRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G  +  +L+  D  IC+++G +L+ +GL+F G+DVIGDY+TEINVTSPTCIRE+      
Sbjct: 241 GTGQGRELSDRDRWICEQVGPTLKRKGLYFVGLDVIGDYLTEINVTSPTCIRELDAIFDI 300

Query: 301 NVASLFWDGIEKIKET 316
           N+A   +D + +++ +
Sbjct: 301 NIAGQLFDTLLELRPS 316


>gi|262164081|ref|ZP_06031820.1| glutathione synthetase [Vibrio mimicus VM223]
 gi|262027609|gb|EEY46275.1| glutathione synthetase [Vibrio mimicus VM223]
          Length = 318

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGVALADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS++D IL+R+DPPF+  YI +TY+LE+  +   L+VN P  +R
Sbjct: 61  EDPSGWYQFKSEQTIALSELDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPITMVTRKAKKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLK 314


>gi|91794325|ref|YP_563976.1| glutathione synthetase [Shewanella denitrificans OS217]
 gi|91716327|gb|ABE56253.1| glutathione synthase [Shewanella denitrificans OS217]
          Length = 319

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 195/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ L AQ RGYQ+F+     L M + K  A  + L + 
Sbjct: 1   MLKLGIVMDPISAINIKKDSSFAMLLAAQARGYQLFYMEMQDLAMVNGKAMAKMRALKVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +   Q+Y L E     LS++DV+L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  QDPAQWYELAESIDTPLSELDVVLMRKDPPFDTEYIYATYMLERAEEEGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+ + +DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDAARIREFHKQKQDIILKPLDGMGGTSIFRVKKDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  M Q+++P+I  GDKRIL+++G+PV   + R+P + + R N+ AGG
Sbjct: 181 GVIIETLTSYGQQYAMAQAFIPEITQGDKRILVVDGEPVPYSLARVPMKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L++ D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVPQALSESDWHIARSIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDVD 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE+  +
Sbjct: 301 ITGMLMDAIERRVK 314


>gi|304396755|ref|ZP_07378635.1| glutathione synthetase [Pantoea sp. aB]
 gi|304355551|gb|EFM19918.1| glutathione synthetase [Pantoea sp. aB]
          Length = 314

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 198/311 (63%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +     L MR     A T+ L+++
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMLLEAQRRGYEIHYMEMHDLSMRGGVASARTRLLTVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIR 122
           +  E ++  G E++I L+ ++V+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNPENWFQFGSEQVIPLADLNVVLMRKDPPFDTEFIYATYILERAEELGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F+E  P TL++R   Q+  F+ E  DII+KPL G GG  +FR+   D NF
Sbjct: 121 DCNEKLYTAWFAEFTPDTLVTRSKAQLRDFWQEHGDIIMKPLDGMGGASIFRVKKDDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+Y+  I++GDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVITETLTEHESRFCMAQNYIAAIKEGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TE+NVTSPTCIREI      +
Sbjct: 241 RGEARALSESDWEIARRVGPTLKAKGLIFVGLDIIGDKLTEVNVTSPTCIREIEAAFPIS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|327192036|gb|EGE59017.1| glutathione synthetase [Rhizobium etli CNPAF512]
          Length = 315

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 183/315 (58%), Positives = 249/315 (79%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI N+A+QM+H++ + +  DSTFA++LEAQ RGY++FHYTP++L  RD K++A+ +P+
Sbjct: 1   MAKITNVAVQMDHVAGINIAGDSTFAMSLEAQTRGYKLFHYTPERLSFRDGKLFASVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  ++ LG  + +DLS MDV+L+RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  LLRDVKGDHFELGAPERVDLSTMDVVLLRQDPPFDMGYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEFS+LMP TLI++D  +I RF  EM DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEFSDLMPKTLITKDPAEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q YLP +R GDKRI+L++G+  GA+NR+P+E D+RSN+H G
Sbjct: 181 NLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEFAGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +IC+RIG +LRERG    GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATELTPREKEICERIGPALRERGFLLVGIDVIGDYMTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIKE 315
           ++A+L WD IE+ + 
Sbjct: 301 DIAALLWDAIERKRS 315


>gi|262172418|ref|ZP_06040096.1| glutathione synthetase [Vibrio mimicus MB-451]
 gi|261893494|gb|EEY39480.1| glutathione synthetase [Vibrio mimicus MB-451]
          Length = 318

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGVALADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS++D IL+R+DPPF+  YI +TY+LE+  +   L+VN P  +R
Sbjct: 61  EDPNGWYQFKSEQTIVLSELDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPITMVTRKADKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLK 314


>gi|83643442|ref|YP_431877.1| glutathione synthetase [Hahella chejuensis KCTC 2396]
 gi|83631485|gb|ABC27452.1| glutathione synthetase [Hahella chejuensis KCTC 2396]
          Length = 322

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 126/316 (39%), Positives = 202/316 (63%), Gaps = 2/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I+ + VK+DST A+ L AQ RG+ +++   D LY+   + YA  + L +
Sbjct: 1   MTIRLGVVMDPIADINVKKDSTLAMLLAAQKRGWSLYYMQQDDLYLEQGRAYARMRTLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
            +   +++ + +E +  L+ +D+IL+R+DPP +  ++ +T++LE       L+VN P  +
Sbjct: 61  ADDPSKWFEIQDEFVDALATLDLILMRKDPPVDSEFVFATHILEAAEREGALVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F +L PP L+SRD+ ++ RF+ E +D++ KPL G GG  +FR+  GD N
Sbjct: 121 RDCNEKLFATQFPDLCPPVLVSRDVMRLRRFFAEHEDVVFKPLDGMGGKSIFRVKTGDFN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              ++E L +     +M Q YLP+I+ GDKRIL++NG+PV   + RIP++ +NR N+  G
Sbjct: 181 LGVILETLTDNGRRQIMAQRYLPEIKQGDKRILMINGEPVPYALARIPAQGENRGNLAVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G  E  +LT  D DIC R+G  LRE+GL F G+DVIGDY+TEINVTSPTCIRE+ +    
Sbjct: 241 GSGEGRELTDRDKDICARVGPVLREKGLHFVGLDVIGDYLTEINVTSPTCIRELDKLYHL 300

Query: 301 NVASLFWDGIEKIKET 316
           ++A    D +  + ++
Sbjct: 301 DIAGQLMDYLSSLLKS 316


>gi|218550194|ref|YP_002383985.1| glutathione synthetase [Escherichia fergusonii ATCC 35469]
 gi|218357735|emb|CAQ90379.1| glutathione synthetase [Escherichia fergusonii ATCC 35469]
 gi|325498504|gb|EGC96363.1| glutathione synthetase [Escherichia fergusonii ECD227]
          Length = 316

 Score =  310 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 129/316 (40%), Positives = 206/316 (65%), Gaps = 3/316 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWQKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEFPVS 300

Query: 302 VASLFWDGIE-KIKET 316
           +  +  D IE +++++
Sbjct: 301 ITGMLMDAIEARLQKS 316


>gi|190889990|ref|YP_001976532.1| glutathione synthetase [Rhizobium etli CIAT 652]
 gi|190695269|gb|ACE89354.1| glutathione synthetase protein [Rhizobium etli CIAT 652]
          Length = 315

 Score =  310 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 183/314 (58%), Positives = 248/314 (78%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI N+A+QM+H++ + +  DSTFA++LEAQ RGY++FHYTP++L  RD K++A+ +P+
Sbjct: 1   MAKITNVAVQMDHVAGINIAGDSTFAMSLEAQTRGYKLFHYTPERLSFRDGKLFASVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  ++ LG  + +DLS MDV+L+RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  LLRDVKGDHFELGAPERVDLSTMDVVLLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEFS+LMP TLI++D  +I RF  EM DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEFSDLMPKTLITKDPAEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q YLP +R GDKRI+L++G+  GA+NR+P+E D+RSN+H G
Sbjct: 181 NLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEFAGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  +  IC+RIG +LRERG    GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATELTPREKQICERIGPALRERGFLLVGIDVIGDYMTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           ++A+L WD IE+ +
Sbjct: 301 DIAALLWDAIERKR 314


>gi|254491095|ref|ZP_05104276.1| glutathione synthase [Methylophaga thiooxidans DMS010]
 gi|224463608|gb|EEF79876.1| glutathione synthase [Methylophaga thiooxydans DMS010]
          Length = 315

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 139/315 (44%), Positives = 210/315 (66%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
             R+I I M+ ++ + +K+DS+FA+ L AQ +G+Q+ +     L++RD K++A  +PL++
Sbjct: 1   MQRSIGIVMDPVARINIKKDSSFAMLLAAQAKGWQVLYMEQQDLFLRDGKVFAEMRPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            E  + +Y LG+ +   ++ ++ IL+R+DPPF+M Y+ STYLLE+      LIVN+P  +
Sbjct: 61  YENADHWYELGDMQTRPITDVEAILMRKDPPFDMEYVYSTYLLEQAQAAGVLIVNDPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   F +  PPTL++R    I  F  +  DII+KPL G GG  +FRI  GD N
Sbjct: 121 RDANEKLFTAWFPQCCPPTLVTRQKHLIREFQQQHGDIILKPLDGMGGASIFRINHGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
           FS ++E L +   + +M Q +LP+I++GDKRILL++G+PV   + RIP+  + R N+ AG
Sbjct: 181 FSVIVETLTQHGKQSVMAQKFLPEIKEGDKRILLIDGEPVPYALARIPAHGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE   LT+ D  IC ++G  LRE+GL F G+DVIGDY+TEINVTSPTCIRE+ R    
Sbjct: 241 GRAEGRPLTERDRWICAQVGNKLREKGLIFVGLDVIGDYLTEINVTSPTCIRELDRQFDI 300

Query: 301 NVASLFWDGIEKIKE 315
           N+A+     IEK  +
Sbjct: 301 NIAADLMTAIEKRLK 315


>gi|254454086|ref|ZP_05067523.1| glutathione synthase [Octadecabacter antarcticus 238]
 gi|198268492|gb|EDY92762.1| glutathione synthase [Octadecabacter antarcticus 238]
          Length = 317

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 151/314 (48%), Positives = 219/314 (69%)

Query: 2   KKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
           KK   +A QM+ I  + +  DS+F +A EAQ  G+ +F+YTPDQL  ++ ++ A  Q L 
Sbjct: 4   KKSLAVAFQMDPIGAIDINGDSSFRLAEEAQALGHTLFYYTPDQLSYQEGRVMARGQDLV 63

Query: 62  LDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
           +  +   ++ +G+ +  DL+ +DVI +RQDPPF+M YIT+T++L++I+P+TL+VN+PFW+
Sbjct: 64  VRREVGNHFDVGDMREQDLADIDVIWLRQDPPFDMGYITTTHILDRIHPDTLVVNDPFWV 123

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           RN PEK+ V +F +L PPT ++RD+  +  F     D+I+KPLY NGG GVF++T  D N
Sbjct: 124 RNYPEKLLVLDFPDLTPPTAVARDLETLKAFRARHGDVILKPLYSNGGAGVFKLTRTDSN 183

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
            +SL EM      EPL++Q +LP +  GDKRI+L+NG PVGA+NR+P++ + RSN+H GG
Sbjct: 184 LASLHEMFMGINREPLIMQKFLPDVSAGDKRIILVNGDPVGAINRVPAKGETRSNMHVGG 243

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LTK D +IC RIG  LRE+G  F GIDVIGDY+TEINVTSPT I E+ R    N
Sbjct: 244 RPEPIGLTKRDREICDRIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIMELERFDNVN 303

Query: 302 VASLFWDGIEKIKE 315
           +A+  W+ IE  ++
Sbjct: 304 IAAKIWEAIEAKRQ 317


>gi|197106940|ref|YP_002132317.1| glutathione synthetase [Phenylobacterium zucineum HLK1]
 gi|196480360|gb|ACG79888.1| glutathione synthetase [Phenylobacterium zucineum HLK1]
          Length = 315

 Score =  309 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 139/312 (44%), Positives = 206/312 (66%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I  V ++ D+TF +   AQ RG+ +F YT D+L M D +++A  + +++
Sbjct: 1   MSLKVAVQMDPIEGVNIEGDTTFLMMEAAQARGHSLFVYTTDKLAMEDGRVFARGRDVTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
                 + SLG  +  +L++ DV+L+RQDPPF+MHYI +T+ LE ++P  L+VN+P  +R
Sbjct: 61  QRVAGDHASLGPWRRTELTEFDVVLLRQDPPFDMHYIDTTFFLEAVHPRVLVVNDPREVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FVT+F  L PPTLI++D   I  F     DI++KPL G GG+GV R    D N 
Sbjct: 121 NAPEKLFVTKFPGLQPPTLITQDRDAIYDFRARHGDIVMKPLNGRGGSGVTRHLQDDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            +++E+  +   EP+++Q +LP +  GDKRILL++G+PVGA+NR+P +   RSN+  GGK
Sbjct: 181 DAMLELHAQIGREPVIVQKFLPSVTKGDKRILLVDGEPVGAINRVPEKGQIRSNLAVGGK 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A+  +LT  D +IC  IG  L+ RGL F GIDVIGDY+TEINVTSPT    + R  G + 
Sbjct: 241 AQPVELTARDREICAAIGPELKARGLLFVGIDVIGDYLTEINVTSPTGAVALKRFTGVDA 300

Query: 303 ASLFWDGIEKIK 314
           A + W  IE ++
Sbjct: 301 AEVLWTRIEALR 312


>gi|37681052|ref|NP_935661.1| glutathione synthetase [Vibrio vulnificus YJ016]
 gi|39931323|sp|Q7MHK1|GSHB_VIBVY RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|37199802|dbj|BAC95632.1| glutathione synthase [Vibrio vulnificus YJ016]
          Length = 318

 Score =  309 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 128/315 (40%), Positives = 194/315 (61%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
            +  + I M+ IS++ +K+DS+FA+ LEAQ RG++I +   + L++      A+T+ + L
Sbjct: 1   MMIKLGIVMDPISSINIKKDSSFAMMLEAQRRGWEIHYMEMNDLHLDQGVAIADTKVVQL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            E    +Y    E+ I+LS++D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +
Sbjct: 61  KEDPNGWYEFTSEQTIELSELDAVLMRKDPPFDTEYIYATYILERAEEQGTLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F   F EL P T+++R   +I  F  E  DII+KPL G GG  +FR+   D N
Sbjct: 121 RDCNEKLFTAWFPELTPTTIVTRKAEKIKAFRQEHGDIILKPLDGMGGASIFRVKENDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AG
Sbjct: 181 VSVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G  E   L++ DL I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      
Sbjct: 241 GSGEPRPLSETDLKIANAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDI 300

Query: 301 NVASLFWDGIEKIKE 315
           ++     D IE+  +
Sbjct: 301 SITGKLMDAIERRLQ 315


>gi|116250106|ref|YP_765944.1| glutathione synthetase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254754|emb|CAK05828.1| putative glutathione synthetase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 315

 Score =  309 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 187/314 (59%), Positives = 247/314 (78%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI N+A+QM+H+  + +  DSTFA++LEAQVRGY +FHYTPD+L  RD K+YA+ +P+
Sbjct: 1   MAKITNVAVQMDHVEGINIAGDSTFAMSLEAQVRGYNLFHYTPDRLSFRDGKLYASVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  +Y LG  + +DL+ MDV+L+RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  VLRDLKGDHYELGVPERVDLATMDVVLLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEFS+LMP TLI++D  +I RF  EM DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEFSDLMPKTLITKDAAEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q YLP +R GDKRI+L++G+  GA+NR+P+E D+RSN+H G
Sbjct: 181 NLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEFAGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +IC RIG +LRERG    GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATELTPREQEICTRIGPALRERGFLLVGIDVIGDYMTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           ++ASL WD IE+ +
Sbjct: 301 DIASLLWDAIERKR 314


>gi|218515922|ref|ZP_03512762.1| glutathione synthetase [Rhizobium etli 8C-3]
          Length = 315

 Score =  309 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 183/314 (58%), Positives = 249/314 (79%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI N+A+QM+H++ + +  DSTFA++LEAQ RGY++FHYTP++L  RD K++A+ +P+
Sbjct: 1   MAKITNVAVQMDHVAGINIACDSTFAMSLEAQTRGYKLFHYTPERLSFRDGKLFASVEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + K  ++ LG  + +DLS MDV+L+RQDPPF+M YITST+LLE+I+P+TL+VN+P W
Sbjct: 61  LLRDVKGDHFELGAPERVDLSTMDVVLLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEFS+LMP TLI++D  +I RF  EM DII+KPLYGNGG GVF  T  DR
Sbjct: 121 VRNSPEKIFVTEFSDLMPKTLITKDPAEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSL+EM  + + EP + Q YLP +R GDKRI+L++G+  GA+NR+P+E D+RSN+H G
Sbjct: 181 NLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEFAGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE T+LT  + +IC+RIG +LRERG    GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 241 GRAEATELTPREKEICERIGPALRERGFLLVGIDVIGDYMTEINVTSPTGIREVKKFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           ++A+L WD IE+ +
Sbjct: 301 DIAALLWDAIERKR 314


>gi|153216282|ref|ZP_01950375.1| glutathione synthetase [Vibrio cholerae 1587]
 gi|124114371|gb|EAY33191.1| glutathione synthetase [Vibrio cholerae 1587]
          Length = 318

 Score =  309 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 193/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLEQGVSLADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS +D IL+R+DPPF+  YI +TY+LE+  +   L+VN P  +R
Sbjct: 61  EDPSGWYQFKSEQTIALSDLDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPITMVTRKAEKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLK 314


>gi|255264073|ref|ZP_05343415.1| glutathione synthase [Thalassiobium sp. R2A62]
 gi|255106408|gb|EET49082.1| glutathione synthase [Thalassiobium sp. R2A62]
          Length = 312

 Score =  309 bits (791), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 150/312 (48%), Positives = 216/312 (69%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              NIA QM+ I  V +  DS+F +A EAQ RG+ +F+Y+PD L   + +I    Q L +
Sbjct: 1   MPLNIAFQMDPIQAVDINADSSFRLAEEAQARGHNLFYYSPDMLAYEEGEITVCGQSLRV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             ++  +  LG+ +  +L   DV+ +RQDPPF+M YITST+LL++++P+TL+VN+P W+R
Sbjct: 61  QREQGNHAILGDMEHRNLRDFDVVWLRQDPPFDMGYITSTHLLDRVHPDTLVVNDPTWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N PEK+ V +F +L PPT I+RD+  +  F  +   +I+KPLYGNGG GVF++T  DRN 
Sbjct: 121 NYPEKLLVLDFPDLTPPTTIARDLETLKAFKDKHGTVILKPLYGNGGAGVFKLTEEDRNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           SSL EM      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+
Sbjct: 181 SSLHEMFSGINNEPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   L+  D++IC+RIG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R  G N+
Sbjct: 241 PEKIDLSPRDIEICERIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQEMERFNGVNI 300

Query: 303 ASLFWDGIEKIK 314
           A   W  IE  +
Sbjct: 301 AEKIWTAIEAKR 312


>gi|254465288|ref|ZP_05078699.1| glutathione synthase [Rhodobacterales bacterium Y4I]
 gi|206686196|gb|EDZ46678.1| glutathione synthase [Rhodobacterales bacterium Y4I]
          Length = 311

 Score =  308 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 148/311 (47%), Positives = 212/311 (68%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+ +  V +  DS+F +A EAQ RG+++F+Y PD L  ++ +I A    +++  
Sbjct: 1   MKIAFQMDPVMGVNINADSSFRLAEEAQARGHELFYYGPDHLAYQEGRITARGHDMTVQR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
             +    LG E+ +DL+  DV+ +RQDPPF+MHYITST+LL+ +  + L+VN+PFW+RN 
Sbjct: 61  VADAPAILGPEREVDLADFDVVWLRQDPPFDMHYITSTHLLDMLKGQALVVNDPFWVRNY 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD+  I  F     D+I+KPLYGNGG GVFR+   DRN +S
Sbjct: 121 PEKLLVLKFPDLTPPTTIARDLQTIRAFKEVHGDVILKPLYGNGGAGVFRLDANDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L E+      EPL++Q +LP + +GDKR++L++G+PVGA+NR+P+  + RSN+H GG+ E
Sbjct: 181 LHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
            T L++ D++IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT I+E+ R    N+A 
Sbjct: 241 KTGLSERDMEICAAIGPLLREKGQVFVGIDVIGDYLTEINVTSPTGIQELERFDRVNIAE 300

Query: 305 LFWDGIEKIKE 315
             W  IE    
Sbjct: 301 KVWQAIEAKIR 311


>gi|126461236|ref|YP_001042350.1| glutathione synthetase [Rhodobacter sphaeroides ATCC 17029]
 gi|126102900|gb|ABN75578.1| glutathione synthase [Rhodobacter sphaeroides ATCC 17029]
          Length = 314

 Score =  308 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 155/313 (49%), Positives = 213/313 (68%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+A+QM+ I +V +  DSTF IALEAQ RG+++F YTPD L   D ++ A    + L
Sbjct: 1   MSLNVALQMDPIGSVNIDADSTFRIALEAQARGHRLFFYTPDHLAYDDGRVTARGAWIEL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             +K  + S GE   +DL   DV+ +RQDPPF+M YIT+T++LE + PE L+VN+PFW+R
Sbjct: 61  RREKGNHVSYGETTTVDLGDFDVVWLRQDPPFDMGYITTTHILELLMPEVLVVNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+ V  F +L+PPT I+RD+  I  F     DII+KPLYGNGG GVFR+   DRN 
Sbjct: 121 NAPEKLLVLRFPDLIPPTTIARDLATIRAFKERHGDIILKPLYGNGGAGVFRLDPNDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           SSL E+      EPL+ Q +LP +  GDKRI+L++G+P+GA+NR+P   + RSN+H GG+
Sbjct: 181 SSLHELFTSMSREPLIAQKFLPAVEKGDKRIILVDGEPIGAINRVPQAGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE   LT  D +IC  +G  LRE+G  F GIDVIGD++TEINVTSPT ++E+ R  G N 
Sbjct: 241 AEKVNLTDRDREICAALGPVLREKGQIFVGIDVIGDWLTEINVTSPTGLQELERFDGTNG 300

Query: 303 ASLFWDGIEKIKE 315
           ++  W+ IE  + 
Sbjct: 301 SARIWEVIEARRR 313


>gi|90412045|ref|ZP_01220052.1| glutathione synthetase [Photobacterium profundum 3TCK]
 gi|90327023|gb|EAS43402.1| glutathione synthetase [Photobacterium profundum 3TCK]
          Length = 315

 Score =  308 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I ++ +K+DS+FA+ +EAQ RG++I +   + L +   K  A T+ +SL 
Sbjct: 1   MIKLGIVMDPIESINIKKDSSFAMMMEAQRRGWEIHYMEMNDLSLEQGKAVARTRVVSLK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    ++    E+ I LS +D +L+R+DPPF+  YI +TY+LE+  N   LIVN P  +R
Sbjct: 61  EDPNGWFEFQSEQEIALSDLDAVLMRKDPPFDTEYIYATYILERAENEGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   ++  F+ E  D+I+KPL G GG+ +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTMVTRRADKLKAFHQEHGDVILKPLDGMGGSSIFRVMKGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTAMGTTYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   +++ D  I + +   L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPISETDRMIAETVAPVLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  E
Sbjct: 301 ITGKLMDAIERRLE 314


>gi|323493585|ref|ZP_08098706.1| glutathione synthetase [Vibrio brasiliensis LMG 20546]
 gi|323312108|gb|EGA65251.1| glutathione synthetase [Vibrio brasiliensis LMG 20546]
          Length = 315

 Score =  308 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 193/311 (62%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGVAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+LS++D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQTIELSELDAVLMRKDPPFDTEYIYATYILERAEEQGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  E  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKADKIKAFREEHGDVILKPLDGMGGASIFRVKENDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDKKIAEAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDVS 300

Query: 302 VASLFWDGIEK 312
           +     D IE+
Sbjct: 301 ITGKLMDAIER 311


>gi|146312990|ref|YP_001178064.1| glutathione synthetase [Enterobacter sp. 638]
 gi|145319866|gb|ABP62013.1| glutathione synthase [Enterobacter sp. 638]
          Length = 315

 Score =  308 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 128/314 (40%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGYQ+ +     LY+ + +  A T+ ++++
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMLLEAQRRGYQLHYMEMADLYLNNGEARARTRIVNVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ + L+++DVIL+R+DPPF+  +I  TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGSEQDLPLAELDVILMRKDPPFDTEFIYCTYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFSDLTPDTLVTRNKAQLKAFWQKHGDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+Y+P I DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYIPAIVDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT  D +I +R+G  L+ +GL F G+D+IGD +TE+NVTSPTCIREI      +
Sbjct: 241 RGEPRPLTDSDWEIARRVGPMLKAKGLIFVGLDIIGDRLTEVNVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IEK  +
Sbjct: 301 ITGMLMDAIEKRLK 314


>gi|331684574|ref|ZP_08385166.1| glutathione synthase [Escherichia coli H299]
 gi|331078189|gb|EGI49395.1| glutathione synthase [Escherichia coli H299]
          Length = 316

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 129/316 (40%), Positives = 206/316 (65%), Gaps = 3/316 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+  +  TLIVN P  +R
Sbjct: 61  QNYDKWYEFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEDKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEFPVS 300

Query: 302 VASLFWDGIE-KIKET 316
           +  +  D IE +++++
Sbjct: 301 ITGMLMDAIEARLQKS 316


>gi|13473969|ref|NP_105537.1| glutathione synthetase [Mesorhizobium loti MAFF303099]
 gi|20138305|sp|Q98DE8|GSHB_RHILO RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|14024720|dbj|BAB51323.1| glutathione synthetase [Mesorhizobium loti MAFF303099]
          Length = 313

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 178/313 (56%), Positives = 250/313 (79%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IA+QM+HISTV +  D++FA++LEAQ RG+Q+FHYTPD+L +RD K++A  + + +
Sbjct: 1   MKLKIAVQMDHISTVSIAGDTSFALSLEAQRRGHQLFHYTPDRLSLRDGKVFARIEEMQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++K  +YSLGE+   DLS+MDV+L+RQDPPF+M+YIT+T++LE+I+P+TL+VN+P W+R
Sbjct: 61  RDEKGSHYSLGEKVRTDLSEMDVVLLRQDPPFDMNYITTTHILERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF++LMP TLI++D  ++  F  E  DII+KPLYGNGG G+F +   DRN 
Sbjct: 121 NSPEKIFVTEFADLMPDTLITKDPLEVAAFRKEFGDIIVKPLYGNGGAGIFHLHEADRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP ++Q YL  +R GDKRI+L++G+PVGA+NR+P+E D+RSN+H GG+
Sbjct: 181 ASLLEMFGQLFREPYIVQRYLKDVRKGDKRIILIDGEPVGAINRVPAEHDSRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE T+LT+ + +IC RIG SLRERG    GIDVIGDY+TEINVTSPT +RE+ R GG ++
Sbjct: 241 AEKTELTEREREICARIGPSLRERGFILVGIDVIGDYMTEINVTSPTGVREVQRFGGADI 300

Query: 303 ASLFWDGIEKIKE 315
           ASLFWD +E  ++
Sbjct: 301 ASLFWDAVEGKRK 313


>gi|170765480|ref|ZP_02900291.1| glutathione synthase [Escherichia albertii TW07627]
 gi|170124626|gb|EDS93557.1| glutathione synthase [Escherichia albertii TW07627]
          Length = 316

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 132/314 (42%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ L++ 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARARTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++RD  QI  F+ +  DII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRDKAQIKAFWEKHSDIILKPLDGMGGASIFRVKESDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             ++E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIVETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPIS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|330993419|ref|ZP_08317354.1| Glutathione synthetase [Gluconacetobacter sp. SXCC-1]
 gi|329759449|gb|EGG75958.1| Glutathione synthetase [Gluconacetobacter sp. SXCC-1]
          Length = 336

 Score =  308 bits (789), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 156/326 (47%), Positives = 222/326 (68%), Gaps = 15/326 (4%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSK-------- 52
           M +   +A+QM+ +  + +  DSTFA+ LEAQ RGY++F Y  + L + + +        
Sbjct: 1   MSRPLKVAVQMDPLGGIDINGDSTFAMMLEAQARGYELFVYQVEALSLSEGRTVPHGRQR 60

Query: 53  ---IYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN 109
              + A  +P+++  K   + + G E++IDL+ MDV+L+RQDPPF+M YIT+T++LE I+
Sbjct: 61  TDRVTARARPVTVRRKAGDHATAGAEQVIDLAGMDVVLMRQDPPFDMAYITATHILEHIH 120

Query: 110 ----PETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLY 165
                  L+VNNP  +RN+PEKI VT + +LMPPTL++ D+  I  F  + +DII+KPL+
Sbjct: 121 GVGPDRALVVNNPAAVRNAPEKILVTHYPDLMPPTLVTWDVKAILEFRAKWRDIIVKPLF 180

Query: 166 GNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVN 225
           GNGG GVFRI   D N ++L+EM F +  EPLMIQ Y P +R GDKRI+L++G+PVGA++
Sbjct: 181 GNGGAGVFRIREDDPNLNALLEMHFARSREPLMIQRYEPAVRRGDKRIILVDGRPVGAID 240

Query: 226 RIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINV 285
           RIP+E + RSN+H GG+    +LT  D +IC  IG  LR+ GL F GIDVIG+++TEINV
Sbjct: 241 RIPAEGETRSNMHVGGRPVRAELTARDREICDTIGPMLRDAGLIFVGIDVIGEWLTEINV 300

Query: 286 TSPTCIREIHRNGGENVASLFWDGIE 311
           TSPT ++EI R  G N A L WD IE
Sbjct: 301 TSPTGLQEIDRFDGINTAGLIWDAIE 326


>gi|262273735|ref|ZP_06051548.1| glutathione synthetase [Grimontia hollisae CIP 101886]
 gi|262222150|gb|EEY73462.1| glutathione synthetase [Grimontia hollisae CIP 101886]
          Length = 315

 Score =  308 bits (789), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 193/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + + M+ I ++ +K+DSTFA+ LEAQ RG++I +   + L M   K  A T+ ++L+
Sbjct: 1   MIKLGVVMDPIESINIKKDSTFAMMLEAQKRGWEIHYMQMNDLSMEQGKALARTKVVTLE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           E  E+++ +  E+ I L+ +D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  ENPEKWFEVVSEQEIALADLDAVLMRKDPPFDTEYIYATYILERAEVEGCLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F E  P TL++R    I  F  +  D+I+KPL G GG+ +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPEHTPTTLVTRRAEHIKAFQEKHGDVILKPLDGMGGSSIFRVKQGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTGLGNNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L+  D  I + +  +L+E+GL F G+D+IGD +TEINVTSPTCIREI      N
Sbjct: 241 RGEARPLSDTDWAIARAVAPTLKEKGLIFVGLDIIGDKLTEINVTSPTCIREIEAAFDIN 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE   +
Sbjct: 301 ICGKLMDAIEARLQ 314


>gi|119386667|ref|YP_917722.1| glutathione synthetase [Paracoccus denitrificans PD1222]
 gi|119377262|gb|ABL72026.1| glutathione synthase [Paracoccus denitrificans PD1222]
          Length = 316

 Score =  308 bits (789), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 153/310 (49%), Positives = 216/310 (69%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I  V +  DSTF + LEA+ RG+++F YT D+L   + ++ A  +P++L
Sbjct: 1   MSLYVALQMDPIEQVSIDGDSTFRLGLEAEARGHRLFQYTADRLSYCEGRVMARGRPITL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             ++  + S G+    DLS+ DV+ +RQDPPF+M YIT+T+LL+++ P T +VN+PFW+R
Sbjct: 61  RREQGNHVSFGDWTDADLSEFDVVWLRQDPPFDMGYITTTHLLDRVQPSTYVVNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEK+ V +F EL PPTLI+RD+ QI  F     D I+KPLYGNGG G+F +   D N 
Sbjct: 121 NSPEKLLVLDFPELTPPTLITRDLAQIRAFRERHGDFILKPLYGNGGVGIFHMRPDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           SSL+E       EP++ Q YLP +  GDKRI+L++G+PVGA+NR+P+E + RSN+H GG+
Sbjct: 181 SSLVETFLANSREPIIAQKYLPAVVKGDKRIILVDGEPVGAINRVPAEGEARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT+ + +IC  IG  LRE+GL FTGIDVI  ++TEINVTSPT I+E+ R  G N 
Sbjct: 241 PEKIGLTEREYEICAHIGPVLREKGLLFTGIDVIDGWLTEINVTSPTGIQELERFDGINA 300

Query: 303 ASLFWDGIEK 312
           A+L WD IE+
Sbjct: 301 AALIWDAIER 310


>gi|320155284|ref|YP_004187663.1| glutathione synthetase [Vibrio vulnificus MO6-24/O]
 gi|319930596|gb|ADV85460.1| glutathione synthetase [Vibrio vulnificus MO6-24/O]
          Length = 317

 Score =  308 bits (789), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 127/314 (40%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RG++I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGWEIHYMEMNDLHLDQGVAIADTKVVQLK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+L+++D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  EDPNGWYEFTSEQTIELAELDAVLMRKDPPFDTEYIYATYILERAEEQGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  E  DII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFRQEHGDIILKPLDGMGGASIFRVKENDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ DL I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGEPRPLSETDLKIANAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLQ 314


>gi|319780480|ref|YP_004139956.1| glutathione synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166368|gb|ADV09906.1| glutathione synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 313

 Score =  308 bits (789), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 177/312 (56%), Positives = 249/312 (79%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IA+QM+HISTV +  D++FA++LEAQ RG+++FHYTPD+L +RD K++A  + + +
Sbjct: 1   MKLKIAVQMDHISTVSIAGDTSFALSLEAQRRGHELFHYTPDRLSLRDGKVFARIEEMQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++K  +YSLGE+   DLS+MDV+L+RQDPPF+M+YIT+T++LE+I+P+TL+VN+P W+R
Sbjct: 61  RDEKGSHYSLGEKVRTDLSEMDVVLLRQDPPFDMNYITTTHILERIHPKTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF++LMP TLI++D  ++  F  E  DII+KPLYGNGG G+F +  GDRN 
Sbjct: 121 NSPEKIFVTEFADLMPDTLITKDPLEVAAFRKEFGDIIVKPLYGNGGAGIFHLLEGDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP ++Q YL  +R GDKRI+L++G+PVGA+NR+P+E D+RSN+H GG+
Sbjct: 181 ASLLEMFGQMFREPYIVQRYLKDVRKGDKRIILIDGEPVGAINRVPAEHDSRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE T+LT  + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT +RE+ R GG ++
Sbjct: 241 AEKTELTAREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGVREVKRFGGADI 300

Query: 303 ASLFWDGIEKIK 314
           ASLFWD +E  +
Sbjct: 301 ASLFWDAVEDKR 312


>gi|311278137|ref|YP_003940368.1| glutathione synthetase [Enterobacter cloacae SCF1]
 gi|308747332|gb|ADO47084.1| glutathione synthetase [Enterobacter cloacae SCF1]
          Length = 315

 Score =  308 bits (788), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 204/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +   + LY+ + +  A+T+ LS++
Sbjct: 1   MIKLGIVMDPIAKINIKKDSSFAMLLEAQRRGYELHYMEMNDLYLINGEARAHTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  + +YS   E+ + L+ +DVIL+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDGWYSFTGEQDLALADLDVILMRKDPPFDTEYIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R   Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFADLTPETLVTRSKAQLKAFWEKHGDIILKPLDGMGGASIFRVKQGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIAETLTELGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +++  +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSESDWEIARKVAPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPIS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IEK  +
Sbjct: 301 ITGMLMDAIEKRLQ 314


>gi|330977057|gb|EGH77017.1| glutathione synthetase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 319

 Score =  308 bits (788), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 188/315 (59%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLYQNAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEQHGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D IEK  +
Sbjct: 301 NIGGLLIDAIEKKLQ 315


>gi|188534951|ref|YP_001908748.1| Glutathione synthase/Ribosomal protein S6 modification
           enzyme(glutaminyl transferase) [Erwinia tasmaniensis
           Et1/99]
 gi|188029993|emb|CAO97877.1| Glutathione synthase/Ribosomal protein S6 modification
           enzyme(glutaminyl transferase) [Erwinia tasmaniensis
           Et1/99]
          Length = 314

 Score =  308 bits (788), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 133/311 (42%), Positives = 205/311 (65%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + LY+R  +  A T+ LS++
Sbjct: 1   MIKLGIVMDPITSINIKKDSSFAMLLEAQNRGYEIHYMEMNDLYLRGGEGRARTRLLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +Q+++ G E+ I LS ++V+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDQWFTFGNEQDIALSDLNVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F+EL P TL++R+ +QI  F+ +  DII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFAELTPDTLVTRNASQIREFWQQHGDIILKPLDGMGGASIFRVKQEDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S ++E L        M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIVETLTGHGSAYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L+  D +I +R+   L+++GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPLSDSDWEIARRVAPVLKQKGLIFVGLDIIGDKLTEINVTSPTCIREIEAAFPIS 300

Query: 302 VASLFWDGIEK 312
           V ++  D IEK
Sbjct: 301 VTAMLMDAIEK 311


>gi|83595019|ref|YP_428771.1| glutathione synthetase [Rhodospirillum rubrum ATCC 11170]
 gi|83577933|gb|ABC24484.1| glutathione synthase [Rhodospirillum rubrum ATCC 11170]
          Length = 318

 Score =  308 bits (788), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 163/308 (52%), Positives = 224/308 (72%), Gaps = 1/308 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +AIQM+ ++ + +  DSTFA+ALEAQ RG++++HY    L  RD ++ A   PLS+  
Sbjct: 8   LRVAIQMDPMAAIDINGDSTFALALEAQARGHRLWHYLAQDLVFRDGRVTAKAHPLSVRR 67

Query: 65  KKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRN 123
           +   ++S G  + IDL S ++V+L+RQDPPF+M YIT+T+LL+ I+P+TL+VN+P  +RN
Sbjct: 68  EAGHHFSFGAPETIDLGSDVEVVLMRQDPPFDMAYITATHLLDHIHPKTLVVNDPTEVRN 127

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
           +PEK+FVT F ELMPPTLI+ D   I  F  E  DII+KPLYGNGG GVF I  GD N +
Sbjct: 128 APEKLFVTRFPELMPPTLITLDRAAIAAFRAEWGDIIVKPLYGNGGAGVFHIAPGDENLN 187

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKA 243
           +L+EM  ++  EP+M+Q YLP+IR GDKR++L++GK  GAVNR+P+  + RSN+H GG+ 
Sbjct: 188 ALLEMFAQRSREPVMVQRYLPEIRQGDKRVILIDGKAAGAVNRVPAAGEARSNMHIGGRP 247

Query: 244 ELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVA 303
           E T LT  DL+IC+ IG  LRE+GL F GIDVIGD++TEINVTSPT I+EI R  G  + 
Sbjct: 248 EKTPLTARDLEICEAIGPILREKGLLFVGIDVIGDWLTEINVTSPTGIQEIDRFDGVCLE 307

Query: 304 SLFWDGIE 311
           +  W+ IE
Sbjct: 308 ADLWNAIE 315


>gi|212709358|ref|ZP_03317486.1| hypothetical protein PROVALCAL_00394 [Providencia alcalifaciens DSM
           30120]
 gi|212688270|gb|EEB47798.1| hypothetical protein PROVALCAL_00394 [Providencia alcalifaciens DSM
           30120]
          Length = 315

 Score =  308 bits (788), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 197/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++K+K+D++FA+ LEA  RGY+I +   + LY+   +  A T+ ++++
Sbjct: 1   MIKLGIVMDPISSIKIKKDTSFAMMLEAARRGYEIHYMEMNDLYLHQGEARATTKIVTVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIR 122
           E   ++Y    E+ I LS +D IL+R+DPPF+  YI +TY+LE+     +LIVN P  +R
Sbjct: 61  ENPTKWYEFHSEQDIALSDLDAILMRKDPPFDTEYIYATYILERAEQAGSLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R   ++  F+ +  D+I KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVTRSSEKLREFHQKHGDVIFKPLDGMGGASIFRLKKDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 GVIIETLTEHNSRYCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I + +  +L+E+GL F G+D+IGD +TEINVTSPTC REI      +
Sbjct: 241 RGEARPLTESDWAIARAVAPTLKEKGLIFVGLDIIGDRLTEINVTSPTCAREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE+  +
Sbjct: 301 ITGMLMDAIERRLK 314


>gi|153835270|ref|ZP_01987937.1| glutathione synthase [Vibrio harveyi HY01]
 gi|156975828|ref|YP_001446735.1| glutathione synthetase [Vibrio harveyi ATCC BAA-1116]
 gi|269960439|ref|ZP_06174812.1| glutathione synthetase [Vibrio harveyi 1DA3]
 gi|148868245|gb|EDL67385.1| glutathione synthase [Vibrio harveyi HY01]
 gi|156527422|gb|ABU72508.1| hypothetical protein VIBHAR_03573 [Vibrio harveyi ATCC BAA-1116]
 gi|269834866|gb|EEZ88952.1| glutathione synthetase [Vibrio harveyi 1DA3]
 gi|328474085|gb|EGF44890.1| glutathione synthetase [Vibrio parahaemolyticus 10329]
          Length = 316

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 127/314 (40%), Positives = 195/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L++   K  A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGKAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+LS++D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQTIELSELDAVLMRKDPPFDTEYIYATYILERAEEQGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  E  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFREEHGDVILKPLDGMGGASIFRVKENDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D+ I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDMKIAQAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRVK 314


>gi|261250169|ref|ZP_05942745.1| glutathione synthetase [Vibrio orientalis CIP 102891]
 gi|260939285|gb|EEX95271.1| glutathione synthetase [Vibrio orientalis CIP 102891]
          Length = 317

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 196/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGYQI +   D L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYQIHYMEMDDLHLDQGVAVADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+LSQ+D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQTIELSQLDAVLMRKDPPFDTEYIYATYILERAEEQGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I +F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKQFREKHGDVILKPLDGMGGASIFRVKEGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDKKIAEAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDVS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  E
Sbjct: 301 ITGKLMDAIERRLE 314


>gi|283835292|ref|ZP_06355033.1| glutathione synthase [Citrobacter youngae ATCC 29220]
 gi|291068450|gb|EFE06559.1| glutathione synthase [Citrobacter youngae ATCC 29220]
          Length = 315

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 200/314 (63%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMLLEAQRRGYEIHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y     + + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFKSGQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFADLTPETLVTRNKAQLKAFWQKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT  D +I +RIG +L+ +GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTDSDWEIARRIGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|163803742|ref|ZP_02197600.1| glutathione synthetase [Vibrio sp. AND4]
 gi|159172461|gb|EDP57329.1| glutathione synthetase [Vibrio sp. AND4]
          Length = 316

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 128/314 (40%), Positives = 195/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGYQI +   D L++   K  A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYQIHYMEMDDLHLDQGKAIADTKVVKLK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+LS++D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPNGWYEFTSEQTIELSELDAVLMRKDPPFDTEYIYATYILERAEEQGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFREKHGDVILKPLDGMGGASIFRVKENDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D+ I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDMKIAQAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRVK 314


>gi|237798184|ref|ZP_04586645.1| glutathione synthetase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|237806089|ref|ZP_04592793.1| glutathione synthetase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021036|gb|EGI01093.1| glutathione synthetase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331027202|gb|EGI07257.1| glutathione synthetase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 319

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 188/315 (59%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQNRGWSLFYMEQKDLYQNAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEQQGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAYGT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++  L  D IEK  E
Sbjct: 301 DIGGLLMDAIEKKLE 315


>gi|268593083|ref|ZP_06127304.1| glutathione synthase [Providencia rettgeri DSM 1131]
 gi|291311352|gb|EFE51805.1| glutathione synthase [Providencia rettgeri DSM 1131]
          Length = 315

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 199/311 (63%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++K+K+D++FA+ LEAQ RGY+I +   + LY+   +  A T+ ++++
Sbjct: 1   MIKLGIVMDPISSIKIKKDTSFAMMLEAQRRGYEIHYMEMNDLYLHQGEARAQTKIVTVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIR 122
           E  E++Y    E+ I LS +D IL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  ENPEKWYEFHGEQDIALSSLDAILMRKDPPFDTEFIYATYILERAEQAGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F+EL P TL++R   ++  F+ +  D+I KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFAELTPDTLVTRSPQKLREFHQKHGDVIFKPLDGMGGASIFRLKQDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L E      M Q++LP I+DGDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 GVIIETLTEHSSRYCMAQNFLPAIKDGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I + +  +L+E+GL F G+D+IGD +TEINVTSPTC REI      +
Sbjct: 241 RGEARPLSESDWAIARAVAPTLKEKGLIFVGLDIIGDRLTEINVTSPTCAREIEAAFDIS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IE+
Sbjct: 301 ITGMLMDAIER 311


>gi|84499730|ref|ZP_00998018.1| glutathione synthetase [Oceanicola batsensis HTCC2597]
 gi|84392874|gb|EAQ05085.1| glutathione synthetase [Oceanicola batsensis HTCC2597]
          Length = 325

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 154/307 (50%), Positives = 218/307 (71%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +AIQM+ +  V +  DSTF IA EAQVRG+ +F+YTPD L  ++ ++ A  Q +++  
Sbjct: 1   MKVAIQMDPVGAVDIDADSTFRIAEEAQVRGHSLFYYTPDHLSYQEGRVIARGQSMTVRR 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           ++  + +LGE + +DL   DV+ +RQDPPF+M YIT+T+LL+++ P TL+VN+PFW+RN 
Sbjct: 61  EQGNHATLGEMETVDLGTFDVVWLRQDPPFDMFYITTTHLLQRLGPGTLVVNDPFWVRNF 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ V +F +L PPT I+RD+  +  F  +  D+I+KPLYGNGG GVFR+T  DRN SS
Sbjct: 121 PEKLLVLDFPDLTPPTAIARDLATLKEFRSKHGDVIVKPLYGNGGAGVFRVTPEDRNLSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L EM      EPL++Q YLP +  GDKR++L++G+ VGA+NR+P+E + RSN+H GG+ E
Sbjct: 181 LHEMFTGFTREPLIVQKYLPAVTKGDKRVILVDGECVGAINRVPAEGETRSNMHVGGRPE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT  D +IC+RIG  LR+RG  F GIDVIGD++TEINVTSPT ++E+ R  G  V +
Sbjct: 241 KVGLTDRDREICERIGPLLRDRGQIFVGIDVIGDWLTEINVTSPTGLQELERFDGVTVTA 300

Query: 305 LFWDGIE 311
             W  IE
Sbjct: 301 KIWQAIE 307


>gi|298293794|ref|YP_003695733.1| glutathione synthetase [Starkeya novella DSM 506]
 gi|296930305|gb|ADH91114.1| glutathione synthetase [Starkeya novella DSM 506]
          Length = 314

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 158/313 (50%), Positives = 228/313 (72%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+A+QM+ I  + +  DSTFA+ LEAQ RG+++ +YT D+L +RD +++   Q L +
Sbjct: 1   MSLNVAVQMDPIDRINIAGDSTFALLLEAQARGHRLAYYTTDRLALRDGELFGTVQDLEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K ++++LGE + + L   D IL+RQDPPF+M+Y+T+T+LLE+I+P+TL+VN+P  +R
Sbjct: 61  RDVKGEHFTLGEARRVRLDSFDAILMRQDPPFDMNYVTATHLLERIHPKTLVVNDPAHVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEKIFVTEF +LMPPTLI+RD+ +I  F  E  DI++KPLYGNGG  VFR+T  D NF
Sbjct: 121 NAPEKIFVTEFPDLMPPTLITRDLEEIKAFRDEFGDIVVKPLYGNGGAAVFRLTRDDLNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL ++    + EP ++Q ++P+++ GDKRI+L++G+  GAVNR+PSE D RSN+  GG 
Sbjct: 181 GSLYDLFATTFREPWVVQRFIPEVKHGDKRIILVDGEFAGAVNRVPSEGDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A+ T LT  + +IC+R+G  L+  GL FTGIDVI   +TEINVTSPT IR I R GG ++
Sbjct: 241 AKETDLTPREKEICERLGPHLKRMGLLFTGIDVIDGNLTEINVTSPTGIRAIRRLGGADI 300

Query: 303 ASLFWDGIEKIKE 315
           A+L WD IE  + 
Sbjct: 301 AALIWDVIEAKRR 313


>gi|209883561|ref|YP_002287418.1| glutathione synthase [Oligotropha carboxidovorans OM5]
 gi|209871757|gb|ACI91553.1| glutathione synthase [Oligotropha carboxidovorans OM5]
          Length = 313

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 151/313 (48%), Positives = 221/313 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I+ + V+ DSTFA+ LEAQ RG+++F+YTP++L +   ++ A  QPLS+
Sbjct: 1   MTLKVAVQMDPIARINVRGDSTFAMLLEAQQRGHELFYYTPERLSLLGREVIAPVQPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++   +++LG+    +L   DV+L+RQDPPF++ Y+T+T+LLE+I+P+TL+VN+P  +R
Sbjct: 61  RDEIGNHFTLGDATRANLESFDVVLLRQDPPFDLAYVTTTHLLERIHPKTLVVNDPTSVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++PEKIFV EFS+LM PTLISRD  +I  F     D++ KPLYG+GG  VFRI   D NF
Sbjct: 121 DAPEKIFVMEFSDLMAPTLISRDKEEIELFRKAHGDVVFKPLYGHGGAAVFRIAAQDMNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL ++    + EP ++Q++LP +R GDKRI+L++G   GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLYDLFSTTFREPWVVQAFLPGVRAGDKRIILVDGVFAGAVNRVPAADDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A+ T LT  + +IC+R+G  L+E GL F G+DVI  ++TEINVTSPT IR I    G NV
Sbjct: 241 AKATDLTPREREICERVGPRLKEMGLLFVGLDVIDGHLTEINVTSPTGIRAIANLSGRNV 300

Query: 303 ASLFWDGIEKIKE 315
           A+  WD IE+ + 
Sbjct: 301 AADIWDAIERKRR 313


>gi|288550385|ref|ZP_05970222.2| glutathione synthase [Enterobacter cancerogenus ATCC 35316]
 gi|288314999|gb|EFC53937.1| glutathione synthase [Enterobacter cancerogenus ATCC 35316]
          Length = 319

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 130/316 (41%), Positives = 203/316 (64%), Gaps = 2/316 (0%)

Query: 2   KKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
           KK+  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +   + LY+ + +  A T+ ++
Sbjct: 3   KKMIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMNDLYLINGEARARTRLVN 62

Query: 62  LDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFW 120
           +++  +++Y  G E+ I L+ ++VIL+R+DPPF+  +I  TY+LE+     TLIVN P  
Sbjct: 63  VEQNYDKWYEFGSEQDIALADLNVILMRKDPPFDTEFIYCTYILERAEEKGTLIVNKPQS 122

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +R+  EK++   FS+L P TL++R   Q+  F+ +  DII+KPL G GG  +FR+  GD 
Sbjct: 123 LRDCNEKLYTAWFSDLTPETLVTRSKAQLKAFWQQHGDIIMKPLDGMGGASIFRVKEGDP 182

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHA 239
           N   + E L E      M Q+YLP I DGDKR+L+++G+PV     RIP   + R N+ A
Sbjct: 183 NIGVIAETLTELGTRYCMAQNYLPAIVDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAA 242

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG+ E   LT+ D +I +R+G +L+ +GL F G+D+IGD +TE+NVTSPTCIREI     
Sbjct: 243 GGRGEPRPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEVNVTSPTCIREIEAEFP 302

Query: 300 ENVASLFWDGIEKIKE 315
            ++  +  D IEK  +
Sbjct: 303 ISITGMLMDAIEKRLQ 318


>gi|237808013|ref|YP_002892453.1| glutathione synthetase [Tolumonas auensis DSM 9187]
 gi|237500274|gb|ACQ92867.1| glutathione synthetase [Tolumonas auensis DSM 9187]
          Length = 318

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 130/312 (41%), Positives = 199/312 (63%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I ++ +K+D++FA+ LEAQ RGY++++     LY+     YA  +PL +
Sbjct: 1   MSIKLGIVMDPIQSINIKKDTSFAMLLEAQQRGYELYYMEMSDLYLEQGISYATMRPLEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            +    +YSLGE     L ++DVIL+R+DPPF+  +I +TYLLE+  +  TLIVN P  +
Sbjct: 61  RQDYTCWYSLGEVVDQPLHELDVILMRKDPPFDTEFIYATYLLERAEDQGTLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   F+E  P TL++R   ++  F+ + +D+I+KPL G GG  +FR+   D N
Sbjct: 121 RDANEKLFTAWFAEHTPTTLVTRSAAKLRSFHQQHQDVILKPLDGMGGASIFRMKHDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              +IE L E      M Q+YLP I+DGDKR+L+++G+P+     RIPS+ + R N+ AG
Sbjct: 181 IGVIIETLTEHGSRYCMAQTYLPAIKDGDKRVLVVDGEPIPYCLARIPSQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E  +LT+ D  I + +G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      
Sbjct: 241 GRGEPRELTEADWKIARAVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEFDI 300

Query: 301 NVASLFWDGIEK 312
           N+  L  D IE+
Sbjct: 301 NICGLLMDAIER 312


>gi|254508610|ref|ZP_05120726.1| glutathione synthase [Vibrio parahaemolyticus 16]
 gi|219548461|gb|EED25470.1| glutathione synthase [Vibrio parahaemolyticus 16]
          Length = 315

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 127/313 (40%), Positives = 196/313 (62%), Gaps = 2/313 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGVAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+LS++D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  EDPTGWYEFKSEQTIELSELDAVLMRKDPPFDTEYIYATYILERAEEQGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I +F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKQFREQHGDVILKPLDGMGGASIFRVKEGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPV-GAVNRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+   + RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPIGYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDKKIAEAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDVS 300

Query: 302 VASLFWDGIEKIK 314
           +     D IE+  
Sbjct: 301 ITGKLMDAIERRI 313


>gi|27364901|ref|NP_760429.1| glutathione synthetase [Vibrio vulnificus CMCP6]
 gi|29611742|sp|Q8DCA9|GSHB_VIBVU RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|27361046|gb|AAO09956.1| glutathione synthase [Vibrio vulnificus CMCP6]
          Length = 317

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 127/314 (40%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RG++I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGWEIHYMEMNDLHLDQGIAIADTKVVQLK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+L+++D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  EDPNGWYEFTSEQTIELAELDAVLMRKDPPFDTEYIYATYILERAEEQGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  E  DII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFRQEHGDIILKPLDGMGGASIFRVKENDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ DL I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGEPRPLSETDLKIANAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRLQ 314


>gi|156932613|ref|YP_001436529.1| glutathione synthetase [Cronobacter sakazakii ATCC BAA-894]
 gi|156530867|gb|ABU75693.1| hypothetical protein ESA_00395 [Cronobacter sakazakii ATCC BAA-894]
          Length = 315

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 129/311 (41%), Positives = 201/311 (64%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ +S++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYLDNGEGRARTRLVSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ +DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGTEQDIALADLDVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFADLTPHTLVTRNKAQLKAFWEKHGDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S + E L        M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIAETLTVLGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT  D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLTDSDWEIARRVGPTLKAKGLIFVGLDIIGDKLTEINVTSPTCVREIEAQYPVS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|27375779|ref|NP_767308.1| glutathione synthetase [Bradyrhizobium japonicum USDA 110]
 gi|39931539|sp|Q89WL0|GSHB_BRAJA RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|27348917|dbj|BAC45933.1| glutathione synthetase [Bradyrhizobium japonicum USDA 110]
          Length = 314

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 154/312 (49%), Positives = 223/312 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+A+QM+ I+ + +K DSTFA+ LEAQ RG+ + +YTPD+L M   ++ A  Q L++
Sbjct: 1   MKLNVAVQMDPIARINIKGDSTFALLLEAQKRGHGLSYYTPDKLSMIGEELVAPVQLLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++   +++LGE K   L+  DV+L+RQDPPF++ YITST+ LE+I+P+TL+VN+P  +R
Sbjct: 61  RDEPGDHFTLGEPKREALNGFDVVLLRQDPPFDLAYITSTHFLERIHPKTLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV  F +LMPPTLISRD+ +I  F  +   +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMNFPQLMPPTLISRDLDEINAFRDKHGAVVMKPLHGHGGAAVFRVMPQDMNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ ++P+++ GDKRI+L+NG+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLFDMFTVTFKEPWVIQQFIPEVKHGDKRIILVNGEFAGAVNRVPAADDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A+ T+LT  + +IC  +G +LRERGL F GIDVI   +TEINVTSPT IR I R GG +V
Sbjct: 241 AQETELTPREREICATVGPALRERGLLFVGIDVINGNLTEINVTSPTGIRAIARLGGPDV 300

Query: 303 ASLFWDGIEKIK 314
           A+  WD IE+ +
Sbjct: 301 AAKVWDTIEQKR 312


>gi|260599274|ref|YP_003211845.1| glutathione synthetase [Cronobacter turicensis z3032]
 gi|260218451|emb|CBA33579.1| Glutathione synthetase [Cronobacter turicensis z3032]
          Length = 315

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 129/311 (41%), Positives = 201/311 (64%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ +S++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYLNNGEGRARTRLVSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ +DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGTEQDIALADLDVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFADLTPHTLVTRNKAQLKAFWEKHGDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S + E L        M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIAETLTVLGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT  D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLTDSDWEIARRVGPTLKAKGLIFVGLDIIGDKLTEINVTSPTCVREIEAQYPVS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|157372260|ref|YP_001480249.1| glutathione synthetase [Serratia proteamaculans 568]
 gi|157324024|gb|ABV43121.1| glutathione synthetase [Serratia proteamaculans 568]
          Length = 316

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 133/311 (42%), Positives = 199/311 (63%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+D++FA+ LEAQ RG+++ +   D LY+      A T+ LS+ 
Sbjct: 1   MIKLGIVMDPIASINIKKDTSFAMLLEAQRRGWELHYMEMDDLYLHAGDGRARTRLLSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           E KE ++S G E+ + L  +DVIL+R+DPPF+  YI +TY+LE+     TL+VN P  +R
Sbjct: 61  EDKESWFSFGSEQDLALQDLDVILMRKDPPFDTEYIYATYILERAEVKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR    I +F+ +  DII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRSAAHIRKFHQQHGDIILKPLDGMGGASIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+++P I++GDKRIL+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTEHGSRFCMAQNFIPAIKEGDKRILVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTC REI      +
Sbjct: 241 RGEARPLSESDWKIARAVAPTLKEKGLIFVGLDVIGDRLTEINVTSPTCAREIEAAFPVS 300

Query: 302 VASLFWDGIEK 312
           V  +  D IEK
Sbjct: 301 VTGMLMDAIEK 311


>gi|91212329|ref|YP_542315.1| glutathione synthetase [Escherichia coli UTI89]
 gi|117625174|ref|YP_854162.1| glutathione synthetase [Escherichia coli APEC O1]
 gi|194436711|ref|ZP_03068811.1| glutathione synthase [Escherichia coli 101-1]
 gi|215488245|ref|YP_002330676.1| glutathione synthetase [Escherichia coli O127:H6 str. E2348/69]
 gi|218559938|ref|YP_002392851.1| glutathione synthetase [Escherichia coli S88]
 gi|237706400|ref|ZP_04536881.1| glutathione synthetase [Escherichia sp. 3_2_53FAA]
 gi|312964790|ref|ZP_07779030.1| glutathione synthase [Escherichia coli 2362-75]
 gi|331648702|ref|ZP_08349790.1| glutathione synthase [Escherichia coli M605]
 gi|91073903|gb|ABE08784.1| glutathione synthetase [Escherichia coli UTI89]
 gi|115514298|gb|ABJ02373.1| glutathione synthetase [Escherichia coli APEC O1]
 gi|194424193|gb|EDX40180.1| glutathione synthase [Escherichia coli 101-1]
 gi|215266317|emb|CAS10748.1| glutathione synthetase [Escherichia coli O127:H6 str. E2348/69]
 gi|218366707|emb|CAR04464.1| glutathione synthetase [Escherichia coli S88]
 gi|222034642|emb|CAP77384.1| glutathione synthetase [Escherichia coli LF82]
 gi|226899440|gb|EEH85699.1| glutathione synthetase [Escherichia sp. 3_2_53FAA]
 gi|281179956|dbj|BAI56286.1| glutathione synthetase [Escherichia coli SE15]
 gi|294491279|gb|ADE90035.1| glutathione synthase [Escherichia coli IHE3034]
 gi|307625479|gb|ADN69783.1| glutathione synthetase [Escherichia coli UM146]
 gi|312290346|gb|EFR18226.1| glutathione synthase [Escherichia coli 2362-75]
 gi|312947478|gb|ADR28305.1| glutathione synthetase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315289505|gb|EFU48900.1| glutathione synthase [Escherichia coli MS 110-3]
 gi|323188659|gb|EFZ73944.1| glutathione synthase [Escherichia coli RN587/1]
 gi|323951615|gb|EGB47490.1| glutathione synthase [Escherichia coli H252]
 gi|323957329|gb|EGB53051.1| glutathione synthase [Escherichia coli H263]
 gi|323960760|gb|EGB56381.1| glutathione synthase [Escherichia coli H489]
 gi|330908982|gb|EGH37496.1| glutathione synthetase [Escherichia coli AA86]
 gi|331042449|gb|EGI14591.1| glutathione synthase [Escherichia coli M605]
          Length = 316

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|110643096|ref|YP_670826.1| glutathione synthetase [Escherichia coli 536]
 gi|191171891|ref|ZP_03033437.1| glutathione synthase [Escherichia coli F11]
 gi|218691071|ref|YP_002399283.1| glutathione synthetase [Escherichia coli ED1a]
 gi|256024544|ref|ZP_05438409.1| glutathione synthetase [Escherichia sp. 4_1_40B]
 gi|300995472|ref|ZP_07181120.1| glutathione synthase [Escherichia coli MS 200-1]
 gi|306812149|ref|ZP_07446347.1| glutathione synthetase [Escherichia coli NC101]
 gi|110344688|gb|ABG70925.1| glutathione synthetase [Escherichia coli 536]
 gi|190907926|gb|EDV67519.1| glutathione synthase [Escherichia coli F11]
 gi|218428635|emb|CAR09419.1| glutathione synthetase [Escherichia coli ED1a]
 gi|300304834|gb|EFJ59354.1| glutathione synthase [Escherichia coli MS 200-1]
 gi|305854187|gb|EFM54625.1| glutathione synthetase [Escherichia coli NC101]
 gi|320195066|gb|EFW69695.1| Glutathione synthetase [Escherichia coli WV_060327]
 gi|324011802|gb|EGB81021.1| glutathione synthase [Escherichia coli MS 60-1]
          Length = 316

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+  +  TLIVN P  +R
Sbjct: 61  QNYDKWYEFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEDKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|324005503|gb|EGB74722.1| glutathione synthase [Escherichia coli MS 57-2]
          Length = 316

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYDFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|242237997|ref|YP_002986178.1| glutathione synthetase [Dickeya dadantii Ech703]
 gi|242130054|gb|ACS84356.1| glutathione synthetase [Dickeya dadantii Ech703]
          Length = 317

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 192/314 (61%), Gaps = 3/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RG+++++     LY+   +  A  + LS+ 
Sbjct: 1   MIKLGIVMDPIAAINIKKDTSFAMLLEAQRRGWELYYMEMGDLYLHAGEARATVRTLSVR 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
                +Y   + + I L ++D IL+R+DPPF+  ++ +TY+LE+     TLIVN P  +R
Sbjct: 61  YDYNDWYQFEDTQDIALHELDAILMRKDPPFDTEFVYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R+  ++  F+ +  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVTRNADRLRAFHQQHSDVILKPLDGMGGASIFRLKPDDANV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHGGRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+++GL F G+DVIGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLSESDWRIARAVAPVLKQKGLIFVGLDVIGDRLTEINVTSPTCVREIEAAYPDV 300

Query: 301 NVASLFWDGIEKIK 314
           ++  +  D IE+  
Sbjct: 301 SITGMLMDAIERYL 314


>gi|66043754|ref|YP_233595.1| glutathione synthetase [Pseudomonas syringae pv. syringae B728a]
 gi|289676343|ref|ZP_06497233.1| glutathione synthetase [Pseudomonas syringae pv. syringae FF5]
 gi|302189828|ref|ZP_07266501.1| glutathione synthetase [Pseudomonas syringae pv. syringae 642]
 gi|63254461|gb|AAY35557.1| Glutathione synthetase, prokaryotic [Pseudomonas syringae pv.
           syringae B728a]
 gi|330899361|gb|EGH30780.1| glutathione synthetase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330972641|gb|EGH72707.1| glutathione synthetase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 319

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 188/315 (59%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLYQNAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEQHGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D IEK  +
Sbjct: 301 NIGGLLMDAIEKKLQ 315


>gi|75674316|ref|YP_316737.1| glutathione synthetase [Nitrobacter winogradskyi Nb-255]
 gi|74419186|gb|ABA03385.1| glutathione synthase [Nitrobacter winogradskyi Nb-255]
          Length = 317

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 153/313 (48%), Positives = 219/313 (69%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I+ + ++ DSTFA+ LEAQ RG+ + +YTPD+L +R   + A  QPL++
Sbjct: 1   MKLKVAVQMDPIARINIRGDSTFALLLEAQRRGHDVSYYTPDKLSLRGRDVVAPVQPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            +    +++LG+     L   DV+L+RQDPPF++ YIT+T+LLE+I+P+TL+VNNP  +R
Sbjct: 61  RDHHGDHFTLGDATRAPLESFDVVLLRQDPPFDLAYITTTHLLERIHPKTLVVNNPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F +LMPPTLISRD+ +I  F  E   +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMDFPDLMPPTLISRDLDEINSFRAEHGAVVMKPLHGHGGAAVFRVMPQDMNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + E  +IQ +LP++  GDKRI+L++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLFDMFSVTFRESWVIQRFLPEVSRGDKRIILVDGEFAGAVNRVPAADDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T LT  + +IC+RIG +LRERGL F GIDVI   +TEINVTSPT IR I   GG +V
Sbjct: 241 ARATDLTPRESEICERIGPALRERGLLFVGIDVIDGLLTEINVTSPTGIRAIAALGGPDV 300

Query: 303 ASLFWDGIEKIKE 315
           A++ WD IE  + 
Sbjct: 301 AAIVWDRIEAKRS 313


>gi|170728460|ref|YP_001762486.1| glutathione synthetase [Shewanella woodyi ATCC 51908]
 gi|169813807|gb|ACA88391.1| glutathione synthetase [Shewanella woodyi ATCC 51908]
          Length = 316

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 197/315 (62%), Gaps = 2/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ L AQ RGY++F+     L M + K  A  + LS+ 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLLAAQSRGYELFYMEMKDLAMVNGKAMATMRSLSVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIR 122
           + +  ++ LGE     L+ +DVIL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  QDENNWFELGESVDTPLADLDVILMRKDPPFDTEFIYATYMLERAEEAGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I +FY E KDIIIKPL G GG+ +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDEKRIRQFYQEKKDIIIKPLDGMGGSSIFRVKEKDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  M+Q ++P I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTNHGQQYTMVQGFIPDITSGDKRILVVDGEPVPYSLARIPQKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +     L++ D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCI+EI      +
Sbjct: 241 RGVAQPLSESDWKIARTIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIKEIQAAFDVD 300

Query: 302 VASLFWDGIEKIKET 316
           +  +  D IE   ++
Sbjct: 301 ITGMLMDAIEARIKS 315


>gi|153839191|ref|ZP_01991858.1| glutathione synthase [Vibrio parahaemolyticus AQ3810]
 gi|149747293|gb|EDM58277.1| glutathione synthase [Vibrio parahaemolyticus AQ3810]
          Length = 316

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 128/314 (40%), Positives = 196/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L++   K  A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGKAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+II+LS++D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQIIELSELDAVLMRKDPPFDTEYIYATYILERAEEQGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  E  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFREEHGDVILKPLDGMGGASIFRVKENDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D+ I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDMKIAQAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRVK 314


>gi|260463425|ref|ZP_05811625.1| glutathione synthetase [Mesorhizobium opportunistum WSM2075]
 gi|259030750|gb|EEW32026.1| glutathione synthetase [Mesorhizobium opportunistum WSM2075]
          Length = 317

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 181/315 (57%), Positives = 250/315 (79%), Gaps = 1/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IA+QM+HISTV +  D++FA++LEAQ RG+Q+FHYTPD+L MRD K++A  + + +
Sbjct: 1   MKLKIAVQMDHISTVSITGDTSFALSLEAQRRGHQLFHYTPDRLSMRDGKVFARIEAMQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++K  +YSLGE+   DLS+MDVIL+RQDPPF+M+YIT+T++LE+I+P TL+VN+P W+R
Sbjct: 61  RDEKGNHYSLGEKVRTDLSEMDVILLRQDPPFDMNYITTTHILERIHPGTLVVNDPAWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI++D  ++  F  E  DIIIKPLYGNGG G+F +   DRN 
Sbjct: 121 NSPEKIFVTEFPDLMPDTLITKDPLEVAAFRKEFGDIIIKPLYGNGGAGIFHMLEADRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+EM  + + EP ++Q YL  +R GDKRI+L++G+PVGA+NR+P+E D+RSN+H GG+
Sbjct: 181 ASLLEMFGQMFREPYIVQRYLKDVRKGDKRIILIDGEPVGAINRVPAEHDSRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE T+LT+ + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT +RE+ R GG ++
Sbjct: 241 AEKTELTEREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGVREVQRFGGADI 300

Query: 303 ASLFWDGIE-KIKET 316
           ASLFWD +E K +++
Sbjct: 301 ASLFWDAVEGKRRKS 315


>gi|326404417|ref|YP_004284499.1| glutathione synthetase [Acidiphilium multivorum AIU301]
 gi|325051279|dbj|BAJ81617.1| glutathione synthetase [Acidiphilium multivorum AIU301]
          Length = 317

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 154/312 (49%), Positives = 225/312 (72%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A+QM+ + +V +  DSTF + LEAQ RG+ ++HYT   +++ +  + A  +P+++  
Sbjct: 4   LRVAVQMDPMESVDIDGDSTFVLMLEAQRRGHALWHYTVRDMWLENGALNARLRPVTVRR 63

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           +   +++ G  + +DL+ MDV+L+RQDPPF+M YIT+T+LLE I+P TL+VN+P  +RN+
Sbjct: 64  EAGNHFAFGPAETMDLAVMDVVLMRQDPPFDMGYITATHLLEHIHPRTLVVNDPAAVRNA 123

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ VT+F +LMPPTLI+ D T I  F    KDII+KPLYGNGG G+FRI   D N  +
Sbjct: 124 PEKLLVTDFPDLMPPTLIAWDRTAIREFRARHKDIIVKPLYGNGGMGIFRIKPDDENLGA 183

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L++  F    EPLM+Q Y P +R GDKRI+L++G+P+GA+NR+P+E D RSN+HAGG A 
Sbjct: 184 LLDTHFAGSREPLMVQRYEPAVRAGDKRIILIDGEPLGAINRVPAEGDARSNMHAGGIAA 243

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
            T++T  D +IC RIG +L+ERGL F GIDVIGDY+TEINVTSPT ++++ R  G ++ +
Sbjct: 244 PTEMTARDREICARIGPTLKERGLLFAGIDVIGDYLTEINVTSPTGLQQVARFNGLHLEA 303

Query: 305 LFWDGIEKIKET 316
             WD IE  + +
Sbjct: 304 TIWDRIEARRAS 315


>gi|331659082|ref|ZP_08360024.1| glutathione synthase [Escherichia coli TA206]
 gi|315295636|gb|EFU54959.1| glutathione synthase [Escherichia coli MS 16-3]
 gi|331053664|gb|EGI25693.1| glutathione synthase [Escherichia coli TA206]
          Length = 316

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMTDLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|26249368|ref|NP_755408.1| glutathione synthetase [Escherichia coli CFT073]
 gi|300980099|ref|ZP_07174842.1| glutathione synthase [Escherichia coli MS 45-1]
 gi|301049258|ref|ZP_07196231.1| glutathione synthase [Escherichia coli MS 185-1]
 gi|29611769|sp|Q8FE30|GSHB_ECOL6 RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|26109776|gb|AAN81981.1|AE016766_69 Glutathione synthetase [Escherichia coli CFT073]
 gi|300298954|gb|EFJ55339.1| glutathione synthase [Escherichia coli MS 185-1]
 gi|300409356|gb|EFJ92894.1| glutathione synthase [Escherichia coli MS 45-1]
 gi|315293939|gb|EFU53291.1| glutathione synthase [Escherichia coli MS 153-1]
          Length = 316

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 132/314 (42%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I STY+LE+  +  TLIVN P  +R
Sbjct: 61  QNYDKWYEFTGEQDLPLADLDVILMRKDPPFDTEFIYSTYILERAEDKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|85714067|ref|ZP_01045056.1| glutathione synthetase [Nitrobacter sp. Nb-311A]
 gi|85699193|gb|EAQ37061.1| glutathione synthetase [Nitrobacter sp. Nb-311A]
          Length = 313

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 158/313 (50%), Positives = 224/313 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I+ + V+ DSTFA+ LEAQ RG+++ +YTPD+L +R   + A+ QPL++
Sbjct: 1   MKLKVAVQMDPIARINVRGDSTFALLLEAQRRGHEVAYYTPDRLSLRGKDVVASVQPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            +++  +++LGE   + L   DV+L+RQDPPF++ YIT+T+LLE+I+P+TL+VN+P  +R
Sbjct: 61  RDQEGNHFTLGETTRVYLESFDVVLLRQDPPFDLAYITTTHLLERIHPKTLVVNDPANVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F +LMPPTLISRD+ +I  F  E   +++KPL+G+GG  VFRI   D NF
Sbjct: 121 NAPEKLFVMDFPDLMPPTLISRDLDEINSFRAEHGAVVMKPLHGHGGAAVFRIMPQDMNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+I+ GDKRI+L+ G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLFDMFSVTFREPWVIQRFLPEIKQGDKRIILVEGEFAGAVNRVPAADDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T LT  + DICKRIG +LRERGL F GIDVI   +TEINVTSPT IR I   GG ++
Sbjct: 241 ARATDLTPRESDICKRIGPALRERGLLFVGIDVIDGLLTEINVTSPTGIRAIAAFGGPDI 300

Query: 303 ASLFWDGIEKIKE 315
           A+  WD IE  + 
Sbjct: 301 AARIWDRIEAKRS 313


>gi|91228681|ref|ZP_01262595.1| glutathione synthetase [Vibrio alginolyticus 12G01]
 gi|269965750|ref|ZP_06179847.1| glutathione synthetase [Vibrio alginolyticus 40B]
 gi|91187752|gb|EAS74070.1| glutathione synthetase [Vibrio alginolyticus 12G01]
 gi|269829618|gb|EEZ83855.1| glutathione synthetase [Vibrio alginolyticus 40B]
          Length = 316

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGVAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+LS++D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQTIELSELDAVLMRKDPPFDTEYIYATYILERAEEQGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKEFREKHGDVILKPLDGMGGASIFRVKENDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ DL I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDLKIAQTVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRVK 314


>gi|148261017|ref|YP_001235144.1| glutathione synthetase [Acidiphilium cryptum JF-5]
 gi|146402698|gb|ABQ31225.1| glutathione synthase [Acidiphilium cryptum JF-5]
          Length = 317

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 155/312 (49%), Positives = 226/312 (72%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A+QM+ + +V +  DSTF + LEAQ RG+ ++HYT   +++ +  + A  +P+++  
Sbjct: 4   LRVAVQMDPMESVDIDGDSTFVLMLEAQRRGHALWHYTVRDMWLENGALNARLRPVTVRR 63

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           +   +++ G  + +DL+ MDV+L+RQDPPF+M YIT+T+LLE I+P TL+VN+P  +RN+
Sbjct: 64  EAGNHFAFGPAETMDLAAMDVVLMRQDPPFDMGYITATHLLEHIHPRTLVVNDPAAVRNA 123

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEK+ VT+F +LMPPTLI+ D T I  F    KDII+KPLYGNGG G+FRI   D N  +
Sbjct: 124 PEKLLVTDFPDLMPPTLIAWDRTAIREFRARHKDIIVKPLYGNGGMGIFRIKPDDENLGA 183

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L++  F    EPLM+Q Y P +R GDKRI+L++G+P+GA+NR+P+E D RSN+HAGG AE
Sbjct: 184 LLDTHFAGSREPLMVQRYEPAVRAGDKRIILIDGEPLGAINRVPAEGDARSNMHAGGIAE 243

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
            T++T  D +IC RIG +L+ERGL F GIDVIGDY+TEINVTSPT ++++ R  G ++ +
Sbjct: 244 PTEMTARDREICARIGPTLKERGLLFAGIDVIGDYLTEINVTSPTGLQQVARFNGLHLEA 303

Query: 305 LFWDGIEKIKET 316
             WD IE  + +
Sbjct: 304 TIWDRIEARRAS 315


>gi|94501649|ref|ZP_01308165.1| glutathione synthetase [Oceanobacter sp. RED65]
 gi|94426225|gb|EAT11217.1| glutathione synthetase [Oceanobacter sp. RED65]
          Length = 316

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 125/312 (40%), Positives = 192/312 (61%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               I I M+ I ++  K+D+T A+   AQ +G+Q+++     L +   +  A   P+ +
Sbjct: 1   MSIKIGIIMDPIESISYKKDTTLALMDAAQRKGWQVYYMEQSDLALEQGQAMARMAPIKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
               E ++  GE +   LS M+++++R+DPPF+  YI STY+LE+     +LI+N P  +
Sbjct: 61  FMDPEHWFERGEYEYRPLSDMNIVMMRKDPPFDNEYIYSTYILERAEQQGSLIINKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK++ T F E  P  L++R+  Q+  F+ + KD+I KPL G GG+ +FR+   D N
Sbjct: 121 RDCNEKVYATAFPECCPEGLVTRNAEQLKAFHKKHKDVIFKPLDGMGGSSIFRLKEDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S +IE L +   E +M Q YLP+I  GDKRIL+++G PV     RIPS  + R N+ AG
Sbjct: 181 ISVIIETLTKFGHEMIMAQKYLPEISKGDKRILMIDGVPVEHCLARIPSSGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L+  D  I +++G  L+E+GL F G+DVIGDY+TE+NVTSPTC+REI R+ G 
Sbjct: 241 GQGVTQPLSDRDRWIAEKVGPYLKEKGLVFVGLDVIGDYLTEVNVTSPTCVREISRDSGL 300

Query: 301 NVASLFWDGIEK 312
           +V+ +  D IEK
Sbjct: 301 DVSMMLMDAIEK 312


>gi|260574113|ref|ZP_05842118.1| glutathione synthetase [Rhodobacter sp. SW2]
 gi|259023579|gb|EEW26870.1| glutathione synthetase [Rhodobacter sp. SW2]
          Length = 313

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 157/313 (50%), Positives = 212/313 (67%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I  V +  DSTF I LEA  RG+ +F YTPD+L   + ++ A   P+ L
Sbjct: 1   MSLKVALQMDPIGAVNIDGDSTFRIGLEALARGHSLFFYTPDRLAFVEGRVLARGWPIEL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
             +   + S G E  +DL + DV+ +RQDPPF+M YIT+T+LLE I+P TL+VN+PFW+R
Sbjct: 61  RREMGNHVSYGAETEVDLGEFDVVWLRQDPPFDMGYITTTHLLEMIHPRTLVVNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEK+ V  F  L+PPT I+RD+  I  F     DII+KPLYGNGG GVFR+   DRN 
Sbjct: 121 NSPEKLLVLRFPGLIPPTAIARDLATIREFKARHGDIILKPLYGNGGAGVFRLDPNDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL E+      EPL++Q +LP +  GDKR++L++G+PVGA+NR+P   + RSN+HAGG+
Sbjct: 181 ASLHELFISMSREPLIVQKFLPDVAKGDKRVILVDGEPVGAINRVPQAGETRSNMHAGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT  DL+IC  IG  LRE+G  F GIDVIGDY+TEINVTSPT ++E+ R  G N 
Sbjct: 241 PEKIGLTPRDLEICATIGPVLREKGQVFVGIDVIGDYLTEINVTSPTGLQELERFDGTNA 300

Query: 303 ASLFWDGIEKIKE 315
           A+  W+ IE  + 
Sbjct: 301 AARIWEVIEAKRR 313


>gi|149191951|ref|ZP_01870182.1| glutathione synthetase [Vibrio shilonii AK1]
 gi|148834218|gb|EDL51224.1| glutathione synthetase [Vibrio shilonii AK1]
          Length = 315

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 126/311 (40%), Positives = 196/311 (63%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ ++L 
Sbjct: 1   MLKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGTAVADTKIVTLK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+LS++D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  EDPTGWYEFTSEQTIELSELDTVLMRKDPPFDTEYIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I +F  +  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKQFRDQHGDVILKPLDGMGGASIFRVKQDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPLSETDKQIAEAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEK 312
           +     D IE+
Sbjct: 301 ITGKLMDAIER 311


>gi|293394488|ref|ZP_06638784.1| glutathione synthase [Serratia odorifera DSM 4582]
 gi|291422953|gb|EFE96186.1| glutathione synthase [Serratia odorifera DSM 4582]
          Length = 316

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 131/311 (42%), Positives = 199/311 (63%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+D++FA+ LEAQ RG+++ +   + LY+      A T+ L++ 
Sbjct: 1   MIKLGIVMDPIASINIKKDTSFAMLLEAQRRGWELHYMEMNDLYLHAGDGRARTRQLAVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           E KE +YS G E+ + L  +DVIL+R+DPPF+  YI +TY+LE+     TL+VN P  +R
Sbjct: 61  EDKESWYSFGSEQDLALQDLDVILMRKDPPFDTEYIYATYILERAEVKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR    I +F+ +  DII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRSAAHIRKFHQQHGDIILKPLDGMGGASIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKRIL+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTEHGSRFCMAQNFLPAIKEGDKRILVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I + +  +L+E+GL F G+D+IGD +TEINVTSPTC REI      +
Sbjct: 241 RGEARPLSESDWKIARAVAPTLKEKGLIFVGLDIIGDRLTEINVTSPTCAREIEAAFPVS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|270263054|ref|ZP_06191324.1| glutathione synthetase [Serratia odorifera 4Rx13]
 gi|270042742|gb|EFA15836.1| glutathione synthetase [Serratia odorifera 4Rx13]
          Length = 316

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 132/311 (42%), Positives = 199/311 (63%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+D++FA+ LEAQ RG+++ +   + LY+      A T+ LS+ 
Sbjct: 1   MIKLGIVMDPIASINIKKDTSFAMLLEAQRRGWELHYMEMNDLYLHAGDGRARTRLLSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           E KE ++S G E+ + L  +DVIL+R+DPPF+  YI +TY+LE+     TL+VN P  +R
Sbjct: 61  EDKESWFSFGAEQDLALQDLDVILMRKDPPFDTEYIYATYILERAEVKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR    I +F+ +  DII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRSAAHIRKFHQQHGDIILKPLDGMGGASIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKRIL+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTEHGSRFCMAQNFLPAIKEGDKRILVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTC REI      +
Sbjct: 241 RGEPRPLSESDWKIARAVAPTLKEKGLIFVGLDVIGDRLTEINVTSPTCAREIEAAFPVS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|260767460|ref|ZP_05876397.1| glutathione synthetase [Vibrio furnissii CIP 102972]
 gi|260617572|gb|EEX42754.1| glutathione synthetase [Vibrio furnissii CIP 102972]
 gi|315181240|gb|ADT88154.1| glutathione synthetase [Vibrio furnissii NCTC 11218]
          Length = 318

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 193/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGVAMADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS++D +L+R+DPPF+  YI +TY+LE+  +   LIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQTIVLSELDAVLMRKDPPFDTEYIYATYILERAEDDGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFREQHGDVILKPLDGMGGASIFRVKQGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L+  D  I + +   L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPLSDTDRQIAETVAPILKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRVK 314


>gi|154244295|ref|YP_001415253.1| glutathione synthetase [Xanthobacter autotrophicus Py2]
 gi|154158380|gb|ABS65596.1| glutathione synthetase [Xanthobacter autotrophicus Py2]
          Length = 315

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 168/312 (53%), Positives = 234/312 (75%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HI+ + V  DSTFA+ LEAQ RG+ +FHYTPD++ MRD  ++A  +PL +
Sbjct: 1   MALKVAVQMDHIANINVAGDSTFALLLEAQARGHDLFHYTPDRMAMRDGAVFATVEPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++   ++SLGE++ I L++MDV+L+RQDPPF+M Y+T+T+LLE+I+P+TL+VN+P  +R
Sbjct: 61  KDEAGAHFSLGEKRRIALTEMDVVLMRQDPPFDMAYVTATHLLERIHPKTLVVNDPAHVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEKIFVTEF ELMPPTLISRD+++I  F  E  D+++KPLYGNGG  VFR+T  D NF
Sbjct: 121 NAPEKIFVTEFPELMPPTLISRDLSEIKAFRAEFGDVVMKPLYGNGGAAVFRLTADDLNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL ++    + EP +IQ +LP ++ GDKRI+L++G+  GAVNR+PSE D RSN+  GG 
Sbjct: 181 GSLYDLFATTFREPWVIQQFLPAVKHGDKRIILVDGEAAGAVNRVPSEGDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T LT  +L+IC RIG SL++ GL F GIDVI   +TEINVTSPT +R I R GG ++
Sbjct: 241 ARPTDLTDRELEICARIGPSLKKMGLIFVGIDVIDGNLTEINVTSPTGLRAIKRLGGPDI 300

Query: 303 ASLFWDGIEKIK 314
           A+  WD IE+ +
Sbjct: 301 AAQIWDRIEEKR 312


>gi|330941628|gb|EGH44409.1| glutathione synthetase [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 319

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 189/315 (60%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLYQNAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEQHGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI +  G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIAKAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D IEK  +
Sbjct: 301 NIGGLLMDAIEKKLQ 315


>gi|157148496|ref|YP_001455815.1| glutathione synthetase [Citrobacter koseri ATCC BAA-895]
 gi|157085701|gb|ABV15379.1| hypothetical protein CKO_04322 [Citrobacter koseri ATCC BAA-895]
          Length = 315

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  + +Y+  +E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  QNYDNWYTFNDEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWQKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT  D +I +RIG +L+ +GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTDSDWEIARRIGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|299133255|ref|ZP_07026450.1| glutathione synthetase [Afipia sp. 1NLS2]
 gi|298593392|gb|EFI53592.1| glutathione synthetase [Afipia sp. 1NLS2]
          Length = 313

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 151/313 (48%), Positives = 223/313 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I+ + V+ DSTFA+ LEAQ RG+++F+YTP++L +    + A  QPL +
Sbjct: 1   MTLKVAVQMDPIARINVRGDSTFAMLLEAQKRGHELFYYTPERLSLSGKDVVAFVQPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++   +++LGE K  ++   DV+L+RQDPPF++ Y+T+T+LLE+I+P+TL+VN+P  +R
Sbjct: 61  RDEPGNHFTLGEAKHTNMQSFDVVLLRQDPPFDLAYVTTTHLLERIHPKTLVVNDPTSVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++PEKIFV EFS+LM PTLISRD  +I  F  E  D++ KPLYG+GG  VFRI   D NF
Sbjct: 121 DAPEKIFVMEFSDLMTPTLISRDKEEIELFRKEHGDVVFKPLYGHGGAAVFRIAAQDMNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL ++    + EP ++Q +LP ++ GDKRI+L++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLYDLFSVTFREPWVVQKFLPGVKAGDKRIILVDGEFAGAVNRVPAPDDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A+ T LT  + +IC+R+G SL+E+GL F G+DVI  ++TEINVTSPT IR I   GG +V
Sbjct: 241 AKATDLTPREREICERVGPSLKEKGLLFVGLDVIDGHLTEINVTSPTGIRAIANLGGPDV 300

Query: 303 ASLFWDGIEKIKE 315
           A+  W+ IE  + 
Sbjct: 301 AAHIWNAIEARRR 313


>gi|331674428|ref|ZP_08375188.1| glutathione synthase [Escherichia coli TA280]
 gi|323966464|gb|EGB61897.1| glutathione synthase [Escherichia coli M863]
 gi|323978758|gb|EGB73839.1| glutathione synthase [Escherichia coli TW10509]
 gi|327251715|gb|EGE63401.1| glutathione synthase [Escherichia coli STEC_7v]
 gi|331068522|gb|EGI39917.1| glutathione synthase [Escherichia coli TA280]
          Length = 316

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 203/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|121590703|ref|ZP_01678035.1| glutathione synthetase [Vibrio cholerae 2740-80]
 gi|121547434|gb|EAX57543.1| glutathione synthetase [Vibrio cholerae 2740-80]
          Length = 318

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 124/314 (39%), Positives = 193/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLEQGVALADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS++D IL+R+DPPF+  YI +TY+LE+  +   L+VN P  +R
Sbjct: 61  EDPSGWYQFKSEQTIALSELDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPITMVTRKAEKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLSETDKKIALEVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D I +  +
Sbjct: 301 ITGKLMDAIGRRLK 314


>gi|114770142|ref|ZP_01447680.1| glutathione synthetase [alpha proteobacterium HTCC2255]
 gi|114548979|gb|EAU51862.1| glutathione synthetase [alpha proteobacterium HTCC2255]
          Length = 312

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 152/309 (49%), Positives = 216/309 (69%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IAIQM+ I  V +  DSTF I  EAQ+RG+++++Y P+QL   + +I A+  P+S+
Sbjct: 1   MHLRIAIQMDPIELVDINADSTFRIMEEAQLRGHELYYYNPEQLAFEEGEITAHGWPISV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
           D  K ++++ GE   + L   DV+ +RQDPPF+M YIT+T+LLE ++P+TL+VN+P W+R
Sbjct: 61  DRVKGKHFTKGEFTKVYLKNFDVVWLRQDPPFDMGYITNTHLLEMVHPDTLVVNDPKWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N PEK+ V  F +L PPT I+RDI  +  F  + KDII+KPLYGNGG GVFR+   DRN 
Sbjct: 121 NYPEKLLVLNFPDLTPPTTIARDIEILKTFKNKYKDIILKPLYGNGGAGVFRLDENDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL E+      EPL+ Q +L  +  GDKRI+L++G+PVGA+NR+P++ + RSN+H GG+
Sbjct: 181 NSLHELFSSINTEPLIAQKFLAAVSKGDKRIILVDGEPVGAINRVPAKGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E  +L + DL+IC++IG  LR++G  F GIDVIG ++TEINVTSPT I+E+ R    NV
Sbjct: 241 PEKVELDERDLEICEKIGPLLRKKGQIFVGIDVIGGFLTEINVTSPTGIQELERFNEINV 300

Query: 303 ASLFWDGIE 311
           A   W  IE
Sbjct: 301 AEKIWLSIE 309


>gi|28899385|ref|NP_798990.1| glutathione synthetase [Vibrio parahaemolyticus RIMD 2210633]
 gi|260366256|ref|ZP_05778715.1| glutathione synthase [Vibrio parahaemolyticus K5030]
 gi|260878927|ref|ZP_05891282.1| glutathione synthase [Vibrio parahaemolyticus AN-5034]
 gi|260898272|ref|ZP_05906768.1| glutathione synthase [Vibrio parahaemolyticus Peru-466]
 gi|260903376|ref|ZP_05911771.1| glutathione synthase [Vibrio parahaemolyticus AQ4037]
 gi|31076673|sp|Q87LK1|GSHB_VIBPA RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|28807621|dbj|BAC60874.1| glutathione synthetase [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085850|gb|EFO35545.1| glutathione synthase [Vibrio parahaemolyticus Peru-466]
 gi|308090486|gb|EFO40181.1| glutathione synthase [Vibrio parahaemolyticus AN-5034]
 gi|308107478|gb|EFO45018.1| glutathione synthase [Vibrio parahaemolyticus AQ4037]
 gi|308113530|gb|EFO51070.1| glutathione synthase [Vibrio parahaemolyticus K5030]
          Length = 316

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 127/314 (40%), Positives = 196/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L++   K  A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGKAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E++I+LS++D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQMIELSELDAVLMRKDPPFDTEYIYATYILERAEEQGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  E  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFREEHGDVILKPLDGMGGASIFRVKENDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D+ I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDMKIAQAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRVK 314


>gi|254230224|ref|ZP_04923616.1| glutathione synthase [Vibrio sp. Ex25]
 gi|262393235|ref|YP_003285089.1| glutathione synthetase [Vibrio sp. Ex25]
 gi|151937256|gb|EDN56122.1| glutathione synthase [Vibrio sp. Ex25]
 gi|262336829|gb|ACY50624.1| glutathione synthetase [Vibrio sp. Ex25]
          Length = 316

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGVAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+LS++D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQTIELSELDAVLMRKDPPFDTEYIYATYILERAEEQGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKEFREKHGDVILKPLDGMGGASIFRVKENDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D+ I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDIKIAQTVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRVK 314


>gi|237729878|ref|ZP_04560359.1| glutathione synthetase [Citrobacter sp. 30_2]
 gi|226908484|gb|EEH94402.1| glutathione synthetase [Citrobacter sp. 30_2]
          Length = 315

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +     LY+ + +  A+T+ LS++
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMLLEAQRRGYEIHYMEMADLYLINGEARAHTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFKSEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFADLTPETLVTRNKAQLKAFWQKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIQDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT  D +I +RIG +L+ +GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTDSDWEIARRIGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|295097486|emb|CBK86576.1| glutathione synthase [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 315

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 204/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +   + LY+ + +  A T+ ++++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMNDLYLINGEARARTRIVNVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E++Y  G E+ I L+ ++VIL+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEKWYEFGTEQDIALADLNVILMRKDPPFDTEYIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   FS+L P TL++R  TQ+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFSDLTPETLVTRSKTQLKEFWQKHGDIIMKPLDGMGGASIFRVKEGDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TE+NVTSPTCIREI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEVNVTSPTCIREIEAEFPIS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IEK  +
Sbjct: 301 ITGMLMDAIEKRLQ 314


>gi|329296975|ref|ZP_08254311.1| glutathione synthetase [Plautia stali symbiont]
          Length = 314

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 131/311 (42%), Positives = 199/311 (63%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +     L +R    YA T+ LS++
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMLLEAQRRGYEIHYMEMGDLSLRGGVTYACTRLLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +Q+Y+ G E+ I L+ ++V+L+R+DPPF+  +I +TYLLE+     TLIVN    +R
Sbjct: 61  QNYDQWYTFGSEQTILLADLNVVLMRKDPPFDTEFIYATYLLERAEEQGTLIVNKQQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F++L P TL++R+  Q+  F+ E  D+I KPL G GG  +FRI   D NF
Sbjct: 121 DCNEKLYTAWFADLTPDTLVTRNKEQLRAFWQEHGDVIFKPLGGMGGASIFRIKKDDANF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L        M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVITETLTNHGQFFCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L+  D +I +R+G +L+ +GL F G+D+IGD +TE+NVTSPTCIREI      +
Sbjct: 241 RGEARPLSDSDWEIARRVGPTLKAKGLIFVGLDIIGDKLTEVNVTSPTCIREIEAAFPVS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|323498677|ref|ZP_08103668.1| glutathione synthetase [Vibrio sinaloensis DSM 21326]
 gi|323316277|gb|EGA69297.1| glutathione synthetase [Vibrio sinaloensis DSM 21326]
          Length = 315

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 127/313 (40%), Positives = 191/313 (61%), Gaps = 2/313 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +     L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMADLHLDQGVAVADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I+LS++D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  EDPNGWYQFKSEQTIELSELDAVLMRKDPPFDTEYIYATYILERAEENGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  E  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFRDEHGDVILKPLDGMGGASIFRVKENDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDKKIAAAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDVS 300

Query: 302 VASLFWDGIEKIK 314
           +     D IE+  
Sbjct: 301 ITGKLMDAIERRI 313


>gi|227888502|ref|ZP_04006307.1| glutathione synthetase [Escherichia coli 83972]
 gi|227834771|gb|EEJ45237.1| glutathione synthetase [Escherichia coli 83972]
 gi|307554929|gb|ADN47704.1| glutathione synthetase [Escherichia coli ABU 83972]
          Length = 316

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T  LS++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTHTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+  +  TLIVN P  +R
Sbjct: 61  QNYDKWYEFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEDKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|323183518|gb|EFZ68915.1| glutathione synthase [Escherichia coli 1357]
          Length = 316

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPALKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|251788142|ref|YP_003002863.1| glutathione synthetase [Dickeya zeae Ech1591]
 gi|247536763|gb|ACT05384.1| glutathione synthetase [Dickeya zeae Ech1591]
          Length = 317

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 122/312 (39%), Positives = 193/312 (61%), Gaps = 3/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+  EAQ RG+++ +     LY+   +  A T+ LS+ 
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLQEAQRRGWEVHYMEMGDLYLHAGEARATTRTLSVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              + +Y  G  + I L ++DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  YDYDHWYDFGATQDIALHELDVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F +L P TL++R+  ++  F+    D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPQLTPDTLVTRNADRLRAFHQRHSDVILKPLDGMGGASIFRLKPEDANV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLSESDWQIARTVAPVLKQKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAYPDV 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IE+
Sbjct: 301 SITGMLMDAIER 312


>gi|260773597|ref|ZP_05882513.1| glutathione synthetase [Vibrio metschnikovii CIP 69.14]
 gi|260612736|gb|EEX37939.1| glutathione synthetase [Vibrio metschnikovii CIP 69.14]
          Length = 318

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 128/314 (40%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGYQI +     L++      A+T+ +S+ 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYQIHYMEMADLHLEQGVALADTKVVSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I L+ +D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  EDPAAWYQFQSEQTIRLADLDAVLMRKDPPFDTEYIYATYILERAEEEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG+ +FRI  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTMVTRKAEKIKAFREQHGDVILKPLDGMGGSSIFRIKQGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQTYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPLSETDKAIALAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRIK 314


>gi|261346260|ref|ZP_05973904.1| glutathione synthase [Providencia rustigianii DSM 4541]
 gi|282565568|gb|EFB71103.1| glutathione synthase [Providencia rustigianii DSM 4541]
          Length = 315

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 195/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++K+K+D++FA+ LEA  RGY+I +   + LY+   +  A T+ ++++
Sbjct: 1   MIKLGIVMDPISSIKIKKDTSFAMMLEAGRRGYEIHYMEMNDLYLHQGEARATTKIVTVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIR 122
           E   ++Y    E+ I L  +D IL+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  ENPNKWYEFKSEQDIALGDLDAILMRKDPPFDTEYIYATYILERAEQAGCLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R   ++  F+ +  D+I KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVTRSSDKLRAFHQKHGDVIFKPLDGMGGASIFRLKQDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L E      M Q++LP I+DGDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 GVIIETLTEHNSRYCMAQNFLPAIKDGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I + +  +L+E+GL F G+D+IGD +TEINVTSPTC REI      +
Sbjct: 241 RGEARPLTESDWAIARAVAPTLKEKGLIFVGLDIIGDRLTEINVTSPTCAREIEAAFDIS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE+  +
Sbjct: 301 ITGMLMDAIERRLQ 314


>gi|82545430|ref|YP_409377.1| glutathione synthetase [Shigella boydii Sb227]
 gi|187730682|ref|YP_001881720.1| glutathione synthetase [Shigella boydii CDC 3083-94]
 gi|81246841|gb|ABB67549.1| glutathione synthetase [Shigella boydii Sb227]
 gi|187427674|gb|ACD06948.1| glutathione synthase [Shigella boydii CDC 3083-94]
 gi|320184294|gb|EFW59106.1| Glutathione synthetase [Shigella flexneri CDC 796-83]
 gi|332091334|gb|EGI96422.1| glutathione synthase [Shigella boydii 3594-74]
          Length = 316

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVLLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|149376904|ref|ZP_01894659.1| glutathione synthetase [Marinobacter algicola DG893]
 gi|149358796|gb|EDM47265.1| glutathione synthetase [Marinobacter algicola DG893]
          Length = 315

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 123/315 (39%), Positives = 191/315 (60%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG++I +     LY++  +  A T+ L++
Sbjct: 1   MTVRLGIVMDPIEKIHFKKDSSLAMLLAAQKRGWEIEYMELPDLYLKGGQARARTRDLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW-I 121
               E ++  G  +   L  +DVIL+RQDPP +  ++ +T++LE    +  +V NP   +
Sbjct: 61  RPDPEDWFGFGGTQDRALGDLDVILMRQDPPVDREFLMATFILEIAEQQGALVVNPASTL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F  +F +  PP +++R   ++  FY E  D+I+KP+ G GG  +FR+   D N
Sbjct: 121 RDCNEKLFAAQFEDCTPPLIVTRSAERLKEFYAEHGDVIMKPVDGMGGRSIFRVKENDDN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              +IE L        M Q Y+P+I+ GDKRILL++G+P+   + RIPS+ +NR N+ AG
Sbjct: 181 LGVIIETLTNYGAHQAMAQKYIPEIKQGDKRILLIDGEPIPYALARIPSQGENRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E  +LT  D +IC R+   L+E+GL F GIDVIGDY+TEINVTSPTCIRE+    G 
Sbjct: 241 GRGEGRELTVRDREICDRVAPVLKEKGLIFVGIDVIGDYLTEINVTSPTCIRELDAAYGI 300

Query: 301 NVASLFWDGIEKIKE 315
           +++S   D IE+  +
Sbjct: 301 DISSQLLDAIERRLK 315


>gi|209760094|gb|ACI78359.1| glutathione synthetase [Escherichia coli]
          Length = 315

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLNNGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|192288755|ref|YP_001989360.1| glutathione synthetase [Rhodopseudomonas palustris TIE-1]
 gi|192282504|gb|ACE98884.1| glutathione synthetase [Rhodopseudomonas palustris TIE-1]
          Length = 313

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 154/312 (49%), Positives = 224/312 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I+ + ++ DSTFA+ LEAQ RG+ I ++TPD+L +R + + A+ Q L +
Sbjct: 1   MTLKVAVQMDPIARINIRGDSTFALLLEAQARGHAISYFTPDKLSLRGNDVVASVQSLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            +++  +++LGE   +D+   DV+L+RQDPPF++ YITST+LLE+I+P TL+VNNP  +R
Sbjct: 61  RDQEGDHFTLGEPARVDMRSYDVVLLRQDPPFDLAYITSTHLLERIHPATLVVNNPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F+ELMPPTLISRD  +I  F  E   +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMDFAELMPPTLISRDKDEINAFRAEHGAVVMKPLHGHGGAAVFRVLPQDINF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+P+E D RSN+  GG 
Sbjct: 181 GSLYDMFAVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAEDDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T+L+  + +IC  +G  LRERGL F GIDVI  Y+TEINVTSPT IR + R GG ++
Sbjct: 241 AAATELSPREREICATLGPKLRERGLLFVGIDVIDGYLTEINVTSPTGIRAVARLGGPDI 300

Query: 303 ASLFWDGIEKIK 314
           A+  WD IE  +
Sbjct: 301 AAKIWDVIEAKR 312


>gi|26991670|ref|NP_747095.1| glutathione synthetase [Pseudomonas putida KT2440]
 gi|38257479|sp|Q88D35|GSHB_PSEPK RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|24986768|gb|AAN70559.1|AE016698_7 glutathione synthetase [Pseudomonas putida KT2440]
          Length = 317

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 134/315 (42%), Positives = 197/315 (62%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY  + K  A  +PL +
Sbjct: 1   MSVRLGIVMDPIASISYKKDSSLAMLLAAQARGWSLFYMEQQDLYQGEGKARARMRPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                +++ LGEE+   L+++DVIL+R+DPPF+M ++ STYLLE+  N   L+VN P  +
Sbjct: 61  FADPARWFELGEEQDSPLAELDVILMRKDPPFDMEFVYSTYLLEQAENDGVLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +   PTL+SR    I  F  +  D+I+KPL G GGT +FR   GD N
Sbjct: 121 RDCNEKMFATLFPQCTTPTLVSRRPDIIREFTAKHADVILKPLDGMGGTSIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTALGTQQIMAQAYLPAIKDGDKRILMIDGEPVDYCLARIPASGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT+ D  I  ++G +LRE+GL F G+DVIGDY+TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLTERDRWIAAQVGPTLREKGLLFVGLDVIGDYLTEINVTSPTCIREIDAAYNT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++     D I++  +
Sbjct: 301 DIGGKLMDAIDRKLK 315


>gi|313500969|gb|ADR62335.1| GshB [Pseudomonas putida BIRD-1]
          Length = 317

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 133/315 (42%), Positives = 196/315 (62%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY  + K  A  +PL +
Sbjct: 1   MSVRLGIVMDPIASISYKKDSSLAMLLAAQARGWSLFYMEQQDLYQGEGKARARMRPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                +++ LGEE+   L+++D IL+R+DPPF+M ++ STYLLE+  N   L+VN P  +
Sbjct: 61  FADPARWFELGEEQDSPLAELDAILMRKDPPFDMEFVYSTYLLEQAENDGVLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +   PTL+SR    I  F  +  D+I+KPL G GGT +FR   GD N
Sbjct: 121 RDCNEKMFATLFPQCTTPTLVSRRPDIIREFTAKHADVILKPLDGMGGTSIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTALGTQQIMAQAYLPAIKDGDKRILMIDGEPVDYCLARIPASGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT+ D  I  ++G +LRE+GL F G+DVIGDY+TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLTERDRWIAAQVGPTLREKGLLFVGLDVIGDYLTEINVTSPTCIREIDAAYNT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++     D I++  +
Sbjct: 301 DIGGKLMDAIDRKLK 315


>gi|300928110|ref|ZP_07143655.1| glutathione synthase [Escherichia coli MS 187-1]
 gi|300463876|gb|EFK27369.1| glutathione synthase [Escherichia coli MS 187-1]
          Length = 316

 Score =  305 bits (782), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 132/314 (42%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  ANT+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARANTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKENGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|90421843|ref|YP_530213.1| glutathione synthetase [Rhodopseudomonas palustris BisB18]
 gi|90103857|gb|ABD85894.1| glutathione synthase [Rhodopseudomonas palustris BisB18]
          Length = 313

 Score =  305 bits (782), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 152/312 (48%), Positives = 228/312 (73%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+A+QM+ I+ + ++ DSTFA+ LEAQ RG+ + +YTPDQL +R + +  + Q LS+
Sbjct: 1   MTLNVAVQMDPIARINIRGDSTFALLLEAQQRGHTLSYYTPDQLSLRGNDLVGSVQSLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++   +++LGE +  ++   DV+L+RQDPPF++ YIT+T+ LE+I+P+TL+VN+P  +R
Sbjct: 61  RDQPGDHFTLGEAQRKNMRDFDVVLLRQDPPFDLAYITNTHFLERIHPDTLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F++LMPPTLISR++ +I  F  E   +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMDFADLMPPTLISRNLAEINSFRAEHGAVVMKPLHGHGGAAVFRVLPQDMNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+P+E D RSN+  GG 
Sbjct: 181 GSLFDMFSVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAEDDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T LT+ + +IC+R+G  LR+RGL F GIDVI  ++TEINVTSPT IR I + GG +V
Sbjct: 241 ARATDLTEREREICERLGPHLRQRGLLFVGIDVIDGHLTEINVTSPTGIRAIAKLGGPDV 300

Query: 303 ASLFWDGIEKIK 314
           A+  WD IEK +
Sbjct: 301 AARIWDVIEKKR 312


>gi|332086876|gb|EGI92012.1| glutathione synthase [Shigella boydii 5216-82]
          Length = 316

 Score =  305 bits (782), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE      TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILECAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLMVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|16130848|ref|NP_417422.1| glutathione synthetase [Escherichia coli str. K-12 substr. MG1655]
 gi|89109724|ref|AP_003504.1| glutathione synthetase [Escherichia coli str. K-12 substr. W3110]
 gi|157154957|ref|YP_001464299.1| glutathione synthetase [Escherichia coli E24377A]
 gi|157162406|ref|YP_001459724.1| glutathione synthetase [Escherichia coli HS]
 gi|170018812|ref|YP_001723766.1| glutathione synthetase [Escherichia coli ATCC 8739]
 gi|170082499|ref|YP_001731819.1| glutathione synthetase [Escherichia coli str. K-12 substr. DH10B]
 gi|170683849|ref|YP_001745108.1| glutathione synthetase [Escherichia coli SMS-3-5]
 gi|188495727|ref|ZP_03002997.1| glutathione synthase [Escherichia coli 53638]
 gi|193063505|ref|ZP_03044594.1| glutathione synthase [Escherichia coli E22]
 gi|193067259|ref|ZP_03048227.1| glutathione synthase [Escherichia coli E110019]
 gi|194426221|ref|ZP_03058776.1| glutathione synthase [Escherichia coli B171]
 gi|194431807|ref|ZP_03064098.1| glutathione synthase [Shigella dysenteriae 1012]
 gi|209920406|ref|YP_002294490.1| glutathione synthetase [Escherichia coli SE11]
 gi|218555506|ref|YP_002388419.1| glutathione synthetase [Escherichia coli IAI1]
 gi|218696545|ref|YP_002404212.1| glutathione synthetase [Escherichia coli 55989]
 gi|218706462|ref|YP_002413981.1| glutathione synthetase [Escherichia coli UMN026]
 gi|238902069|ref|YP_002927865.1| glutathione synthetase [Escherichia coli BW2952]
 gi|253772215|ref|YP_003035046.1| glutathione synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254037996|ref|ZP_04872054.1| glutathione synthetase [Escherichia sp. 1_1_43]
 gi|254162857|ref|YP_003045965.1| glutathione synthetase [Escherichia coli B str. REL606]
 gi|256019251|ref|ZP_05433116.1| glutathione synthetase [Shigella sp. D9]
 gi|260845617|ref|YP_003223395.1| glutathione synthetase [Escherichia coli O103:H2 str. 12009]
 gi|260857080|ref|YP_003230971.1| glutathione synthetase [Escherichia coli O26:H11 str. 11368]
 gi|260869634|ref|YP_003236036.1| glutathione synthetase [Escherichia coli O111:H- str. 11128]
 gi|293406454|ref|ZP_06650380.1| glutathione synthetase [Escherichia coli FVEC1412]
 gi|293412307|ref|ZP_06655030.1| glutathione synthase [Escherichia coli B354]
 gi|293449277|ref|ZP_06663698.1| glutathione synthase [Escherichia coli B088]
 gi|298382191|ref|ZP_06991788.1| glutathione synthetase [Escherichia coli FVEC1302]
 gi|300815583|ref|ZP_07095807.1| glutathione synthase [Escherichia coli MS 107-1]
 gi|300824848|ref|ZP_07104951.1| glutathione synthase [Escherichia coli MS 119-7]
 gi|300900236|ref|ZP_07118420.1| glutathione synthase [Escherichia coli MS 198-1]
 gi|300906489|ref|ZP_07124184.1| glutathione synthase [Escherichia coli MS 84-1]
 gi|300921288|ref|ZP_07137657.1| glutathione synthase [Escherichia coli MS 115-1]
 gi|300940771|ref|ZP_07155317.1| glutathione synthase [Escherichia coli MS 21-1]
 gi|300947677|ref|ZP_07161846.1| glutathione synthase [Escherichia coli MS 116-1]
 gi|300954207|ref|ZP_07166672.1| glutathione synthase [Escherichia coli MS 175-1]
 gi|301027302|ref|ZP_07190648.1| glutathione synthase [Escherichia coli MS 69-1]
 gi|301027728|ref|ZP_07191038.1| glutathione synthase [Escherichia coli MS 196-1]
 gi|301306392|ref|ZP_07212461.1| glutathione synthase [Escherichia coli MS 124-1]
 gi|301327363|ref|ZP_07220613.1| glutathione synthase [Escherichia coli MS 78-1]
 gi|301643700|ref|ZP_07243739.1| glutathione synthase [Escherichia coli MS 146-1]
 gi|307139632|ref|ZP_07498988.1| glutathione synthetase [Escherichia coli H736]
 gi|307310432|ref|ZP_07590080.1| glutathione synthetase [Escherichia coli W]
 gi|312972812|ref|ZP_07786985.1| glutathione synthase [Escherichia coli 1827-70]
 gi|331643640|ref|ZP_08344771.1| glutathione synthase [Escherichia coli H736]
 gi|331654459|ref|ZP_08355459.1| glutathione synthase [Escherichia coli M718]
 gi|331664530|ref|ZP_08365436.1| glutathione synthase [Escherichia coli TA143]
 gi|331669690|ref|ZP_08370536.1| glutathione synthase [Escherichia coli TA271]
 gi|331678939|ref|ZP_08379613.1| glutathione synthase [Escherichia coli H591]
 gi|332280359|ref|ZP_08392772.1| glutathione synthetase [Shigella sp. D9]
 gi|121663|sp|P04425|GSHB_ECOLI RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|157831252|pdb|1GSA|A Chain A, Structure Of Glutathione Synthetase Complexed With Adp And
           Glutathione
 gi|157831253|pdb|1GSH|A Chain A, Structure Of Escherichia Coli Glutathione Synthetase At Ph
           7.5
 gi|157835039|pdb|2GLT|A Chain A, Structure Of Escherichia Coli Glutathione Synthetase At Ph
           6.0.
 gi|41625|emb|CAA25826.1| unnamed protein product [Escherichia coli]
 gi|882476|gb|AAA69114.1| glutathione synthetase [Escherichia coli str. K-12 substr. MG1655]
 gi|1789316|gb|AAC75984.1| glutathione synthetase [Escherichia coli str. K-12 substr. MG1655]
 gi|85675757|dbj|BAE77010.1| glutathione synthetase [Escherichia coli str. K12 substr. W3110]
 gi|157068086|gb|ABV07341.1| glutathione synthase [Escherichia coli HS]
 gi|157076987|gb|ABV16695.1| glutathione synthase [Escherichia coli E24377A]
 gi|169753740|gb|ACA76439.1| glutathione synthetase [Escherichia coli ATCC 8739]
 gi|169890334|gb|ACB04041.1| glutathione synthetase [Escherichia coli str. K-12 substr. DH10B]
 gi|170521567|gb|ACB19745.1| glutathione synthase [Escherichia coli SMS-3-5]
 gi|188490926|gb|EDU66029.1| glutathione synthase [Escherichia coli 53638]
 gi|192930782|gb|EDV83387.1| glutathione synthase [Escherichia coli E22]
 gi|192959216|gb|EDV89651.1| glutathione synthase [Escherichia coli E110019]
 gi|194415529|gb|EDX31796.1| glutathione synthase [Escherichia coli B171]
 gi|194420163|gb|EDX36241.1| glutathione synthase [Shigella dysenteriae 1012]
 gi|209913665|dbj|BAG78739.1| glutathione synthase [Escherichia coli SE11]
 gi|218353277|emb|CAU99234.1| glutathione synthetase [Escherichia coli 55989]
 gi|218362274|emb|CAQ99895.1| glutathione synthetase [Escherichia coli IAI1]
 gi|218433559|emb|CAR14462.1| glutathione synthetase [Escherichia coli UMN026]
 gi|226839620|gb|EEH71641.1| glutathione synthetase [Escherichia sp. 1_1_43]
 gi|238861351|gb|ACR63349.1| glutathione synthetase [Escherichia coli BW2952]
 gi|242378473|emb|CAQ33257.1| glutathione synthetase monomer, subunit of glutathione synthetase
           [Escherichia coli BL21(DE3)]
 gi|253323259|gb|ACT27861.1| glutathione synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974758|gb|ACT40429.1| glutathione synthetase [Escherichia coli B str. REL606]
 gi|253978924|gb|ACT44594.1| glutathione synthetase [Escherichia coli BL21(DE3)]
 gi|257755729|dbj|BAI27231.1| glutathione synthetase [Escherichia coli O26:H11 str. 11368]
 gi|257760764|dbj|BAI32261.1| glutathione synthetase [Escherichia coli O103:H2 str. 12009]
 gi|257765990|dbj|BAI37485.1| glutathione synthetase [Escherichia coli O111:H- str. 11128]
 gi|260448010|gb|ACX38432.1| glutathione synthetase [Escherichia coli DH1]
 gi|284922890|emb|CBG35979.1| glutathione synthetase [Escherichia coli 042]
 gi|291322367|gb|EFE61796.1| glutathione synthase [Escherichia coli B088]
 gi|291426460|gb|EFE99492.1| glutathione synthetase [Escherichia coli FVEC1412]
 gi|291469078|gb|EFF11569.1| glutathione synthase [Escherichia coli B354]
 gi|298277331|gb|EFI18847.1| glutathione synthetase [Escherichia coli FVEC1302]
 gi|299879164|gb|EFI87375.1| glutathione synthase [Escherichia coli MS 196-1]
 gi|300318791|gb|EFJ68575.1| glutathione synthase [Escherichia coli MS 175-1]
 gi|300356252|gb|EFJ72122.1| glutathione synthase [Escherichia coli MS 198-1]
 gi|300395108|gb|EFJ78646.1| glutathione synthase [Escherichia coli MS 69-1]
 gi|300401732|gb|EFJ85270.1| glutathione synthase [Escherichia coli MS 84-1]
 gi|300411750|gb|EFJ95060.1| glutathione synthase [Escherichia coli MS 115-1]
 gi|300452723|gb|EFK16343.1| glutathione synthase [Escherichia coli MS 116-1]
 gi|300454471|gb|EFK17964.1| glutathione synthase [Escherichia coli MS 21-1]
 gi|300522686|gb|EFK43755.1| glutathione synthase [Escherichia coli MS 119-7]
 gi|300531512|gb|EFK52574.1| glutathione synthase [Escherichia coli MS 107-1]
 gi|300838387|gb|EFK66147.1| glutathione synthase [Escherichia coli MS 124-1]
 gi|300846047|gb|EFK73807.1| glutathione synthase [Escherichia coli MS 78-1]
 gi|301077902|gb|EFK92708.1| glutathione synthase [Escherichia coli MS 146-1]
 gi|306909327|gb|EFN39822.1| glutathione synthetase [Escherichia coli W]
 gi|309703302|emb|CBJ02638.1| glutathione synthetase [Escherichia coli ETEC H10407]
 gi|310332754|gb|EFP99967.1| glutathione synthase [Escherichia coli 1827-70]
 gi|315062253|gb|ADT76580.1| glutathione synthetase [Escherichia coli W]
 gi|315137544|dbj|BAJ44703.1| glutathione synthetase [Escherichia coli DH1]
 gi|315256839|gb|EFU36807.1| glutathione synthase [Escherichia coli MS 85-1]
 gi|315614892|gb|EFU95530.1| glutathione synthase [Escherichia coli 3431]
 gi|320181048|gb|EFW55969.1| Glutathione synthetase [Shigella boydii ATCC 9905]
 gi|323154656|gb|EFZ40855.1| glutathione synthase [Escherichia coli EPECa14]
 gi|323162607|gb|EFZ48454.1| glutathione synthase [Escherichia coli E128010]
 gi|323168001|gb|EFZ53690.1| glutathione synthase [Shigella sonnei 53G]
 gi|323173839|gb|EFZ59468.1| glutathione synthase [Escherichia coli LT-68]
 gi|323180407|gb|EFZ65959.1| glutathione synthase [Escherichia coli 1180]
 gi|323377163|gb|ADX49431.1| glutathione synthetase [Escherichia coli KO11]
 gi|323936050|gb|EGB32345.1| glutathione synthase [Escherichia coli E1520]
 gi|323941967|gb|EGB38146.1| glutathione synthase [Escherichia coli E482]
 gi|323946555|gb|EGB42578.1| glutathione synthase [Escherichia coli H120]
 gi|323971706|gb|EGB66934.1| glutathione synthase [Escherichia coli TA007]
 gi|324017219|gb|EGB86438.1| glutathione synthase [Escherichia coli MS 117-3]
 gi|324119742|gb|EGC13622.1| glutathione synthase [Escherichia coli E1167]
 gi|331037111|gb|EGI09335.1| glutathione synthase [Escherichia coli H736]
 gi|331047841|gb|EGI19918.1| glutathione synthase [Escherichia coli M718]
 gi|331058461|gb|EGI30442.1| glutathione synthase [Escherichia coli TA143]
 gi|331063358|gb|EGI35271.1| glutathione synthase [Escherichia coli TA271]
 gi|331073769|gb|EGI45090.1| glutathione synthase [Escherichia coli H591]
 gi|332087734|gb|EGI92861.1| glutathione synthase [Shigella dysenteriae 155-74]
 gi|332102711|gb|EGJ06057.1| glutathione synthetase [Shigella sp. D9]
 gi|332344846|gb|AEE58180.1| glutathione synthase GshB [Escherichia coli UMNK88]
 gi|332999694|gb|EGK19279.1| glutathione synthase [Shigella flexneri VA-6]
          Length = 316

 Score =  305 bits (782), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|170023087|ref|YP_001719592.1| glutathione synthetase [Yersinia pseudotuberculosis YPIII]
 gi|169749621|gb|ACA67139.1| glutathione synthetase [Yersinia pseudotuberculosis YPIII]
          Length = 319

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 129/312 (41%), Positives = 202/312 (64%), Gaps = 3/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+ LEAQ RG+++ +     LYMR     A T+ L++ 
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLLEAQRRGWELHYMEMGDLYMRGGDGRARTRRLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           + K+ ++S G E+ + L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R
Sbjct: 61  QDKDNWFSFGAEQDLPLYDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR    I +F+ E  DII+KPL G GGT +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRSKDHIRKFHQEHGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTELGSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D +I + +   L+++GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLSESDWEIARTVAPILKQKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPEI 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IE+
Sbjct: 301 SITGMLMDAIER 312


>gi|191167941|ref|ZP_03029744.1| glutathione synthase [Escherichia coli B7A]
 gi|309794036|ref|ZP_07688461.1| glutathione synthase [Escherichia coli MS 145-7]
 gi|190902026|gb|EDV61772.1| glutathione synthase [Escherichia coli B7A]
 gi|308122443|gb|EFO59705.1| glutathione synthase [Escherichia coli MS 145-7]
 gi|320202611|gb|EFW77181.1| Glutathione synthetase [Escherichia coli EC4100B]
          Length = 316

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L  +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLVDLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|39933399|ref|NP_945675.1| glutathione synthetase [Rhodopseudomonas palustris CGA009]
 gi|47605581|sp|P61396|GSHB_RHOPA RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|39647245|emb|CAE25766.1| putative glutathione synthetase [Rhodopseudomonas palustris CGA009]
          Length = 313

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 154/312 (49%), Positives = 224/312 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I+ + ++ DSTFA+ LEAQ RG+ I ++TPD+L +R + + A+ Q L +
Sbjct: 1   MTLKVAVQMDPIARINIRGDSTFALLLEAQARGHAISYFTPDKLSLRGNDVVASVQSLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            +++  +++LGE   +D+   DV+L+RQDPPF++ YITST+LLE+I+P TL+VNNP  +R
Sbjct: 61  RDQEGDHFTLGEPARVDMRSYDVVLLRQDPPFDLAYITSTHLLERIHPATLVVNNPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F+ELMPPTLISRD  +I  F  E   +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMDFTELMPPTLISRDKDEINAFRAEHGAVVMKPLHGHGGAAVFRVLPQDINF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+P+E D RSN+  GG 
Sbjct: 181 GSLYDMFAVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAEDDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T+L+  + +IC  +G  LRERGL F GIDVI  Y+TEINVTSPT IR + R GG ++
Sbjct: 241 AAATELSPREREICATLGPKLRERGLLFVGIDVIDGYLTEINVTSPTGIRAVARLGGPDI 300

Query: 303 ASLFWDGIEKIK 314
           A+  WD IE  +
Sbjct: 301 AAKIWDVIEAKR 312


>gi|259909606|ref|YP_002649962.1| glutathione synthetase [Erwinia pyrifoliae Ep1/96]
 gi|224965228|emb|CAX56760.1| glutathione synthetase [Erwinia pyrifoliae Ep1/96]
 gi|283479684|emb|CAY75600.1| glutathione synthetase [Erwinia pyrifoliae DSM 12163]
 gi|310766487|gb|ADP11437.1| glutathione synthetase [Erwinia sp. Ejp617]
          Length = 314

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 134/311 (43%), Positives = 206/311 (66%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + LY+R  +  A T+ LS++
Sbjct: 1   MIKLGIVMDPITSINIKKDSSFAMLLEAQSRGYEIHYMEMNDLYLRGGEGRARTRLLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +   Q+++ G+E+ I LS ++V+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNDSQWFAFGDEQDIALSGLNVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R+ +QI +F+ +  DII+KPL G GG  +FRI   D N 
Sbjct: 121 DCNEKLFTAWFADLTPDTLVTRNASQIRKFWQQHHDIILKPLDGMGGASIFRIKQEDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S ++E L        M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIVETLTGHGSFYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT  D +I +R+   L+++GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPLTASDWEIARRVAPILKQKGLIFVGLDIIGDKLTEINVTSPTCIREIEAAFPIS 300

Query: 302 VASLFWDGIEK 312
           V ++  D IEK
Sbjct: 301 VTAMLMDAIEK 311


>gi|218701657|ref|YP_002409286.1| glutathione synthetase [Escherichia coli IAI39]
 gi|300925057|ref|ZP_07140975.1| glutathione synthase [Escherichia coli MS 182-1]
 gi|218371643|emb|CAR19482.1| glutathione synthetase [Escherichia coli IAI39]
 gi|300418803|gb|EFK02114.1| glutathione synthase [Escherichia coli MS 182-1]
          Length = 316

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHGDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|22127197|ref|NP_670620.1| glutathione synthetase [Yersinia pestis KIM 10]
 gi|45443245|ref|NP_994784.1| glutathione synthetase [Yersinia pestis biovar Microtus str. 91001]
 gi|51597517|ref|YP_071708.1| glutathione synthetase [Yersinia pseudotuberculosis IP 32953]
 gi|108806327|ref|YP_650243.1| glutathione synthetase [Yersinia pestis Antiqua]
 gi|108813292|ref|YP_649059.1| glutathione synthetase [Yersinia pestis Nepal516]
 gi|145597887|ref|YP_001161963.1| glutathione synthetase [Yersinia pestis Pestoides F]
 gi|149367056|ref|ZP_01889089.1| glutathione synthetase [Yersinia pestis CA88-4125]
 gi|162418966|ref|YP_001607685.1| glutathione synthetase [Yersinia pestis Angola]
 gi|165925090|ref|ZP_02220922.1| glutathione synthase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165937233|ref|ZP_02225797.1| glutathione synthase [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010361|ref|ZP_02231259.1| glutathione synthase [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166212824|ref|ZP_02238859.1| glutathione synthase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399834|ref|ZP_02305352.1| glutathione synthase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422030|ref|ZP_02313783.1| glutathione synthase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426710|ref|ZP_02318463.1| glutathione synthase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|186896640|ref|YP_001873752.1| glutathione synthetase [Yersinia pseudotuberculosis PB1/+]
 gi|218928107|ref|YP_002345982.1| glutathione synthetase [Yersinia pestis CO92]
 gi|229837627|ref|ZP_04457789.1| glutathione synthetase [Yersinia pestis Pestoides A]
 gi|229840854|ref|ZP_04461013.1| glutathione synthetase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842586|ref|ZP_04462741.1| glutathione synthetase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229903755|ref|ZP_04518868.1| glutathione synthetase [Yersinia pestis Nepal516]
 gi|270487533|ref|ZP_06204607.1| glutathione synthase [Yersinia pestis KIM D27]
 gi|294502902|ref|YP_003566964.1| glutathione synthetase [Yersinia pestis Z176003]
 gi|20138178|sp|P58582|GSHB_YERPE RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|21960263|gb|AAM86871.1|AE013933_8 glutathione synthetase [Yersinia pestis KIM 10]
 gi|45438113|gb|AAS63661.1| glutathione synthetase [Yersinia pestis biovar Microtus str. 91001]
 gi|51590799|emb|CAH22445.1| Glutathione synthetase [Yersinia pseudotuberculosis IP 32953]
 gi|108776940|gb|ABG19459.1| glutathione synthase [Yersinia pestis Nepal516]
 gi|108778240|gb|ABG12298.1| glutathione synthase [Yersinia pestis Antiqua]
 gi|115346718|emb|CAL19601.1| glutathione synthetase [Yersinia pestis CO92]
 gi|145209583|gb|ABP38990.1| glutathione synthase [Yersinia pestis Pestoides F]
 gi|149290670|gb|EDM40746.1| glutathione synthetase [Yersinia pestis CA88-4125]
 gi|162351781|gb|ABX85729.1| glutathione synthase [Yersinia pestis Angola]
 gi|165914707|gb|EDR33320.1| glutathione synthase [Yersinia pestis biovar Orientalis str. IP275]
 gi|165923290|gb|EDR40441.1| glutathione synthase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990847|gb|EDR43148.1| glutathione synthase [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166206116|gb|EDR50596.1| glutathione synthase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960167|gb|EDR56188.1| glutathione synthase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050542|gb|EDR61950.1| glutathione synthase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054313|gb|EDR64132.1| glutathione synthase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|186699666|gb|ACC90295.1| glutathione synthetase [Yersinia pseudotuberculosis PB1/+]
 gi|229679525|gb|EEO75628.1| glutathione synthetase [Yersinia pestis Nepal516]
 gi|229690896|gb|EEO82950.1| glutathione synthetase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229697220|gb|EEO87267.1| glutathione synthetase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229704315|gb|EEO91326.1| glutathione synthetase [Yersinia pestis Pestoides A]
 gi|262360937|gb|ACY57658.1| glutathione synthetase [Yersinia pestis D106004]
 gi|262364877|gb|ACY61434.1| glutathione synthetase [Yersinia pestis D182038]
 gi|270336037|gb|EFA46814.1| glutathione synthase [Yersinia pestis KIM D27]
 gi|294353361|gb|ADE63702.1| glutathione synthetase [Yersinia pestis Z176003]
 gi|320013983|gb|ADV97554.1| glutathione synthetase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 319

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 129/312 (41%), Positives = 202/312 (64%), Gaps = 3/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+ LEAQ RG+++ +     LYMR     A T+ L++ 
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLLEAQRRGWELHYMEMGDLYMRGGDGRARTRRLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           + K+ ++S G E+ + L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R
Sbjct: 61  QDKDNWFSFGAEQDLPLYDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR    I +F+ E  DII+KPL G GGT +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRSKDHIRKFHQEHGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTELSSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D +I + +   L+++GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLSESDWEIARTVAPILKQKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPEI 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IE+
Sbjct: 301 SITGMLMDAIER 312


>gi|15803486|ref|NP_289519.1| glutathione synthetase [Escherichia coli O157:H7 EDL933]
 gi|15833077|ref|NP_311850.1| glutathione synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|168747561|ref|ZP_02772583.1| glutathione synthase [Escherichia coli O157:H7 str. EC4113]
 gi|168753899|ref|ZP_02778906.1| glutathione synthase [Escherichia coli O157:H7 str. EC4401]
 gi|168760089|ref|ZP_02785096.1| glutathione synthase [Escherichia coli O157:H7 str. EC4501]
 gi|168766954|ref|ZP_02791961.1| glutathione synthase [Escherichia coli O157:H7 str. EC4486]
 gi|168773414|ref|ZP_02798421.1| glutathione synthase [Escherichia coli O157:H7 str. EC4196]
 gi|168781806|ref|ZP_02806813.1| glutathione synthase [Escherichia coli O157:H7 str. EC4076]
 gi|168785805|ref|ZP_02810812.1| glutathione synthase [Escherichia coli O157:H7 str. EC869]
 gi|168797522|ref|ZP_02822529.1| glutathione synthase [Escherichia coli O157:H7 str. EC508]
 gi|195937085|ref|ZP_03082467.1| glutathione synthetase [Escherichia coli O157:H7 str. EC4024]
 gi|208808874|ref|ZP_03251211.1| glutathione synthase [Escherichia coli O157:H7 str. EC4206]
 gi|208812853|ref|ZP_03254182.1| glutathione synthase [Escherichia coli O157:H7 str. EC4045]
 gi|208819026|ref|ZP_03259346.1| glutathione synthase [Escherichia coli O157:H7 str. EC4042]
 gi|209397305|ref|YP_002272427.1| glutathione synthase [Escherichia coli O157:H7 str. EC4115]
 gi|217327944|ref|ZP_03444027.1| glutathione synthase [Escherichia coli O157:H7 str. TW14588]
 gi|254794899|ref|YP_003079736.1| glutathione synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|261226259|ref|ZP_05940540.1| glutathione synthetase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256483|ref|ZP_05949016.1| glutathione synthetase [Escherichia coli O157:H7 str. FRIK966]
 gi|291284268|ref|YP_003501086.1| Glutathione synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|20138174|sp|P58578|GSHB_ECO57 RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|12517493|gb|AAG58078.1|AE005525_4 glutathione synthetase [Escherichia coli O157:H7 str. EDL933]
 gi|13363295|dbj|BAB37246.1| glutathione synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|187770848|gb|EDU34692.1| glutathione synthase [Escherichia coli O157:H7 str. EC4196]
 gi|188017782|gb|EDU55904.1| glutathione synthase [Escherichia coli O157:H7 str. EC4113]
 gi|189000562|gb|EDU69548.1| glutathione synthase [Escherichia coli O157:H7 str. EC4076]
 gi|189358705|gb|EDU77124.1| glutathione synthase [Escherichia coli O157:H7 str. EC4401]
 gi|189363647|gb|EDU82066.1| glutathione synthase [Escherichia coli O157:H7 str. EC4486]
 gi|189369227|gb|EDU87643.1| glutathione synthase [Escherichia coli O157:H7 str. EC4501]
 gi|189373877|gb|EDU92293.1| glutathione synthase [Escherichia coli O157:H7 str. EC869]
 gi|189379640|gb|EDU98056.1| glutathione synthase [Escherichia coli O157:H7 str. EC508]
 gi|208728675|gb|EDZ78276.1| glutathione synthase [Escherichia coli O157:H7 str. EC4206]
 gi|208734130|gb|EDZ82817.1| glutathione synthase [Escherichia coli O157:H7 str. EC4045]
 gi|208739149|gb|EDZ86831.1| glutathione synthase [Escherichia coli O157:H7 str. EC4042]
 gi|209158705|gb|ACI36138.1| glutathione synthase [Escherichia coli O157:H7 str. EC4115]
 gi|209760088|gb|ACI78356.1| glutathione synthetase [Escherichia coli]
 gi|209760090|gb|ACI78357.1| glutathione synthetase [Escherichia coli]
 gi|209760092|gb|ACI78358.1| glutathione synthetase [Escherichia coli]
 gi|209760096|gb|ACI78360.1| glutathione synthetase [Escherichia coli]
 gi|217320311|gb|EEC28736.1| glutathione synthase [Escherichia coli O157:H7 str. TW14588]
 gi|254594299|gb|ACT73660.1| glutathione synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|290764141|gb|ADD58102.1| Glutathione synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|320189295|gb|EFW63954.1| Glutathione synthetase [Escherichia coli O157:H7 str. EC1212]
 gi|320640593|gb|EFX10132.1| glutathione synthetase [Escherichia coli O157:H7 str. G5101]
 gi|320645840|gb|EFX14825.1| glutathione synthetase [Escherichia coli O157:H- str. 493-89]
 gi|320651140|gb|EFX19580.1| glutathione synthetase [Escherichia coli O157:H- str. H 2687]
 gi|320656636|gb|EFX24532.1| glutathione synthetase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320662155|gb|EFX29556.1| glutathione synthetase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667231|gb|EFX34194.1| glutathione synthetase [Escherichia coli O157:H7 str. LSU-61]
 gi|326338966|gb|EGD62781.1| Glutathione synthetase [Escherichia coli O157:H7 str. 1044]
 gi|326343153|gb|EGD66921.1| Glutathione synthetase [Escherichia coli O157:H7 str. 1125]
          Length = 315

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|84394070|ref|ZP_00992806.1| glutathione synthetase [Vibrio splendidus 12B01]
 gi|84375312|gb|EAP92223.1| glutathione synthetase [Vibrio splendidus 12B01]
          Length = 316

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 129/311 (41%), Positives = 191/311 (61%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   D L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMDDLHLDQGVAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS +D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQTIALSDLDAVLMRKDPPFDTEYIYATYILERAEENGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  E  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFREEHGDVILKPLDGMGGASIFRVKEGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDWAIARAVAPALKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEK 312
           V     D IE+
Sbjct: 301 VTGKLMDAIER 311


>gi|28872149|ref|NP_794768.1| glutathione synthetase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213971484|ref|ZP_03399596.1| glutathione synthetase [Pseudomonas syringae pv. tomato T1]
 gi|301385808|ref|ZP_07234226.1| glutathione synthetase [Pseudomonas syringae pv. tomato Max13]
 gi|302062231|ref|ZP_07253772.1| glutathione synthetase [Pseudomonas syringae pv. tomato K40]
 gi|302133698|ref|ZP_07259688.1| glutathione synthetase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|38257460|sp|Q87VA4|GSHB_PSESM RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|28855403|gb|AAO58463.1| glutathione synthetase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213923766|gb|EEB57349.1| glutathione synthetase [Pseudomonas syringae pv. tomato T1]
 gi|330873923|gb|EGH08072.1| glutathione synthetase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330963798|gb|EGH64058.1| glutathione synthetase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 319

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 188/315 (59%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQDRGWTLFYMEQKDLYQNAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M +I +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEIDAGLDDLDVILMRKDPPFDMEFIYTTYLLEQAESAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    +  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADILREFAEQQGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D IEK  +
Sbjct: 301 NIGGLLMDAIEKKLQ 315


>gi|319405125|emb|CBI78731.1| glutathione synthetase [Bartonella sp. AR 15-3]
          Length = 312

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 186/307 (60%), Positives = 239/307 (77%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IAIQM+HI+T+K++ D+TFA+AL AQ RG+ +FHYTPD+L++RD  + A  +PL++ +
Sbjct: 1   MKIAIQMDHIATLKIQGDTTFALALAAQERGHSLFHYTPDRLFIRDGCVIARLEPLTVRD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           ++  +Y LGE    +L  MDV+L+RQDPPF+M+YIT+T+ LE+I+P+TL+VN+P W+RNS
Sbjct: 61  EEGYHYQLGESVRTELVDMDVVLLRQDPPFDMNYITTTHFLERIHPKTLVVNDPVWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEKIFVTEF +LMP TLI++DI +I  F     DIIIKPLYGNGG GVF +   DRNFSS
Sbjct: 121 PEKIFVTEFFDLMPETLITKDIEEIKAFRSMFGDIIIKPLYGNGGVGVFHLKNDDRNFSS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           LIEM  + Y EP ++Q YL  IR+GDKRI+LL+G+PVGA+NRIP   D RSNIH GG  E
Sbjct: 181 LIEMFEKSYKEPFIVQRYLESIREGDKRIILLDGEPVGAINRIPIATDVRSNIHVGGCVE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ D +IC RIG SL++RGL   GIDVIGDYITEINVTSPT IREI R GG ++AS
Sbjct: 241 CIDLTERDYEICARIGPSLKKRGLLLVGIDVIGDYITEINVTSPTGIREIKRFGGADIAS 300

Query: 305 LFWDGIE 311
           LFWD +E
Sbjct: 301 LFWDIVE 307


>gi|74313504|ref|YP_311923.1| glutathione synthetase [Shigella sonnei Ss046]
 gi|73856981|gb|AAZ89688.1| glutathione synthetase [Shigella sonnei Ss046]
          Length = 316

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTENGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|148550069|ref|YP_001270171.1| glutathione synthetase [Pseudomonas putida F1]
 gi|148514127|gb|ABQ80987.1| glutathione synthase [Pseudomonas putida F1]
          Length = 317

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 133/315 (42%), Positives = 198/315 (62%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY  + K  A  +PL++
Sbjct: 1   MSVRLGIVMDPIASISYKKDSSLAMLLAAQARGWSLFYMEQQDLYQGEGKARARMRPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                +++ LGEE+   L+++DVIL+R+DPPF+M ++ STYLLE+  N   L+VN P  +
Sbjct: 61  FADPARWFELGEEQDSPLAELDVILMRKDPPFDMEFVYSTYLLEQAENDGVLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +   PTL+SR    +  F  +  D+I+KPL G GGT +FR   GD N
Sbjct: 121 RDCNEKMFATLFPQCTTPTLVSRRPDILREFTAKHADVILKPLDGMGGTSIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTALGTQQIMAQAYLPAIKDGDKRILMIDGEPVDYCLARIPASGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT+ D  I  ++G +LRE+GL F G+DVIGDY+TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLTERDRWIAAQVGPTLREKGLLFVGLDVIGDYLTEINVTSPTCIREIDAAYNT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++     D I++  +
Sbjct: 301 DIGGKLMDAIDRKLK 315


>gi|332162805|ref|YP_004299382.1| glutathione synthetase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318604354|emb|CBY25852.1| glutathione synthetase [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325667035|gb|ADZ43679.1| glutathione synthetase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330858995|emb|CBX69353.1| glutathione synthetase [Yersinia enterocolitica W22703]
          Length = 317

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 132/311 (42%), Positives = 199/311 (63%), Gaps = 3/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RG+++ +     LY+R     A T+ LS+ 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMLLEAQRRGWELHYMEMGDLYLRGGDGRARTRLLSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           + K  ++S G E+ I L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R
Sbjct: 61  QDKNDWFSFGTEQDIPLHDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR    I +F+ E  DII+KPL G GGT +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRSKDHIRKFHQEHGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTELGSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTCIREI       
Sbjct: 241 RGEARPLSESDWKIARAVAPVLKQKGLVFVGLDIIGDRLTEINVTSPTCIREIEAAFPDV 300

Query: 301 NVASLFWDGIE 311
           ++  +  D IE
Sbjct: 301 SITGMLMDAIE 311


>gi|77461530|ref|YP_351037.1| glutathione synthetase [Pseudomonas fluorescens Pf0-1]
 gi|77385533|gb|ABA77046.1| glutathione synthetase [Pseudomonas fluorescens Pf0-1]
          Length = 316

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 197/315 (62%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY  + +  A  +PL +
Sbjct: 1   MSVRVGIVMDPIASISYKKDSSLAMLLAAQKRGWVLFYMEQKDLYQGEGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
               E+++ LG E+   LS ++VIL+R+DPPF+M ++ STYLLE+      L+VN P  +
Sbjct: 61  FANPEKWFELGTEQDSPLSDLNVILMRKDPPFDMEFVYSTYLLEQAESAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPT++SR    +  F  +  D+I+KPL G GGT +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTVVSRRADVLREFAAKHGDVILKPLDGMGGTSIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP++ + R N+ AG
Sbjct: 181 LSVILETLTALGAQQIMGQAYLPAIKDGDKRILMIDGEPVDYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT  D  I  ++G +LR +GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLTDKDRWIAAQVGPTLRAKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++  +  D IEK  +
Sbjct: 301 DIGGMLMDAIEKKLQ 315


>gi|86146408|ref|ZP_01064732.1| glutathione synthetase [Vibrio sp. MED222]
 gi|85835887|gb|EAQ54021.1| glutathione synthetase [Vibrio sp. MED222]
          Length = 316

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 191/311 (61%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   D L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMDDLHLDQGVAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS +D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPNGWYKFKSEQTIALSDLDAVLMRKDPPFDTEYIYATYILERAEENGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFREKHGDVILKPLDGMGGASIFRVKEGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDWAIARAVAPALKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEK 312
           V     D IE+
Sbjct: 301 VTGKLMDAIER 311


>gi|296104611|ref|YP_003614757.1| glutathione synthetase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295059070|gb|ADF63808.1| glutathione synthetase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 315

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 129/314 (41%), Positives = 203/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +   + LY+ + +  A T+ ++++
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMNDLYLINGEARARTRIVNVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ ++VIL+R+DPPF+  YI  TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGSEQDIALADLNVILMRKDPPFDTEYIYCTYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   FS+L P TL++R  TQ+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFSDLTPETLVTRSKTQLKAFWQKHGDIIMKPLDGMGGASIFRVKEGDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGTRYCMAQNYLPAIKDGDKRVLIVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TE+NVTSPTCIREI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEVNVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IEK  +
Sbjct: 301 ITGMLMDAIEKRLQ 314


>gi|333015287|gb|EGK34629.1| glutathione synthase [Shigella flexneri K-227]
          Length = 316

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I  +IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIASQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|30064263|ref|NP_838434.1| glutathione synthetase [Shigella flexneri 2a str. 2457T]
 gi|30042520|gb|AAP18244.1| glutathione synthetase [Shigella flexneri 2a str. 2457T]
          Length = 316

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNXAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTCYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|123443621|ref|YP_001007593.1| glutathione synthetase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090582|emb|CAL13451.1| glutathione synthetase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 317

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 132/311 (42%), Positives = 199/311 (63%), Gaps = 3/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RG+++ +     LY+R     A T+ LS+ 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMLLEAQRRGWELHYMEMGDLYLRGGDGRARTRLLSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           + K  ++S G E+ I L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R
Sbjct: 61  QDKNDWFSFGTEQDIPLHDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR    I +F+ E  DII+KPL G GGT +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRSKDHIRKFHQEHGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTELGSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTCIREI       
Sbjct: 241 RGEARPLSESDWKIARAVAPVLKQKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFPDV 300

Query: 301 NVASLFWDGIE 311
           ++  +  D IE
Sbjct: 301 SITGMLMDAIE 311


>gi|288933584|ref|YP_003437643.1| glutathione synthetase [Klebsiella variicola At-22]
 gi|288888313|gb|ADC56631.1| glutathione synthetase [Klebsiella variicola At-22]
          Length = 316

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 129/314 (41%), Positives = 203/314 (64%), Gaps = 3/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+T+ +K+D++FA+ LEAQ RGY++ +   + LY+ + +  A T+ +S++
Sbjct: 1   MIKLGIVMDPIATINIKKDTSFAMLLEAQRRGYELHYMEMNDLYLINGEARARTRTVSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYDFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FSEL P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSELTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKAGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVITETLTELGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPDI 300

Query: 301 NVASLFWDGIEKIK 314
           ++  +  D IE+  
Sbjct: 301 SITGMLMDAIERRI 314


>gi|320174057|gb|EFW49227.1| Glutathione synthetase [Shigella dysenteriae CDC 74-1112]
          Length = 316

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T  L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTCTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVLLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|24114202|ref|NP_708712.1| glutathione synthetase [Shigella flexneri 2a str. 301]
 gi|110806855|ref|YP_690375.1| glutathione synthetase [Shigella flexneri 5 str. 8401]
 gi|39931516|sp|Q83Q91|GSHB_SHIFL RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|24053349|gb|AAN44419.1| glutathione synthetase [Shigella flexneri 2a str. 301]
 gi|110616403|gb|ABF05070.1| glutathione synthetase [Shigella flexneri 5 str. 8401]
 gi|281602284|gb|ADA75268.1| Glutathione synthetase [Shigella flexneri 2002017]
 gi|313647997|gb|EFS12443.1| glutathione synthase [Shigella flexneri 2a str. 2457T]
 gi|332752990|gb|EGJ83374.1| glutathione synthase [Shigella flexneri 4343-70]
 gi|332753791|gb|EGJ84170.1| glutathione synthase [Shigella flexneri K-671]
 gi|332754620|gb|EGJ84986.1| glutathione synthase [Shigella flexneri 2747-71]
 gi|332765364|gb|EGJ95582.1| glutathione synthase [Shigella flexneri 2930-71]
 gi|332999914|gb|EGK19497.1| glutathione synthase [Shigella flexneri K-218]
 gi|333015055|gb|EGK34398.1| glutathione synthase [Shigella flexneri K-304]
          Length = 316

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTCYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|326410131|gb|ADZ67196.1| glutathione synthetase [Brucella melitensis M28]
 gi|326539851|gb|ADZ88066.1| glutathione synthase [Brucella melitensis M5-90]
          Length = 304

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 177/304 (58%), Positives = 235/304 (77%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+HISTV +  D+TFA++LEAQ RG+++FHYTPD L MRD  + A  + + + + K  +Y
Sbjct: 1   MDHISTVNITGDTTFALSLEAQKRGHELFHYTPDWLSMRDGVVSARVEKMEVRDVKGDHY 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFV 130
           +LGE    DL++MDVIL+RQDPPF+M+YIT+T+LLE+I+P+TL+VN+P W+RNSPEKIFV
Sbjct: 61  TLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVRNSPEKIFV 120

Query: 131 TEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLF 190
           TEF +LMP TLI++D  ++  F  E  DII+KPLYGNGG GVF +  GDRN +SL+EM  
Sbjct: 121 TEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNLTSLLEMFG 180

Query: 191 EKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTK 250
           + + EP + Q YL  +R GDKRI+L++G+PVGA+NR+PSE D RSN+H GG+ E +KLT 
Sbjct: 181 QLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGRPEQSKLTP 240

Query: 251 IDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGI 310
            + +IC RIG SL+ERG    GIDVIGDY+TEINVTSPT IREI R  G N+A+LFWD +
Sbjct: 241 REREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNIAALFWDAV 300

Query: 311 EKIK 314
           E  +
Sbjct: 301 EARR 304


>gi|253990750|ref|YP_003042106.1| glutathione synthetase [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|211639081|emb|CAR67693.1| Glutathione synthetase [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253782200|emb|CAQ85364.1| Glutathione synthetase [Photorhabdus asymbiotica]
          Length = 316

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 125/315 (39%), Positives = 199/315 (63%), Gaps = 3/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+ LEAQ RG+++ +     LY+   +  A T+ L ++
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLLEAQRRGWELHYMEMSDLYLHQGEARARTRLLQVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
              +Q+Y L +E+ + L  +DVIL+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  NNPQQWYQLNKEQDLALETLDVILMRKDPPFDTEYIYTTYILERAEAKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F +L P TL++R+  ++  F+ +  D+I KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPDLTPDTLVTRNAIRLREFHQKHSDVIFKPLDGMGGASIFRLKKDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 GVIIETLTEHGSRFCMAQNFLPAIKEGDKRVLIVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I K +  +L+E+GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLSESDWAIAKAVAPTLQEKGLIFVGLDIIGDKLTEINVTSPTCVREIEAAFPDI 300

Query: 301 NVASLFWDGIEKIKE 315
           ++  +  + IEK  E
Sbjct: 301 SITGMLMNAIEKRLE 315


>gi|206577717|ref|YP_002236602.1| glutathione synthase [Klebsiella pneumoniae 342]
 gi|206566775|gb|ACI08551.1| glutathione synthase [Klebsiella pneumoniae 342]
          Length = 316

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 203/314 (64%), Gaps = 3/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+T+ +K+D++FA+ LEAQ RGY++ +   + LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIATINIKKDTSFAMLLEAQRRGYELHYMEMNDLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYDFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FSEL P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSELTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKAGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPDI 300

Query: 301 NVASLFWDGIEKIK 314
           ++  +  D IE+  
Sbjct: 301 SITGMLMDAIERRI 314


>gi|197335460|ref|YP_002155191.1| glutathione synthase [Vibrio fischeri MJ11]
 gi|197316950|gb|ACH66397.1| glutathione synthase [Vibrio fischeri MJ11]
          Length = 315

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 126/313 (40%), Positives = 192/313 (61%), Gaps = 2/313 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RG++I +     L++   K  A+T+ ++L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQKRGWEIHYMEMSDLHLDQGKAVADTKIVTLK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           +    +Y    E+ IDL+ +D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  DDPTGWYEFQSEQTIDLADLDAVLMRKDPPFDTEYIYATYILERAEIQGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R   +I  F  E  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTLVTRKAEKIKAFREEHGDVILKPLDGMGGASIFRVKTGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCI+EI      +
Sbjct: 241 TGEARPLSETDWAIANAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAFDIS 300

Query: 302 VASLFWDGIEKIK 314
           +     D IE+  
Sbjct: 301 ITGKLMDAIERRI 313


>gi|218710624|ref|YP_002418245.1| glutathione synthetase [Vibrio splendidus LGP32]
 gi|218323643|emb|CAV19932.1| Glutathione synthetase [Vibrio splendidus LGP32]
          Length = 316

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 129/313 (41%), Positives = 191/313 (61%), Gaps = 2/313 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   D L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMDDLHLDQGVAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS +D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQTIALSDLDAVLMRKDPPFDTEYIYATYILERAEENGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  E  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKAFREEHGDVILKPLDGMGGASIFRVKEGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDWAIARAVAPALKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEKIK 314
           V     D IE+  
Sbjct: 301 VTGKLMDAIERRI 313


>gi|292487086|ref|YP_003529956.1| glutathione synthetase [Erwinia amylovora CFBP1430]
 gi|292900529|ref|YP_003539898.1| glutathione synthetase [Erwinia amylovora ATCC 49946]
 gi|291200377|emb|CBJ47505.1| glutathione synthetase [Erwinia amylovora ATCC 49946]
 gi|291552503|emb|CBA19548.1| glutathione synthetase [Erwinia amylovora CFBP1430]
 gi|312171189|emb|CBX79448.1| glutathione synthetase [Erwinia amylovora ATCC BAA-2158]
          Length = 314

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 134/311 (43%), Positives = 206/311 (66%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY+I +   + LY+R  +  A T+ LS++
Sbjct: 1   MIKLGIVMDPITSINIKKDSSFAMLLEAQKRGYEIHYMEMNDLYLRAGEGRARTRLLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +   Q+++ G+E+ I LS ++V+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNVNQWFAFGDEQDIALSDLNVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R+ +QI +F+ +  DII+KPL G GG  +FRI   D N 
Sbjct: 121 DCNEKLFTAWFADLTPDTLVTRNASQIRKFWQQHNDIILKPLDGMGGASIFRIRQEDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S ++E L        M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIVETLTGHGSFYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT  D +I +R+   L+++GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEARPLTDSDWEIARRVAPVLKQKGLIFVGLDIIGDKLTEINVTSPTCIREIEAAFPIS 300

Query: 302 VASLFWDGIEK 312
           V ++  D IEK
Sbjct: 301 VTAMLMDAIEK 311


>gi|300723911|ref|YP_003713222.1| glutathione synthetase [Xenorhabdus nematophila ATCC 19061]
 gi|297630439|emb|CBJ91104.1| glutathione synthetase [Xenorhabdus nematophila ATCC 19061]
          Length = 320

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 124/315 (39%), Positives = 196/315 (62%), Gaps = 3/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+ LEAQ RG+++ +   + LY+   +  A  + L+++
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLLEAQKRGWELHYMEMNDLYLHQGEARARIRLLTVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETL-IVNNPFWIR 122
           +  +Q+Y  G E+ I L  + VIL+R+DPPF+  YI +TY+LE+   +   IVN P  +R
Sbjct: 61  QNPQQWYQFGSEQEIALDTLHVILMRKDPPFDTEYIYATYILERAEIKGSLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F +L P TL++R+   +  F+ +  D+I KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPDLTPETLVTRNAKYLREFHQKHGDVIFKPLDGMGGASIFRLKQDDANV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L E      M Q++LP I+DGDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 GVIIETLTEHGSRYCMAQNFLPAIKDGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+E+GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLSESDWAIARAVAPVLKEKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPEI 300

Query: 301 NVASLFWDGIEKIKE 315
           +V  +  D IEK  E
Sbjct: 301 SVTGMLMDAIEKRLE 315


>gi|290511349|ref|ZP_06550718.1| glutathione synthase [Klebsiella sp. 1_1_55]
 gi|289776342|gb|EFD84341.1| glutathione synthase [Klebsiella sp. 1_1_55]
          Length = 316

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 203/314 (64%), Gaps = 3/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+T+ +K+D++FA+ LEAQ RGY++ +   + LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIATINIKKDTSFAMLLEAQRRGYELHYMEMNDLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYDFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FSEL P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSELTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKAGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVITETLTELGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPDI 300

Query: 301 NVASLFWDGIEKIK 314
           ++  +  D IE+  
Sbjct: 301 SITGMLMDAIERRI 314


>gi|152971898|ref|YP_001337007.1| glutathione synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238896477|ref|YP_002921215.1| glutathione synthetase [Klebsiella pneumoniae NTUH-K2044]
 gi|262042597|ref|ZP_06015753.1| glutathione synthase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|150956747|gb|ABR78777.1| glutathione synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238548797|dbj|BAH65148.1| glutathione synthetase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259040031|gb|EEW41146.1| glutathione synthase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 316

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 204/315 (64%), Gaps = 3/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+T+ +K+D++FA+ LEAQ RGY++ +   + LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIATINIKKDTSFAMLLEAQRRGYELHYMEMNDLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYDFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FSEL P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSELTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKAGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPDI 300

Query: 301 NVASLFWDGIEKIKE 315
           ++  +  D IE+  +
Sbjct: 301 SITGMLMDAIERRID 315


>gi|329998572|ref|ZP_08303169.1| glutathione synthase [Klebsiella sp. MS 92-3]
 gi|328538643|gb|EGF64742.1| glutathione synthase [Klebsiella sp. MS 92-3]
          Length = 316

 Score =  305 bits (780), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 204/315 (64%), Gaps = 3/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+T+ +K+D++FA+ LEAQ RGY++ +   + LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIATINIKKDTSFAMLLEAQRRGYELHYMEMNDLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYDFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FSEL P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSELTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKAGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGRRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPDI 300

Query: 301 NVASLFWDGIEKIKE 315
           ++  +  D IE+  +
Sbjct: 301 SITGMLMDAIERRID 315


>gi|148980483|ref|ZP_01816080.1| glutathione synthetase [Vibrionales bacterium SWAT-3]
 gi|145961208|gb|EDK26522.1| glutathione synthetase [Vibrionales bacterium SWAT-3]
          Length = 316

 Score =  304 bits (779), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 126/311 (40%), Positives = 189/311 (60%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +   + L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGVAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I LS +D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPNGWYEFKSEQTIALSDLDAVLMRKDPPFDTEYIYATYILERAEENGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I  F  +  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKEFREKHGDVILKPLDGMGGASIFRVKEGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     R P++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARTPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L+  D  I + +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSDTDWAIARAVAPALKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEK 312
           V     D IE+
Sbjct: 301 VTGKLMDAIER 311


>gi|49475054|ref|YP_033095.1| glutathione synthetase [Bartonella henselae str. Houston-1]
 gi|49237859|emb|CAF27054.1| Glutathione synthetase [Bartonella henselae str. Houston-1]
          Length = 312

 Score =  304 bits (779), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 181/307 (58%), Positives = 236/307 (76%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IAIQM+HIST++++ D+TFA+AL AQ RGY +FHYTPD+L MRD  +    + L++ +
Sbjct: 1   MKIAIQMDHISTLQIQGDTTFALALAAQERGYSLFHYTPDRLSMRDGCVIVKLEALTVHD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           K+  +Y LG+     L  MDV+L+RQDPPF+++YIT+T+LLE I+P+TL+VN+P W+RNS
Sbjct: 61  KEGNHYQLGKPIRTQLMDMDVVLLRQDPPFDLNYITTTHLLECIHPKTLVVNDPAWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEKIFVTEF +LMP TLI++DI +IT F     +II+KPLYGNGG GVF +   DRN +S
Sbjct: 121 PEKIFVTEFPDLMPETLITKDIEEITAFRATFGEIIVKPLYGNGGAGVFHLKQDDRNLAS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L+E+  + Y EP ++Q YL  +R GDKRI+LL+GKPVGA+NRI +E D RSN+H GG+AE
Sbjct: 181 LLEIFAQIYREPFIVQRYLDAVRKGDKRIILLDGKPVGAINRIAAETDVRSNMHVGGRAE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LTK D +IC+RIG +L+ERGL   GIDVIGDYITEINVTSPT IREI R  G ++A 
Sbjct: 241 NVDLTKRDYEICQRIGPALKERGLLLVGIDVIGDYITEINVTSPTGIREIKRFSGTDIAH 300

Query: 305 LFWDGIE 311
           LFWD IE
Sbjct: 301 LFWDVIE 307


>gi|307132694|ref|YP_003884710.1| glutathione synthetase [Dickeya dadantii 3937]
 gi|306530223|gb|ADN00154.1| glutathione synthetase [Dickeya dadantii 3937]
          Length = 317

 Score =  304 bits (779), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 122/312 (39%), Positives = 192/312 (61%), Gaps = 3/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+  EAQ RG+++ +     LY+   +  A T+ LS+ 
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLQEAQRRGWELHYMEMGDLYLHAGEARATTRILSVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
                +Y  G  + I L ++DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  YDYNGWYDFGATQDIALHELDVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F +L P TL++R   ++  F+ +  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPQLTPDTLVTRSADRLRAFHQQHSDVILKPLDGMGGASIFRLKPEDANV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLSESDWQIARTVAPVLKQKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAYPDV 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IE+
Sbjct: 301 SITGMLMDAIER 312


>gi|149911574|ref|ZP_01900187.1| glutathione synthetase [Moritella sp. PE36]
 gi|149805353|gb|EDM65365.1| glutathione synthetase [Moritella sp. PE36]
          Length = 317

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 132/311 (42%), Positives = 199/311 (63%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+ + +K+DS+FA+ +EAQ RGY++F+     L M + + YA+++ L +
Sbjct: 1   MTIKLGIVMDPIADINIKKDSSFAMLMEAQNRGYELFYMEMQDLSMLEGRAYASSRSLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            +    +Y LGEE    LS +DVIL+R+DPPF+  +I +TY+LE+  +  TLIVN P  +
Sbjct: 61  QQDPASWYELGEETNHLLSDLDVILMRKDPPFDTEFIYATYMLERAEDEGTLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK++   F+E  P TL++R   ++  F+ E KD+I+KPL G GG  +FR+   D+N
Sbjct: 121 RDANEKLYTAWFNEFTPTTLVTRRKDKLRAFHKEHKDVILKPLDGMGGASIFRLNEQDKN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S +IE L E      M Q ++P+I+DGDKRIL+++G+PV     RIP+  + R NI AG
Sbjct: 181 VSVIIETLTEHGTRYCMAQKFIPEIKDGDKRILVIDGEPVPYCLARIPASGETRGNIAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L++ D  I K +G  L+E+GL F G+DVIGD +TEINVTSPTCIREI      
Sbjct: 241 GRGVARPLSESDWKIAKALGPKLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAYDV 300

Query: 301 NVASLFWDGIE 311
           ++  +  D IE
Sbjct: 301 SITGMLMDAIE 311


>gi|290476316|ref|YP_003469220.1| glutathione synthetase [Xenorhabdus bovienii SS-2004]
 gi|289175653|emb|CBJ82456.1| glutathione synthetase [Xenorhabdus bovienii SS-2004]
          Length = 319

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 128/315 (40%), Positives = 198/315 (62%), Gaps = 3/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++K+K+D++FA+ LEAQ RG++I +   + LY+   +  A T+ L+++
Sbjct: 1   MIKLGIVMDPISSIKIKKDTSFAMLLEAQKRGWEIHYMEMNDLYLHQGEARARTRLLTVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETL-IVNNPFWIR 122
           E  +Q+Y  G E+ I L  + VIL+R+DPPF+  YI +TY+LE+   +   IVN P  +R
Sbjct: 61  ENLQQWYQFGSEQEIALDNLHVILMRKDPPFDTEYIYATYILERAEDKGSLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R+   +  F+ +  D+I KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVTRNAKTLREFHQKHGDVIFKPLDGMGGASIFRLKQDDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L E      M Q++LP I+DGDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 GVIIETLTEHGSRYCMAQNFLPAIKDGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+E+GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLSESDWAIARAVAPVLKEKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPAI 300

Query: 301 NVASLFWDGIEKIKE 315
           ++  +  D IEK  E
Sbjct: 301 SITGMLMDAIEKRLE 315


>gi|315497094|ref|YP_004085898.1| glutathione synthetase [Asticcacaulis excentricus CB 48]
 gi|315415106|gb|ADU11747.1| glutathione synthetase [Asticcacaulis excentricus CB 48]
          Length = 318

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 135/315 (42%), Positives = 202/315 (64%), Gaps = 1/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I  + +  D+TF + + AQ RG++++ Y P  L + D KI+A  + ++L
Sbjct: 1   MTLRVAVQMDPIENINIAGDTTFLLMMAAQARGHELWVYEPQHLSLEDGKIFARARKVTL 60

Query: 63  DEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
              K  + + G  + ++L S +DV+L+RQDPPF++ YIT+TYLLE I+P+TL+VN+P  +
Sbjct: 61  RPVKGDHVTAGTHQKLNLGSDVDVVLMRQDPPFDVAYITATYLLEMIHPKTLVVNDPRSV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+ PEK+F   F  L PPTLIS D   +  F     D+I+KPL+G  G G+ ++   DRN
Sbjct: 121 RDCPEKLFAQHFQGLQPPTLISADPEALRDFQQRHGDVILKPLHGAAGGGIIKLKADDRN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
             +LIE+      EPL++Q ++P +  GDKRI+L++G+ VGA+NR+P +   RSN+  GG
Sbjct: 181 LDALIELHAAIGREPLVLQKFIPAVSAGDKRIILVDGEVVGAINRVPQKDAVRSNLRVGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
            A  T LT  DL+IC  +G +LRERGL F G+DVIGDY+TEINVTSPT   ++    G +
Sbjct: 241 TAAPTTLTPRDLEICAAVGPALRERGLIFVGLDVIGDYLTEINVTSPTGAVQLKAFDGID 300

Query: 302 VASLFWDGIEKIKET 316
                W  +E+   T
Sbjct: 301 AGDALWSVVERKLST 315


>gi|158425972|ref|YP_001527264.1| glutathione synthetase [Azorhizobium caulinodans ORS 571]
 gi|158332861|dbj|BAF90346.1| prokaryotic glutathione synthetase [Azorhizobium caulinodans ORS
           571]
          Length = 314

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 164/313 (52%), Positives = 233/313 (74%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HI+ + +  DSTFA+ LEAQ RG+++ HYTPD+L MRD  ++A  + L++
Sbjct: 1   MSLQVAVQMDHIAHINIAGDSTFALLLEAQRRGHRLVHYTPDRLAMRDGAVFATVEDLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++  ++++LGE++ + LS  DV+L+RQDPPF+M Y+T+T+LLE+I+P+TL+VN+P  +R
Sbjct: 61  ADEAGKHFTLGEKRRVKLSDYDVVLLRQDPPFDMAYVTTTHLLERIHPKTLVVNDPAHVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEKIFVTEF ELMPPTLI+RD+ +I  F  E KD+++KPLYGNGG  VFR+  GD NF
Sbjct: 121 NAPEKIFVTEFPELMPPTLITRDLEEIKAFRAEFKDVVMKPLYGNGGAAVFRMAEGDLNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL ++    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+PSE D RSN+  GG 
Sbjct: 181 GSLYDLFSTTFREPWVIQRFLPEVKHGDKRIILVDGEAAGAVNRVPSEGDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T LT  + +IC RIG SLR+ GL F GIDVI   +TEINVTSPT +R I R GG ++
Sbjct: 241 ARPTDLTDREQEICARIGPSLRKMGLIFVGIDVIDGNLTEINVTSPTGLRAIKRLGGPDI 300

Query: 303 ASLFWDGIEKIKE 315
           A+  WD IE+ + 
Sbjct: 301 AAQIWDKIEEKRR 313


>gi|153950930|ref|YP_001399820.1| glutathione synthetase [Yersinia pseudotuberculosis IP 31758]
 gi|152962425|gb|ABS49886.1| glutathione synthase [Yersinia pseudotuberculosis IP 31758]
          Length = 319

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 130/312 (41%), Positives = 202/312 (64%), Gaps = 3/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+ LEAQ RG+++ +     LYMR     A T+ L++ 
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLLEAQRRGWELHYMEMGDLYMRGGDGRARTRLLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           + KE ++S G E+ + L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R
Sbjct: 61  QDKENWFSFGAEQDLPLYDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR    I +F+ E  DII+KPL G GGT +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRSKDHIRKFHQEHGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTELGSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D +I + +   L+++GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLSESDWEIARTVAPILKQKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPEI 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IE+
Sbjct: 301 SITGMLMDAIER 312


>gi|212637181|ref|YP_002313706.1| glutathione synthetase [Shewanella piezotolerans WP3]
 gi|212558665|gb|ACJ31119.1| Glutathione synthetase, prokaryotic [Shewanella piezotolerans WP3]
          Length = 315

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 125/310 (40%), Positives = 193/310 (62%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+   + L M + +  A  + L++ 
Sbjct: 1   MIKLGIVMDPISDINIKKDSSFAMLMAAQSRGYQLFYMEMNDLAMVNGQAMATMRALTVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +    +Y L       L+ +DVIL+R+DPPF+  ++ STY+LE+      LIVN P  +R
Sbjct: 61  QDPLDWYQLEAAVDTPLADLDVILMRKDPPFDTEFVYSTYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+ E  DII+KPL G GG+ +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETVVTRDEQRIRAFHKEKGDIILKPLDGMGGSSIFRVKKDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L  +  +  M Q+++P I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTNEGQQYAMAQAFIPDITSGDKRILVVDGEPVPYSLARIPQKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +     L++ D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCI+EI      +
Sbjct: 241 RGVAQPLSESDWHIARTIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAFDVD 300

Query: 302 VASLFWDGIE 311
           ++ +  D IE
Sbjct: 301 ISGMLMDAIE 310


>gi|283788531|ref|YP_003368396.1| glutathione synthetase [Citrobacter rodentium ICC168]
 gi|282951985|emb|CBG91712.1| glutathione synthetase [Citrobacter rodentium ICC168]
          Length = 315

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 197/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIASINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L  +D IL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYDFTGEQDLALDSLDAILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWQKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIVDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT  D  I +RIG +L+ +GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTDSDWAIARRIGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPIS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|289209561|ref|YP_003461627.1| glutathione synthetase [Thioalkalivibrio sp. K90mix]
 gi|288945192|gb|ADC72891.1| glutathione synthetase [Thioalkalivibrio sp. K90mix]
          Length = 313

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 129/306 (42%), Positives = 196/306 (64%), Gaps = 2/306 (0%)

Query: 7   IAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK 66
           IA+ M+ I+ +K  +D+TFA+ L AQ RG+++ +  P  L++ + + Y  ++P+++ +++
Sbjct: 5   IAVLMDPIAGIKPWKDTTFAMLLAAQARGHRLHYLEPGDLWIEEGRAYVRSRPVAVRDQR 64

Query: 67  EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRNSP 125
           E YY+LG E+  D S+ D++L+R+DPPF++ YI +TY L+        +VN P  +R+  
Sbjct: 65  EDYYTLGPEQEGDASRFDLLLMRKDPPFDLEYIYATYALDLAERDGVRVVNRPGALRDVN 124

Query: 126 EKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSL 185
           EK F T F +  PPTLI+RD  +I  F     DI++KPL G GG  VFRI  GD N S +
Sbjct: 125 EKAFATHFVDCGPPTLITRDRARIRAFLDHHGDIVVKPLDGMGGASVFRIREGDPNLSVI 184

Query: 186 IEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGKAE 244
           +E + E     ++ Q +LP+   GDKRI+L+ G+P    + RIP+E + R+N+ AGG+ E
Sbjct: 185 LETMTEFDRRTIVAQRFLPEYTAGDKRIILIGGEPYDYALARIPAEGETRANLAAGGRGE 244

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT  D  IC +I   L+ RGL F GIDVIGDY+TEINVTSPT +RE+    G+++A 
Sbjct: 245 AVPLTDRDRWICAQIAPELKRRGLDFVGIDVIGDYLTEINVTSPTGVRELDAACGDDLAG 304

Query: 305 LFWDGI 310
            F D +
Sbjct: 305 QFIDYL 310


>gi|90409106|ref|ZP_01217228.1| glutathione synthetase [Psychromonas sp. CNPT3]
 gi|90309780|gb|EAS37943.1| glutathione synthetase [Psychromonas sp. CNPT3]
          Length = 315

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 128/315 (40%), Positives = 194/315 (61%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               I I M+ I  + + +DS+FA+ LEAQ RG+++++ T   LY+ + + +  ++ LS+
Sbjct: 1   MSIKIGILMDPIENINIHKDSSFAMLLEAQSRGWELYYITMKDLYLENGRCFVESKKLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
             K+  +Y L       L+ +D +L+R DPPF+  YI +TYLLE+      LIVN P  +
Sbjct: 61  QRKENDFYQLEAPIDHPLADLDALLMRIDPPFDTEYIYATYLLERAEEEGCLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   F+E  P TL++R+  +I  F+ + +D+I+KPL G GG  +FRI   D N
Sbjct: 121 RDANEKLFTAWFNEFTPETLVTRNAKKIREFHQKHRDVILKPLDGMGGASIFRIKENDAN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              +IE L E      M Q+++P+I  GDKRIL+++G+P+   + RIP++ + R N+ AG
Sbjct: 181 LGVIIETLTEHESRYCMAQAFIPEITQGDKRILIVDGEPMPYALARIPAKGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L++ D  I   IG  L+E+GL F G+DVIGD ITEINVTSPTCI+EI +  G 
Sbjct: 241 GRGVAQPLSESDWHIANSIGPKLKEKGLIFVGLDVIGDKITEINVTSPTCIQEIDKAYGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+A    D IEK   
Sbjct: 301 NIAGKLMDAIEKRVR 315


>gi|59711042|ref|YP_203818.1| glutathione synthetase [Vibrio fischeri ES114]
 gi|59479143|gb|AAW84930.1| glutathione synthetase [Vibrio fischeri ES114]
          Length = 315

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 126/313 (40%), Positives = 192/313 (61%), Gaps = 2/313 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RG++I +     L++   K  A+T+ ++L 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMMLEAQKRGWEIHYMEMSDLHLAQGKAVADTKIVTLK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           +    +Y    E+ IDL+ +D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  DDPTGWYEFQSEQTIDLADLDAVLMRKDPPFDTEYIYATYILERAEIQGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R   +I  F  E  D+I+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFPELTPTTLVTRKAEKIKAFREEHGDVILKPLDGMGGASIFRVKAGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCI+EI      +
Sbjct: 241 TGEARPLSETDWAIANAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAFDIS 300

Query: 302 VASLFWDGIEKIK 314
           +     D IE+  
Sbjct: 301 ITGKLMDAIERRI 313


>gi|110635911|ref|YP_676119.1| glutathione synthetase [Mesorhizobium sp. BNC1]
 gi|110286895|gb|ABG64954.1| glutathione synthase [Chelativorans sp. BNC1]
          Length = 316

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 168/312 (53%), Positives = 244/312 (78%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +AIQM+H+ST+ +  D+TFA+ALEA+ RG++++HYTPD+L+ R S+ +A  + L++
Sbjct: 1   MPLRVAIQMDHVSTISIAGDTTFALALEAERRGHKLWHYTPDRLFQRGSEAFATVEALNV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++   ++SLG  + I LS+MDV+L+RQDPPF+M+YIT+T++LE+++P+TL+VN+P W+R
Sbjct: 61  RDEIGNHFSLGAPERIALSEMDVVLLRQDPPFDMNYITTTHILERVHPKTLVVNDPVWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           NSPEKIFVTEF +LMP TLI+RD  ++  F  E  DII+KPLYGNGG G+F +   DRN 
Sbjct: 121 NSPEKIFVTEFPDLMPDTLITRDPIEVDAFRREHGDIIVKPLYGNGGAGIFHLAQADRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL+E+  + + EP ++Q YL ++R GDKRI+L+ G+PVGA+NRIPSE D+RSN+H GG+
Sbjct: 181 ASLLELFTQMFREPFIVQRYLKEVRGGDKRIILIEGEPVGAINRIPSEHDSRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE T++T+ + +IC RIG +LRERG    GIDVIG  +TEINVTSPT +RE+ R GG ++
Sbjct: 241 AEPTEITEREREICARIGPALRERGFVLVGIDVIGGLLTEINVTSPTGVREVKRFGGADI 300

Query: 303 ASLFWDGIEKIK 314
           A+LFWD +E  +
Sbjct: 301 AALFWDAVEARR 312


>gi|92115777|ref|YP_575506.1| glutathione synthetase [Nitrobacter hamburgensis X14]
 gi|91798671|gb|ABE61046.1| glutathione synthase [Nitrobacter hamburgensis X14]
          Length = 313

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 155/313 (49%), Positives = 221/313 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IA+QM+ I+ + V+ DSTFA+ LEAQ RG+ + +YTPD+L +R   + A  Q L++
Sbjct: 1   MKLKIAVQMDPIARINVRGDSTFALLLEAQRRGHAVSYYTPDKLSLRGKDLVAPAQSLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++   +++LGE     L   DV+L+RQDPPF++ YIT+T+LLE+I+P+TL+VN+P  +R
Sbjct: 61  RDQDGDHFTLGEATRAYLESFDVVLLRQDPPFDLAYITTTHLLERIHPKTLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++PEK+FV +F ELMPPTLISRD+ +I+ F  E   +++KPL+G GG  VFR+   D NF
Sbjct: 121 DAPEKLFVMDFPELMPPTLISRDLDEISSFRAEHGAVVMKPLHGYGGAAVFRVMPQDMNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLFDMFSVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAADDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A+ T LT  + +IC+RIG +LRERGL F GIDVI   +TEINVTSPT IR I   GG +V
Sbjct: 241 AQATDLTPREREICERIGPALRERGLLFVGIDVIDGNLTEINVTSPTGIRAIAAFGGPDV 300

Query: 303 ASLFWDGIEKIKE 315
           A+  WD IE  + 
Sbjct: 301 AAKIWDRIEAKRS 313


>gi|293416208|ref|ZP_06658848.1| glutathione synthase [Escherichia coli B185]
 gi|291432397|gb|EFF05379.1| glutathione synthase [Escherichia coli B185]
          Length = 316

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIVRQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|289624693|ref|ZP_06457647.1| glutathione synthetase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647577|ref|ZP_06478920.1| glutathione synthetase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330865805|gb|EGH00514.1| glutathione synthetase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 319

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 188/315 (59%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLYQDAGQARARVKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEKHGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D I+K  +
Sbjct: 301 NIGGLLMDAIDKKLQ 315


>gi|145298213|ref|YP_001141054.1| glutathione synthetase [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142850985|gb|ABO89306.1| glutathione synthetase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 317

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 129/312 (41%), Positives = 198/312 (63%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ IS + +K+DS+FA+  EAQ RGY++F+     LYM   + +   +PL++
Sbjct: 1   MTIKLGIVMDPISAINIKKDSSFAMLEEAQKRGYELFYLEMSDLYMEAGRAFGTMRPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                 ++SLGE     LS +DVIL+R+DPPF+  +I +TY+LE+  +   LIVN P  +
Sbjct: 61  KYDYADWFSLGEVIDQPLSTLDVILMRKDPPFDTEFIYATYMLERAEDEGCLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK++   F+E  P TL++R   ++  F+ + KD+I+KPL G GG  +FR+   D N
Sbjct: 121 RDANEKLYTAWFAEHTPTTLVTRRADKLRAFHAKHKDVILKPLDGMGGASIFRMKEDDAN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              +IE L E   +  M Q+YLP I+DGDKR+L++NG+PV     RIP++ + R N+ AG
Sbjct: 181 VGVIIETLTEHGSQYCMAQTYLPAIKDGDKRVLVVNGEPVPYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I + +G +L+E+GL F G+D+IGD +TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLSEADWAIARAVGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFDV 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IE+
Sbjct: 301 SITGMLMDAIER 312


>gi|320540152|ref|ZP_08039807.1| glutathione synthetase [Serratia symbiotica str. Tucson]
 gi|320029818|gb|EFW11842.1| glutathione synthetase [Serratia symbiotica str. Tucson]
          Length = 316

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 132/311 (42%), Positives = 195/311 (62%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+D++FA+ LEAQ RG+++ +   + LY+      A T+ LS+ 
Sbjct: 1   MIKLGIVMDPIASINIKKDTSFAMLLEAQRRGWELHYMEMNDLYLHAGDGRACTRRLSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           E +E +YS   E+ + L  +DVIL+R+DPPF+  YI +TY+LE+     TL+VN P  +R
Sbjct: 61  ENQESWYSFAAEQDLALQDLDVILMRKDPPFDTEYIYATYILERAEVKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR    I  F+    DII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRSAAHIRNFHQRHGDIILKPLDGMGGASIFRVQQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKRIL+++G+PV     RIP+  + R N+ AGG
Sbjct: 181 SVIIETLTEHGKRFCMAQNFLPAIKEGDKRILVVDGEPVPYCLARIPAHGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E+  L++ D  I   +  +L+ +GLFF G+DVIGD +TEINVTSPTC REI      +
Sbjct: 241 HGEVRPLSESDWKIAHAVASTLKAKGLFFVGLDVIGDRLTEINVTSPTCAREIEAAFSVS 300

Query: 302 VASLFWDGIEK 312
           + SL  + IEK
Sbjct: 301 ITSLLMEAIEK 311


>gi|258542762|ref|YP_003188195.1| glutathione synthetase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633840|dbj|BAH99815.1| glutathione synthetase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636899|dbj|BAI02868.1| glutathione synthetase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639952|dbj|BAI05914.1| glutathione synthetase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643008|dbj|BAI08963.1| glutathione synthetase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646063|dbj|BAI12011.1| glutathione synthetase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649116|dbj|BAI15057.1| glutathione synthetase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652103|dbj|BAI18037.1| glutathione synthetase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655160|dbj|BAI21087.1| glutathione synthetase [Acetobacter pasteurianus IFO 3283-12]
          Length = 331

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 148/325 (45%), Positives = 217/325 (66%), Gaps = 14/325 (4%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDS--------- 51
           M     +A+QM+ +  V +  DSTFA+ LEAQ RG+ ++ Y  + L + +          
Sbjct: 1   MASSLQVAVQMDPLEHVNIHGDSTFALMLEAQKRGHTLYVYEVNSLALGEGAVEPEQSSK 60

Query: 52  -KIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP 110
            ++ A  +P+++  ++  + + G      L  MDV+L+RQDPPF+M YIT+T++L+ ++ 
Sbjct: 61  TRVTALMRPVTVRREEGNHATFGAPTRQSLGDMDVVLMRQDPPFDMAYITATHMLDHVHG 120

Query: 111 ----ETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYG 166
               + L+VN+P W+R+SPEK+ VT F +LMPPTL++ DI QI  F  +  DII+KPL+G
Sbjct: 121 IGPGKALVVNDPRWVRDSPEKLLVTHFPDLMPPTLVTWDIEQIRAFRAKWHDIIVKPLFG 180

Query: 167 NGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNR 226
           NGG+GVFRI   D+N ++L+EM F +  EPLMIQ Y P +  GDKRI+L++G+P+GA+NR
Sbjct: 181 NGGSGVFRIREDDQNLNALLEMHFARSREPLMIQRYEPAVTAGDKRIILVDGEPIGAINR 240

Query: 227 IPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVT 286
           +PS  D+RSN+H GG A+   L++ D +IC  IG  L+E GL F GIDVIG Y+TEINVT
Sbjct: 241 VPSGEDHRSNMHVGGVAKQIGLSERDREICTAIGPFLKEHGLIFVGIDVIGQYLTEINVT 300

Query: 287 SPTCIREIHRNGGENVASLFWDGIE 311
           SPT ++E+ R  G N A   W+ IE
Sbjct: 301 SPTGLQELERFDGINGAGAIWNCIE 325


>gi|260775561|ref|ZP_05884458.1| glutathione synthetase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608742|gb|EEX34907.1| glutathione synthetase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 316

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 123/311 (39%), Positives = 190/311 (61%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I ++ +K+DS+FA+ LEAQ RGY+I +     L++      A+T+ + L 
Sbjct: 1   MIKLGIVMDPIESINIKKDSSFAMMLEAQRRGYEIHYMEMHDLHLDQGVAVADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    ++    E+ I+LS++D +L+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  EDPTGWFQFKSEQTIELSELDAVLMRKDPPFDTEYIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P T+++R   +I +F  +  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTIVTRKAEKIKQFREQHGDVILKPLDGMGGASIFRVKDNDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+ +     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEAMPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDKQIAAAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDIS 300

Query: 302 VASLFWDGIEK 312
           +     D IE+
Sbjct: 301 ITGKLMDAIER 311


>gi|329114638|ref|ZP_08243397.1| Glutathione synthetase [Acetobacter pomorum DM001]
 gi|326696118|gb|EGE47800.1| Glutathione synthetase [Acetobacter pomorum DM001]
          Length = 358

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 147/328 (44%), Positives = 217/328 (66%), Gaps = 14/328 (4%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDS--------- 51
           M     +A+QM+ +  + +  DSTFA+ LEAQ RG+ ++ Y  + L + +          
Sbjct: 28  MASSLQVAVQMDPLEHINIHGDSTFALMLEAQKRGHALYVYEVNTLALGEGAAEPEQSSK 87

Query: 52  -KIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP 110
            ++ A  +P+++  ++  + + G      L  MDV+L+RQDPPF+M YIT+T++L+ ++ 
Sbjct: 88  TRVTALMRPVTVRREEGNHATFGAPMRQSLGDMDVVLMRQDPPFDMAYITATHMLDHVHG 147

Query: 111 ----ETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYG 166
               + L+VN+P W+R+SPEK+ VT F +LMPPTL++ DI QI  F  +  DII+KPL+G
Sbjct: 148 IGPGKALVVNDPRWVRDSPEKLLVTHFPDLMPPTLVTWDIEQIRAFRAKWHDIIVKPLFG 207

Query: 167 NGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNR 226
           NGG+GVFRI   D+N ++L+EM F +  EPLMIQ Y P +  GDKRI+L++G+PVGA+NR
Sbjct: 208 NGGSGVFRIREDDQNLNALLEMHFARSREPLMIQRYEPAVTAGDKRIILVDGEPVGAINR 267

Query: 227 IPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVT 286
           +PS  D+RSN+H GG A+   L+  D +IC  IG  L++ GL F GIDVIG Y+TEINVT
Sbjct: 268 VPSGEDHRSNMHVGGVAKQIGLSARDREICTAIGPFLKDHGLIFVGIDVIGQYLTEINVT 327

Query: 287 SPTCIREIHRNGGENVASLFWDGIEKIK 314
           SPT ++E+ R  G N A   W+ IE+  
Sbjct: 328 SPTGLQELERFDGINGAGAIWNCIERKL 355


>gi|91974881|ref|YP_567540.1| glutathione synthetase [Rhodopseudomonas palustris BisB5]
 gi|91681337|gb|ABE37639.1| glutathione synthase [Rhodopseudomonas palustris BisB5]
          Length = 313

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 152/313 (48%), Positives = 223/313 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I+ + ++ DSTFA+ LEAQ RG+ I +YTPD+L +R + + A+ Q LS+
Sbjct: 1   MTLKVAVQMDPIARINIRGDSTFAMLLEAQKRGHAISYYTPDKLSLRGTDVVASVQRLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            +++  +++LGE   +D+   DV+L+RQDPPF++ YITST+LLE+I+P TL+VN+P  +R
Sbjct: 61  RDQEGDHFTLGEPTRVDMRSFDVVLLRQDPPFDLAYITSTHLLERIHPHTLVVNDPISVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F+ELMPPTLISRD+ +I  F  E   +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMDFAELMPPTLISRDLNEINSFRAEHGAVVMKPLHGHGGAAVFRVLPQDINF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLYDMFAVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAADDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T L++ +  IC  +   LRERGL   GIDVI  Y+TEINVTSPT IR + R GG ++
Sbjct: 241 AAATDLSERERTICATLAPKLRERGLLLVGIDVIDGYLTEINVTSPTGIRAVARLGGPDI 300

Query: 303 ASLFWDGIEKIKE 315
           A+  WD IE+ + 
Sbjct: 301 AARVWDVIEQKRS 313


>gi|322613492|gb|EFY10433.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322621084|gb|EFY17942.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322624148|gb|EFY20982.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322628113|gb|EFY24902.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633232|gb|EFY29974.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322636190|gb|EFY32898.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322639528|gb|EFY36216.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322647539|gb|EFY44028.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322648723|gb|EFY45170.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322653778|gb|EFY50104.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322657884|gb|EFY54152.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322663987|gb|EFY60186.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322669002|gb|EFY65153.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673004|gb|EFY69111.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322678005|gb|EFY74068.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681181|gb|EFY77214.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322687889|gb|EFY83856.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323194915|gb|EFZ80102.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323196666|gb|EFZ81814.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202634|gb|EFZ87674.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207879|gb|EFZ92825.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323212569|gb|EFZ97386.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323214948|gb|EFZ99696.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323222678|gb|EGA07043.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323225421|gb|EGA09653.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323230564|gb|EGA14682.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323235085|gb|EGA19171.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323239124|gb|EGA23174.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323244518|gb|EGA28524.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323247133|gb|EGA31099.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323253384|gb|EGA37213.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323256309|gb|EGA40045.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323262515|gb|EGA46071.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323267389|gb|EGA50873.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323269207|gb|EGA52662.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 315

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 201/310 (64%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIAHINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGSEQEIKLADLDVILMRKDPPFDTEFIYATYILERAEEEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFADLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|82778281|ref|YP_404630.1| glutathione synthetase [Shigella dysenteriae Sd197]
 gi|309785225|ref|ZP_07679856.1| glutathione synthase [Shigella dysenteriae 1617]
 gi|81242429|gb|ABB63139.1| glutathione synthetase [Shigella dysenteriae Sd197]
 gi|308926345|gb|EFP71821.1| glutathione synthase [Shigella dysenteriae 1617]
          Length = 316

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 201/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A T  L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAYTCTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R++PPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKEPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M+Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMVQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|170719657|ref|YP_001747345.1| glutathione synthetase [Pseudomonas putida W619]
 gi|169757660|gb|ACA70976.1| glutathione synthetase [Pseudomonas putida W619]
          Length = 317

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 196/315 (62%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY  + K  A  +PL +
Sbjct: 1   MSVRLGIVMDPIASISYKKDSSLAMLLAAQARGWSLFYMEQRDLYQAEGKARARMRPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWI 121
                +++ LG+E+   L+++DVIL+R+DPPF+M ++ STYLLE+      L+VN P  +
Sbjct: 61  FADPARWFELGDEQDSPLAELDVILMRKDPPFDMEFVYSTYLLEQAEAEGVLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GGT +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRPDIIRAFAAQHGDVILKPLDGMGGTSIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTALGAQQIMAQAYLPAIKDGDKRILMIDGEPVDYCLARIPASGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G +LR +GL F G+DVIGDY+TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLSERDRWIAAQVGPTLRAKGLLFVGLDVIGDYLTEINVTSPTCIREIDAAYNT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++     D I++  +
Sbjct: 301 DIGGKLMDAIDRQLK 315


>gi|157960428|ref|YP_001500462.1| glutathione synthetase [Shewanella pealeana ATCC 700345]
 gi|157845428|gb|ABV85927.1| glutathione synthetase [Shewanella pealeana ATCC 700345]
          Length = 317

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 126/316 (39%), Positives = 196/316 (62%), Gaps = 3/316 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+     L M + +  A  + L++ 
Sbjct: 1   MIKLGIVMDPISDINIKKDSSFAMLMAAQSRGYQLFYMEMKDLAMVNGQAMATMRALTVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              +++Y L E     L+ +DVIL+R+DPPF+  ++ STY+LE+      LIVN P  +R
Sbjct: 61  NDPQEWYQLEEAVDTPLADLDVILMRKDPPFDTEFVYSTYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GG+ +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDEQRIRAFHQAKGDIILKPLDGMGGSSIFRVKKDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L  +  +  M Q+++P I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTAEGSQYAMAQAFIPDITAGDKRILVVDGEPVPYSLARIPQKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +     L++ D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCI+EI      +
Sbjct: 241 RGVAQPLSESDWHIARTIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAFDVD 300

Query: 302 VASLFWDGIE-KIKET 316
           +  +  D IE +I ++
Sbjct: 301 ITGMLMDAIEQRINKS 316


>gi|298484999|ref|ZP_07003096.1| Glutathione synthetase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298160409|gb|EFI01433.1| Glutathione synthetase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|330886265|gb|EGH20166.1| glutathione synthetase [Pseudomonas syringae pv. mori str. 301020]
          Length = 319

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 188/315 (59%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLYQDAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEKHGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D I+K  +
Sbjct: 301 NIGGLLMDAIDKKLQ 315


>gi|163757806|ref|ZP_02164895.1| glutathione synthetase protein [Hoeflea phototrophica DFL-43]
 gi|162285308|gb|EDQ35590.1| glutathione synthetase protein [Hoeflea phototrophica DFL-43]
          Length = 315

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 181/314 (57%), Positives = 246/314 (78%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI+N+A+QM+H+ ++ +  DSTFA+++EAQ RGY++FHYTPDQL MRD  + A  +P+
Sbjct: 1   MSKIKNVAVQMDHVRSISIAGDSTFAMSMEAQARGYKLFHYTPDQLSMRDGVVQAVAEPM 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + +  ++ LG ++ I+L+ MDV+L+RQDPPF+M YITST+LLE+++P+TL+VN+P W
Sbjct: 61  ILRDVEGDHFELGPQETINLADMDVVLLRQDPPFDMAYITSTHLLERVHPKTLVVNDPAW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RNSPEKIFVTEF +LMP TLISRD   I  F  E+ D+I+KPLYGNGG GVF I   DR
Sbjct: 121 VRNSPEKIFVTEFPDLMPKTLISRDPETIKAFRAEVGDMILKPLYGNGGAGVFHIKPDDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N +SL+EM  + Y EP + Q YLP +R GDKRILL++G+PVGA+NR+P+E D+RSN+H G
Sbjct: 181 NMTSLLEMFAQMYREPFIAQEYLPHVRAGDKRILLIDGEPVGAINRVPAEHDSRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE ++LT  + +IC RIG +LRERG    GID+IGD +TEINVTSPT +RE+ R GG 
Sbjct: 241 GRAEHSELTDREKEICARIGPALRERGFILVGIDIIGDLMTEINVTSPTGLREVKRFGGA 300

Query: 301 NVASLFWDGIEKIK 314
           ++ASLFWD +E  K
Sbjct: 301 DIASLFWDAVEAKK 314


>gi|257483600|ref|ZP_05637641.1| glutathione synthetase [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|330984647|gb|EGH82750.1| glutathione synthetase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 319

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 188/315 (59%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLYQNAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEKHGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D I+K  +
Sbjct: 301 NIGGLLMDAIDKKLQ 315


>gi|304413316|ref|ZP_07394789.1| Glutathione synthase/Ribosomal protein S6 modification enzyme
           (glutaminyl transferase) [Candidatus Regiella
           insecticola LSR1]
 gi|304284159|gb|EFL92552.1| Glutathione synthase/Ribosomal protein S6 modification enzyme
           (glutaminyl transferase) [Candidatus Regiella
           insecticola LSR1]
          Length = 318

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 126/313 (40%), Positives = 200/313 (63%), Gaps = 2/313 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RG+++++     LY+ + K  A  +P+ + 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMLLEAQRRGWELYYMEVVDLYLENGKGKACMRPVEVT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           + ++ +Y  G E+ + L ++DVIL+R+DPPF+  +I +TY+LE+     +L+VN P  +R
Sbjct: 61  DDQKNWYQFGNEQDLPLDELDVILMRKDPPFDTEFIYATYILERAEAEGSLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R   +I  F+ + +DII+KPL G GG  +FRI   D N 
Sbjct: 121 DCNEKLFTAWFPELTPHTLVTRQKEKIRAFHQDHEDIILKPLDGMGGASIFRIKKDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q++LP I +GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTHHGQHFCMAQNFLPAIAEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +AE   L++ D  I + +   L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RAEAKPLSESDWQIARTVAPRLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFSIS 300

Query: 302 VASLFWDGIEKIK 314
           +  +  + IE I 
Sbjct: 301 ITGMLMNAIENII 313


>gi|227115170|ref|ZP_03828826.1| glutathione synthetase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227326189|ref|ZP_03830213.1| glutathione synthetase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|253690072|ref|YP_003019262.1| glutathione synthetase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756650|gb|ACT14726.1| glutathione synthetase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 319

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 126/312 (40%), Positives = 193/312 (61%), Gaps = 3/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I T+ +K+D++FA+ LEAQ RG+++ +   + LYM      A T+ LS+ 
Sbjct: 1   MIKLGIVMDPIDTINIKKDTSFAMLLEAQRRGWELHYMEMNDLYMHAGVARATTRRLSVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              + +Y    E+ I L ++DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  YDYDGWYDFSGEQDIALEELDVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F  L P TL++R   ++ +F+ +  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPHLTPDTLVTRRADKLRQFHEKHGDVILKPLDGMGGASIFRLKQDDANV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHATRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D  I + +  +L+ +GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLTESDWKIARDVAPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAYPDV 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IEK
Sbjct: 301 SITGMLMDAIEK 312


>gi|330830727|ref|YP_004393679.1| glutathione synthetase, prokaryotic [Aeromonas veronii B565]
 gi|328805863|gb|AEB51062.1| Glutathione synthetase, prokaryotic [Aeromonas veronii B565]
          Length = 316

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 126/312 (40%), Positives = 197/312 (63%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ IS + +K+DS+FA+  EAQ RGY++F+     LYM   + +   +PL++
Sbjct: 1   MTIKLGIVMDPISAINIKKDSSFAMLEEAQKRGYELFYLEMKDLYMEAGRAFGTMRPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                 +Y+LGE     LS +DVIL+R+DPPF+  +I +TY+LE+  +   LIVN P  +
Sbjct: 61  KYDYADWYTLGEVVDQPLSNLDVILMRKDPPFDTEFIYATYMLERAEDEGCLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK++   F+E  P TL++R   ++  F+ + +D+I+KPL G GG  +FR+   D N
Sbjct: 121 RDANEKLYTAWFAEHTPTTLVTRRADKLRAFHAQHRDVILKPLDGMGGASIFRMKEDDAN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              +IE L     +  M Q+YLP I+DGDKR+L+++G+PV     RIP++ + R N+ AG
Sbjct: 181 VGVIIETLTAHGSQYCMAQTYLPAIKDGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I + +G +L+E+GL F G+D+IGD +TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLSEADWAIARAVGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFDV 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IE+
Sbjct: 301 HITGMLMDAIER 312


>gi|261823141|ref|YP_003261247.1| glutathione synthetase [Pectobacterium wasabiae WPP163]
 gi|261607154|gb|ACX89640.1| glutathione synthetase [Pectobacterium wasabiae WPP163]
          Length = 319

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 126/312 (40%), Positives = 193/312 (61%), Gaps = 3/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I T+ +K+D++FA+ LEAQ RG+++ +   + LYM      A T+ LS+ 
Sbjct: 1   MIKLGIVMDPIDTINIKKDTSFAMLLEAQRRGWELHYMEMNDLYMHAGVARATTRRLSVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              + +Y    E+ I L ++DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  YDYDGWYDFSGEQDIALEELDVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F  L P TL++R   ++ +F+ +  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPHLTPDTLVTRRADKLRQFHEKHGDVILKPLDGMGGASIFRLKQDDANV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHASRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D  I + +  +L+ +GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLTESDWKIARDVAPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAYPDV 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IEK
Sbjct: 301 SITGMLMDAIEK 312


>gi|312883852|ref|ZP_07743569.1| glutathione synthetase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368310|gb|EFP95845.1| glutathione synthetase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 315

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 188/314 (59%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RGY+I +     L++      A+T+ + L 
Sbjct: 1   MLKLGIVMDPISSINIKKDSSFAMMLEAQHRGYEIHYMEMHDLHLEQGIAIADTKVVELK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E    +Y    E+ I L+ +D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  EDPSCWYRFTSEQTIKLADLDAVLMRKDPPFDTEYIYATYILERAEEHGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR   +I  F  E  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPTTLVSRKAERIRAFREEHGDVILKPLDGMGGASIFRVKGQDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+ +     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTNHGQNYAMAQTFVPDITNGDKRILVVDGEVIPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 TGEARPLSETDKQIAAAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAVFDVS 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE+  +
Sbjct: 301 ITGKLMDAIERRVK 314


>gi|117619413|ref|YP_857628.1| glutathione synthase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117560820|gb|ABK37768.1| glutathione synthase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 317

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 127/312 (40%), Positives = 197/312 (63%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ IS + +K+DS+FA+  EAQ RGY++F+     LYM   + +   +PL++
Sbjct: 1   MTIKLGIVMDPISAINIKKDSSFAMLEEAQKRGYELFYLEMKDLYMEAGRAFGTMRPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                 +Y+LGE     LS +DVIL+R+DPPF+  +I +TY+LE+  +   LIVN P  +
Sbjct: 61  KYDYADWYTLGEVVDQPLSSLDVILMRKDPPFDTEFIYATYMLERAEDEGCLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK++   F+E  P TL++R   ++  F+ + KD+I+KPL G GG  +FR+   D N
Sbjct: 121 RDANEKLYTAWFAEHTPTTLVTRRADKLRAFHAKHKDVILKPLDGMGGASIFRMKEDDAN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              +IE L     +  M Q+YLP I+DGDKR+L+++G+PV     RIP++ + R N+ AG
Sbjct: 181 VGVIIETLTAHGSQYCMAQTYLPAIKDGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I + +G +L+E+GL F G+D+IGD +TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLSEADWAIARAVGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFDV 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IE+
Sbjct: 301 HITGMLMDAIER 312


>gi|90023275|ref|YP_529102.1| glutathione synthase [Saccharophagus degradans 2-40]
 gi|89952875|gb|ABD82890.1| glutathione synthase [Saccharophagus degradans 2-40]
          Length = 317

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 126/317 (39%), Positives = 195/317 (61%), Gaps = 2/317 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M +  NI + M+ I+++   +D+T A+   AQ RG+ + +     LY+      A T+PL
Sbjct: 1   MHRPLNIGVVMDPIASITYYKDTTLALLQAAQARGHNLTYMEMPDLYLEQGVAKARTRPL 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPF 119
           ++ +  +Q+Y LG  +  +L+ +DVIL+R+DPPF+  +I +TY+LE+  N   L+VN P 
Sbjct: 61  TVFDNAQQWYQLGSFEDKNLADLDVILMRKDPPFDNQFIYATYILERAENDGCLVVNKPQ 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R+  EK+F T F E  PP L+SRD  ++  F+ + +D+I KPL G GG+G+FR    D
Sbjct: 121 SLRDCNEKVFATAFPECCPPVLVSRDPARLRAFHAQHQDVIFKPLDGMGGSGIFRCKHDD 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N S ++E L     E +M Q YLP+I+ GDKRIL++NG+ +   + RIP+  + R N+ 
Sbjct: 181 PNVSVILETLTLNSAEFIMAQKYLPEIKQGDKRILVVNGEAIPYSLARIPASGETRGNLA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG      LT+ D  I  ++  +L E+GL F G+DVIGDY+TEINVTSPTC+REI +  
Sbjct: 241 AGGTGVAQPLTERDQWIVDQVAPTLIEKGLLFVGLDVIGDYLTEINVTSPTCVREIDKAF 300

Query: 299 GENVASLFWDGIEKIKE 315
             N+       +E  ++
Sbjct: 301 NTNIGEKLVIALENKRQ 317


>gi|238798621|ref|ZP_04642096.1| Glutathione synthetase [Yersinia mollaretii ATCC 43969]
 gi|238717507|gb|EEQ09348.1| Glutathione synthetase [Yersinia mollaretii ATCC 43969]
          Length = 317

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 130/311 (41%), Positives = 201/311 (64%), Gaps = 3/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RG+++ +     LYMR     A T+ LS+ 
Sbjct: 1   MIKLGIVMDPITSINIKKDSSFAMLLEAQRRGWELHYMEMGDLYMRGGDGRARTRLLSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           + K+ ++S G E+ + L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R
Sbjct: 61  QDKDDWFSFGAEQDLPLHDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL+SR    I +F+ E  DII+KPL G GGT +FR+   D N 
Sbjct: 121 DCNEKLFTAWFADLTPDTLVSRSKDHIRKFHQEHGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTELGSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTCIREI       
Sbjct: 241 RGEARPLSESDWKIARAVAPVLKQKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFPDV 300

Query: 301 NVASLFWDGIE 311
           ++  +  D IE
Sbjct: 301 SITGMLMDAIE 311


>gi|238785645|ref|ZP_04629622.1| Glutathione synthetase [Yersinia bercovieri ATCC 43970]
 gi|238713424|gb|EEQ05459.1| Glutathione synthetase [Yersinia bercovieri ATCC 43970]
          Length = 317

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 130/311 (41%), Positives = 202/311 (64%), Gaps = 3/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+DS+FA+ LEAQ RG+++ +     LYMR     A T+ LS++
Sbjct: 1   MIKLGIVMDPITSINIKKDSSFAMLLEAQRRGWELHYMEMGDLYMRGGDGRARTRLLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           + K+ ++S G E+ + L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R
Sbjct: 61  QDKDHWFSFGAEQDLPLHDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL+SR    I +F+ E  DII+KPL G GGT +FR+   D N 
Sbjct: 121 DCNEKLFTAWFADLTPDTLVSRSKDHIRKFHQEHGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTELGSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN-GGE 300
           + E   L++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTCIREI       
Sbjct: 241 RGEARPLSESDWKIARAVAPVLKQKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFSDV 300

Query: 301 NVASLFWDGIE 311
           ++  +  D IE
Sbjct: 301 SITGMLMDAIE 311


>gi|88800501|ref|ZP_01116064.1| glutathione synthetase [Reinekea sp. MED297]
 gi|88776732|gb|EAR07944.1| glutathione synthetase [Reinekea sp. MED297]
          Length = 318

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 134/315 (42%), Positives = 191/315 (60%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+ M+ I +   K+DST A+   AQ RG+ + + T   LY+ +         L++
Sbjct: 1   MTIRLAVVMDPIESTAYKKDSTLAMLWAAQDRGWSVHYLTMSDLYLDNGIAKGRATALTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
               + +Y LGE + I LS+ DVIL+R+DPPF+  YI +TYLLE+     TL+VN P  +
Sbjct: 61  HRNPDHFYDLGETETIPLSEFDVILMRKDPPFDNEYIYATYLLERAEQQGTLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK F T FSE  PP L++RD + + +F+    D+I KPL G GG+ +FR+   D N
Sbjct: 121 RDCNEKFFATAFSECTPPHLVARDASLLRQFHQTHGDVIFKPLDGMGGSAIFRLKPDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            S +IE L     E +M Q YLP+I+DGDKRIL++NGKPV   + R+P++ + R N+ AG
Sbjct: 181 VSVIIETLTNNGQEQIMAQKYLPEIKDGDKRILMINGKPVDYSLARLPAKGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G      LT+ D  I  ++   L +RGL F G+DVIGDY+TE+NVTSPTCIREI    G 
Sbjct: 241 GSGRAQPLTERDRWIANQVAPELVKRGLLFVGLDVIGDYLTEVNVTSPTCIREIDAAYGT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++  +    IEK  E
Sbjct: 301 DIGGMLMTEIEKQLE 315


>gi|319408034|emb|CBI81688.1| glutathione synthetase [Bartonella schoenbuchensis R1]
          Length = 312

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 183/312 (58%), Positives = 241/312 (77%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IAIQM+HIST++++ D+TFA+AL AQ RG+ +FHYTPD L MR   + A  +PL + +
Sbjct: 1   MKIAIQMDHISTLQIQGDTTFALALAAQERGHTLFHYTPDCLSMRGDCVIARLEPLIVRD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           ++  +Y LGE     L  MDV+L+RQDPPF+M+YIT+TYLLE+I+P+TL+VN+P W+RNS
Sbjct: 61  EEGCHYKLGEPVYTPLMDMDVVLLRQDPPFDMYYITTTYLLERIHPKTLVVNDPTWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEKIFVTEFS+LMP TLI++DI +I  F  ++ DIIIKPLYG+GG GVF +   DRN +S
Sbjct: 121 PEKIFVTEFSDLMPETLITKDIEEIKSFRNKVGDIIIKPLYGSGGAGVFHLKQDDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L+EM    Y EP ++Q YL  +R GDKR++LL+G PVGA+NRIP+E+D RSN+H GG+AE
Sbjct: 181 LVEMFEHSYREPFIVQRYLDVVRKGDKRVILLDGTPVGAINRIPAEMDARSNMHVGGRAE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LTK D +IC RIG +L++RG    GID+IGDYITEINVTSPT IREI R GG ++AS
Sbjct: 241 TIGLTKRDYEICARIGPTLQKRGFLLVGIDIIGDYITEINVTSPTGIREIKRFGGADIAS 300

Query: 305 LFWDGIEKIKET 316
           LFWD IE+ + +
Sbjct: 301 LFWDIIERKRSS 312


>gi|271502143|ref|YP_003335169.1| glutathione synthetase [Dickeya dadantii Ech586]
 gi|270345698|gb|ACZ78463.1| glutathione synthetase [Dickeya dadantii Ech586]
          Length = 317

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 121/312 (38%), Positives = 193/312 (61%), Gaps = 3/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +R + I M+ IS++ +K+D++FA+  EAQ RG+++ +     LY+   +  A T+ L++ 
Sbjct: 1   MRKLGIVMDPISSINIKKDTSFAMLQEAQRRGWELHYMEMGDLYLHAGEARATTRTLNVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
                +Y  G  + I L ++DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  YDYNHWYDFGATQDIALHELDVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F +L P TL++R+  ++  F+    D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPQLTPDTLVTRNADRLRAFHQHHSDVILKPLDGMGGASIFRLKPEDANV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLSESDWQIARTVAPVLKQKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAYPDV 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D I++
Sbjct: 301 SITGMLMDAIDR 312


>gi|294634385|ref|ZP_06712922.1| glutathione synthase [Edwardsiella tarda ATCC 23685]
 gi|291092193|gb|EFE24754.1| glutathione synthase [Edwardsiella tarda ATCC 23685]
          Length = 316

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 194/310 (62%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+D++FA+ LEAQ RGYQ+ +     LY+   +  A T+ LS+ 
Sbjct: 1   MIKLGIVMDPIASINIKKDTSFAMLLEAQRRGYQLHYMEMADLYLHQGEARAQTRLLSVS 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           + K  +Y    E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  DDKTSWYRFDGEQDIALADLDVILMRKDPPFDTEFIYATYILERAEAHGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R    +  F+    DII+KPL G GG  +FRI   D N 
Sbjct: 121 DCNEKLFTAWFADLTPDTLVTRRADHLRDFHARHGDIILKPLDGMGGASIFRIKQDDANV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I++GDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHGHRFCMAQNYLPAIKEGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I +++   L+++GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEARPLSESDWAIARKVAPILKQKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPVS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|322834234|ref|YP_004214261.1| glutathione synthetase [Rahnella sp. Y9602]
 gi|321169435|gb|ADW75134.1| glutathione synthetase [Rahnella sp. Y9602]
          Length = 316

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 201/315 (63%), Gaps = 2/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+ LEAQ RGY++ +   + LY+R  +  A T+ LS+ 
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLLEAQSRGYELHYMEMNSLYLRGGEGRATTKKLSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  + +Y  G E+ I L ++DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QDYDGWYEFGTEQDIALQELDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R+  Q+  F+ E  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVTRNAAQLKAFHKEHTDVILKPLDGMGGASIFRLKPEDANV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I+DGDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVVIETLTEHGSRFCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTC REI      +
Sbjct: 241 RGEARPLSESDWAIARTVAPILKQKGLIFVGLDIIGDRLTEINVTSPTCAREIEAAFPIS 300

Query: 302 VASLFWDGIEKIKET 316
           +  +  D IEK   +
Sbjct: 301 ITGMLMDAIEKRLAS 315


>gi|331009675|gb|EGH89731.1| glutathione synthetase [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 319

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 188/315 (59%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLYQNAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQSTPPTLVSRRADIIREFAEKHGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D I+K  +
Sbjct: 301 NIGGLLMDAIDKKLQ 315


>gi|50122844|ref|YP_052011.1| glutathione synthetase [Pectobacterium atrosepticum SCRI1043]
 gi|49613370|emb|CAG76821.1| glutathione synthetase [Pectobacterium atrosepticum SCRI1043]
          Length = 319

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 127/312 (40%), Positives = 193/312 (61%), Gaps = 3/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I T+ +K+D++FA+ LEAQ RG+++ +   + LYM      A T+ LS+ 
Sbjct: 1   MIKLGIVMDPIDTINIKKDTSFAMLLEAQRRGWELHYMEMNDLYMHAGVARATTRRLSVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              + +Y    E+ I L ++DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  YDYDGWYDFSGEQDIALEELDVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EKIF   F  L P TL++R   ++ +F+ +  D+I+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKIFTAWFPHLTPDTLVTRRADKLRQFHEKHGDVILKPLDGMGGASIFRLKQDDANV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHASRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D  I + +  +L+ +GL F G+D+IGD +TEINVTSPTC+REI       
Sbjct: 241 RGEARPLTESDWKIARDVAPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAYPDV 300

Query: 301 NVASLFWDGIEK 312
           ++  +  D IEK
Sbjct: 301 SITGMLMDAIEK 312


>gi|331018475|gb|EGH98531.1| glutathione synthetase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 319

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 187/315 (59%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQDRGWTLFYMEQKDLYQNAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M +I +TYLLE+      L+V  P  +
Sbjct: 61  FADPAKWFEFEAEIDAGLDDLDVILMRKDPPFDMEFIYTTYLLEQAESAGVLVVKKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    +  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADILREFAEQQGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D IEK  +
Sbjct: 301 NIGGLLMDAIEKKLQ 315


>gi|16766396|ref|NP_462011.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56415033|ref|YP_152108.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|161616059|ref|YP_001590024.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167990378|ref|ZP_02571478.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168234354|ref|ZP_02659412.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168236163|ref|ZP_02661221.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168242898|ref|ZP_02667830.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168264459|ref|ZP_02686432.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168463718|ref|ZP_02697635.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168819875|ref|ZP_02831875.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194443383|ref|YP_002042354.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194449284|ref|YP_002047083.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194472813|ref|ZP_03078797.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194735153|ref|YP_002116043.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197249067|ref|YP_002148009.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197262606|ref|ZP_03162680.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197363962|ref|YP_002143599.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|200386633|ref|ZP_03213245.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204928334|ref|ZP_03219534.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205354018|ref|YP_002227819.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207858356|ref|YP_002245007.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|20138176|sp|P58580|GSHB_SALTY RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|16421648|gb|AAL21970.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56129290|gb|AAV78796.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|161365423|gb|ABX69191.1| hypothetical protein SPAB_03860 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402046|gb|ACF62268.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194407588|gb|ACF67807.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194459177|gb|EDX48016.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194710655|gb|ACF89876.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195633481|gb|EDX51895.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197095439|emb|CAR60998.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197212770|gb|ACH50167.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197240861|gb|EDY23481.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197290744|gb|EDY30098.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|199603731|gb|EDZ02276.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204322656|gb|EDZ07853.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205273799|emb|CAR38794.1| Glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205331162|gb|EDZ17926.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205331711|gb|EDZ18475.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205338209|gb|EDZ24973.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205343301|gb|EDZ30065.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205347067|gb|EDZ33698.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206710159|emb|CAR34515.1| Glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|261248226|emb|CBG26063.1| GSH synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267995260|gb|ACY90145.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301159650|emb|CBW19169.1| Glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312914117|dbj|BAJ38091.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320087527|emb|CBY97292.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321225768|gb|EFX50822.1| Glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|323131451|gb|ADX18881.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|326629131|gb|EGE35474.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|332989962|gb|AEF08945.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 315

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 201/310 (64%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIAHINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGSEQEIKLADLDVILMRKDPPFDTEFIYATYILERAEEEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFADLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKEGDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|296386906|ref|ZP_06876405.1| glutathione synthetase [Pseudomonas aeruginosa PAb1]
          Length = 317

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 187/310 (60%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+ +  K+DS+ A+ L AQ RG+ +F+     LY +        +PL +
Sbjct: 1   MSVRLGIVMDPIARINFKKDSSLAMLLAAQARGWSLFYMEQQDLYQKAGVARGRMRPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++ L  E    L ++DVIL+R+DPPF+  ++ STYLLE+      L+VN P  +
Sbjct: 61  FNDASRWFELEAESDQPLHELDVILMRKDPPFDNEFVYSTYLLEQAERAGALVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK F T+F++  PPT++SR    +  F  E +DII+KPL G GG+ +FR   GD N
Sbjct: 121 RDCNEKFFATQFTQCTPPTMVSRRSDILREFAAEHRDIILKPLDGMGGSSIFRHREGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L +   + +M Q YLP+I+DGDKRIL+++G+PV     RIP++ + R N+ AG
Sbjct: 181 LSVILETLTQHGSQQIMAQRYLPEIKDGDKRILMIDGEPVPYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L++ D  I   +G  LRERGL F G+DVIGDY+TEINVTSPTCIREI +    
Sbjct: 241 GRGVAQPLSERDRWIAAEVGPYLRERGLLFVGLDVIGDYLTEINVTSPTCIREIDQAFDT 300

Query: 301 NVASLFWDGI 310
            +     D I
Sbjct: 301 RIGDKLMDAI 310


>gi|167552013|ref|ZP_02345766.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205323328|gb|EDZ11167.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
          Length = 315

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 126/310 (40%), Positives = 201/310 (64%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RGY++ +     LY+ + +  A T+ L+++
Sbjct: 1   MIKLGIVMDPIAHINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLNVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGSEQEIKLADLDVILMRKDPPFDTEFIYATYILERAEEEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFADLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKEGDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPCCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|157377105|ref|YP_001475705.1| glutathione synthetase [Shewanella sediminis HAW-EB3]
 gi|157319479|gb|ABV38577.1| Glutathione synthase [Shewanella sediminis HAW-EB3]
          Length = 316

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 133/314 (42%), Positives = 196/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ L AQ RGYQ+F+     L M + +  AN + LS+ 
Sbjct: 1   MIKLGIVMDPISDINIKKDSSFAMLLAAQSRGYQLFYMEMQDLAMVNGEAMANMRELSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  + ++ LGE     LS +DV+L+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  QDPDNWFELGEPVDTPLSALDVVLMRKDPPFDTEFIYATYMLERAEEEGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  FY +  DII+KPL G GGT +FRI  GD N 
Sbjct: 121 DANEKLFTAWFSEFTPETMVTRDANRIREFYKQKGDIILKPLDGMGGTLIFRIKAGDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L E      M Q+++P I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTEYGQRYAMAQAFIPDITSGDKRILVVDGEPVPYSLARIPQKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +     L++ D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCI+EI      +
Sbjct: 241 RGVAQPLSESDWAIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAFDVD 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDSIEARLK 314


>gi|167036032|ref|YP_001671263.1| glutathione synthetase [Pseudomonas putida GB-1]
 gi|166862520|gb|ABZ00928.1| glutathione synthetase [Pseudomonas putida GB-1]
          Length = 317

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 134/315 (42%), Positives = 197/315 (62%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY  +SK  A  +PL +
Sbjct: 1   MSVRLGIVMDPIASISYKKDSSLAMLLAAQARGWSLFYMEQQDLYQGESKARARMRPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                 ++ LGEE+   L+++DVIL+R+DPPF+M ++ STYLLE+  N   L+VN P  +
Sbjct: 61  FADPAHWFELGEEQDSPLAELDVILMRKDPPFDMEFVYSTYLLEQAENDGVLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +   PTL+SR    I  F  +  D+I+KPL G GGT +FR   GD N
Sbjct: 121 RDCNEKMFATLFPQCTTPTLVSRRPDIIREFAAKHADVILKPLDGMGGTSIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTALGTQQIMAQAYLPAIKDGDKRILMIDGEPVDYCLARIPASGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT+ D  I  ++G +LRE+GL F G+DVIGD++TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLTERDRWIAAQVGPTLREKGLLFVGLDVIGDFLTEINVTSPTCIREIDAAYNT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++     D I++  +
Sbjct: 301 DIGGKLMDAIDRKLK 315


>gi|238795148|ref|ZP_04638738.1| Glutathione synthetase [Yersinia intermedia ATCC 29909]
 gi|238725547|gb|EEQ17111.1| Glutathione synthetase [Yersinia intermedia ATCC 29909]
          Length = 317

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 131/311 (42%), Positives = 204/311 (65%), Gaps = 3/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RG+++ +     LY++  +  A+T+ LS+ 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMLLEAQRRGWELHYMEMGDLYLQGGEGRASTRLLSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           + KE +++ G E+ I L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R
Sbjct: 61  QDKESWFNFGAEQDIPLHDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SRD  +I +F+ +  DII+KPL G GGT +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRDKDRIRKFHQKHGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTELGSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTCIREI       
Sbjct: 241 RGEARPLSESDWAIARAVAPVLKQKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFPDV 300

Query: 301 NVASLFWDGIE 311
           ++  +  D IE
Sbjct: 301 SITKMLMDAIE 311


>gi|209694141|ref|YP_002262069.1| glutathione synthetase [Aliivibrio salmonicida LFI1238]
 gi|208008092|emb|CAQ78233.1| glutathione synthetase [Aliivibrio salmonicida LFI1238]
          Length = 328

 Score =  301 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 127/313 (40%), Positives = 192/313 (61%), Gaps = 2/313 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RG++I +     L++   K  A+T+ + L 
Sbjct: 11  MIKLGIVMDPISSINIKKDSSFAMMLEAQKRGWEIHYMEMADLHLDQGKAVADTKVVELK 70

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           E    +Y    E+ IDL+++D +L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 71  EDPTGWYEFKSEQTIDLAELDAVLMRKDPPFDTEYIYATYILERAEIQGALIVNKPQSLR 130

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R   +I  F  +  DII+KPL G GG  +FR+  GD N 
Sbjct: 131 DCNEKLFTAWFPELTPTTLVTRKSDKIKAFREKHGDIILKPLDGMGGASIFRVKAGDPNV 190

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+++P I +GDKRIL+++G+P+     RIP++ + R N+ AGG
Sbjct: 191 SVIIETLTNHEQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG 250

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L++ D  I   +  +L+E+GL F G+DVIGD +TEINVTSPTCI+EI      +
Sbjct: 251 TGEARPLSETDWAIANAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAFDIS 310

Query: 302 VASLFWDGIEKIK 314
           +     D IE+  
Sbjct: 311 ITGKLMDAIERRI 323


>gi|294142458|ref|YP_003558436.1| glutathione synthetase [Shewanella violacea DSS12]
 gi|293328927|dbj|BAJ03658.1| glutathione synthetase [Shewanella violacea DSS12]
          Length = 317

 Score =  301 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 132/314 (42%), Positives = 197/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ L AQ RGYQ+F+     L M + K  AN + LS+ 
Sbjct: 1   MIKLGIVMDPISDINIKKDSSFAMLLAAQSRGYQLFYMEMRDLAMVNGKAMANMRALSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  + ++ LGE     +S +DV+L+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  QDPDNWFELGEAIDTPMSDLDVVLMRKDPPFDTEFIYATYMLERAEEEGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD T+I  FY E  DII+KPL G GG+ +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDETRIRNFYQEKGDIILKPLDGMGGSSIFRVKKDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  MIQ+++P I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTNYGQQYAMIQAFIPDITSGDKRILVIDGEPVPYSLARIPQKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +     L++ D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCI+EI      +
Sbjct: 241 RGVAQPLSESDWHIARSIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAYDVD 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLK 314


>gi|161506353|ref|YP_001573465.1| glutathione synthetase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160867700|gb|ABX24323.1| hypothetical protein SARI_04550 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 315

 Score =  301 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 202/310 (65%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIANINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRMLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y L +E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYELNDEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFSDLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKEGDPNM 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|316931697|ref|YP_004106679.1| glutathione synthetase [Rhodopseudomonas palustris DX-1]
 gi|315599411|gb|ADU41946.1| glutathione synthetase [Rhodopseudomonas palustris DX-1]
          Length = 313

 Score =  301 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 151/308 (49%), Positives = 220/308 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I+ + ++ DSTFA+ LEAQ RG+ I ++TPD+L +R +++ A+ Q L +
Sbjct: 1   MTLKVAVQMDPIARINIRGDSTFALLLEAQARGHSISYFTPDKLSLRGNEVIASVQSLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            +++  +++LGE   +D+   DV+L+RQDPPF++ YITST+LLE+I+P TL+VN+P  +R
Sbjct: 61  RDQEGDHFTLGEPARVDMRSFDVVLLRQDPPFDLAYITSTHLLERIHPHTLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F+ELMPPTLISRD  +I  F  E   +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMDFTELMPPTLISRDKDEINAFRAEHGAVVMKPLHGHGGAAVFRVLPQDINF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLYDMFAVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAADDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T L+  +  IC  +G  LRERGL F GIDVI  Y+TEINVTSPT IR + R GG ++
Sbjct: 241 AAATDLSPREQQICAALGPKLRERGLLFVGIDVIDGYLTEINVTSPTGIRAVARLGGPDI 300

Query: 303 ASLFWDGI 310
           A+  WD I
Sbjct: 301 AARVWDVI 308


>gi|312963612|ref|ZP_07778093.1| glutathione synthase [Pseudomonas fluorescens WH6]
 gi|311282121|gb|EFQ60721.1| glutathione synthase [Pseudomonas fluorescens WH6]
          Length = 317

 Score =  301 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 132/315 (41%), Positives = 195/315 (61%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY  D +  A  +PL +
Sbjct: 1   MSVRVGIVMDPIASISYKKDSSLAMLLAAQARGWTLFYMEQRDLYQGDGEARARMRPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
               E+++ L +E    LS +DVIL+R+DPPF+M ++ STYLLE+      LIVN P  +
Sbjct: 61  FANPEKWFELQDEIDSPLSDLDVILMRKDPPFDMEFVYSTYLLEQAERAGVLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPT++SR    +  F  +  D+I+KPL G GGT +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTVVSRRADVLREFAAQHGDVILKPLDGMGGTSIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTALGTQQIMGQAYLPAIKDGDKRILMIDGEPVDYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I  ++G +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIASQVGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAYGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  +    IE+  +
Sbjct: 301 NIGEMLMGAIERKLQ 315


>gi|238909893|ref|ZP_04653730.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
          Length = 315

 Score =  301 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 128/310 (41%), Positives = 201/310 (64%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIAHINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGNEQEIKLADLDVILMRKDPPFDTEFIYATYILERAEEEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFADLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKEGDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++GKPV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGKPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|224584888|ref|YP_002638687.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224469416|gb|ACN47246.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 315

 Score =  301 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 126/310 (40%), Positives = 201/310 (64%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RGY++ +     LY+ + +  A T+ L+++
Sbjct: 1   MIKLGIVMDPIAHINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLNVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGSEQEIKLADLDVILMRKDPPFDTEFIYATYILERAEEEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFADLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKEGDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|85060000|ref|YP_455702.1| glutathione synthetase [Sodalis glossinidius str. 'morsitans']
 gi|84780520|dbj|BAE75297.1| glutathione synthase [Sodalis glossinidius str. 'morsitans']
          Length = 318

 Score =  301 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 131/311 (42%), Positives = 194/311 (62%), Gaps = 2/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IST+ +K+DS+FA+ LEAQ RGY+I +     LY+R  +  A+T+ LS+ 
Sbjct: 1   MIKLGIVMDPISTINIKKDSSFAMLLEAQSRGYEIHYMEMSSLYLRGGEARASTRLLSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  + +YS   EK I+L ++DVIL+R+DPPF+  +I +TY+LE+  +   LIVN P  +R
Sbjct: 61  QDYDAWYSFNGEKDINLGELDVILMRKDPPFDTEFIYATYILERAEDEGALIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F+   P TL+S     I  F+ E  DII+KPL G GGT +FR+   D N 
Sbjct: 121 DCNEKLFTAWFARHTPDTLVSHRDDHIRAFWQEHGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           + ++E L        M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 TVIVETLTGYGRHFCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L+  D  I + +   L+++GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 HGEARPLSDSDWKIARDVAPVLKKKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPIS 300

Query: 302 VASLFWDGIEK 312
           +  +  D IEK
Sbjct: 301 ITGMLMDAIEK 311


>gi|269137636|ref|YP_003294336.1| glutathione synthetase [Edwardsiella tarda EIB202]
 gi|267983296|gb|ACY83125.1| glutathione synthetase [Edwardsiella tarda EIB202]
 gi|304557701|gb|ADM40365.1| Glutathione synthetase [Edwardsiella tarda FL6-60]
          Length = 316

 Score =  301 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 129/310 (41%), Positives = 194/310 (62%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+D++FA+ LEAQ RGYQ+ +   D LY++  +  A T+ LS+ 
Sbjct: 1   MIKLGIVMDPIASINIKKDTSFAMLLEAQRRGYQLHYMEMDSLYLQQGEARAQTRLLSVS 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           + K  +Y    E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  DDKASWYRFDGEQDIALADLDVILMRKDPPFDTEFIYATYILERAEARGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R    +  F+    D+I+KPL G GG  +FRI   D N 
Sbjct: 121 DCNEKLFTAWFADLTPDTLVTRSAAHLRDFHARHGDVILKPLDGMGGASIFRIQQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHGKRFCMAQNYLPAIVDGDKRVLVIDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I +++   L+E+GL F G+D+IGD +TEINVTSPTC REI      +
Sbjct: 241 RGEARPLSESDWAIARKVAPMLKEKGLIFVGLDIIGDRLTEINVTSPTCAREIEAAFPVS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|86747545|ref|YP_484041.1| glutathione synthetase [Rhodopseudomonas palustris HaA2]
 gi|86570573|gb|ABD05130.1| glutathione synthase [Rhodopseudomonas palustris HaA2]
          Length = 313

 Score =  301 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 151/313 (48%), Positives = 224/313 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I+ + ++ DSTFA+ LEAQ RG+ I ++TPD+L +R + + A+ Q LS+
Sbjct: 1   MTLKVAVQMDPIARINIRGDSTFALLLEAQKRGHAISYFTPDKLSLRGTDVVASAQSLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  +++LGE + ID+   D +L+RQDPPF++ YITST+LLE+I+P+TL+VN+P  +R
Sbjct: 61  RDLEGDHFTLGEPERIDMRSFDAVLLRQDPPFDLAYITSTHLLERIHPQTLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F+ELMPPTLISR++ +I  F  E   +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMDFAELMPPTLISRNLDEINAFRAEHGAVVMKPLHGHGGAAVFRVLPQDINF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLYDMFAVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAADDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T L++ +  IC  +G  LRERGL   GIDVI  Y+TEINVTSPT IR + R GG ++
Sbjct: 241 AAATDLSERERAICATLGPKLRERGLLLVGIDVIDGYLTEINVTSPTGIRAVARLGGPDI 300

Query: 303 ASLFWDGIEKIKE 315
           A+  WD IE+ + 
Sbjct: 301 AARVWDVIEQKRS 313


>gi|24372420|ref|NP_716462.1| glutathione synthetase [Shewanella oneidensis MR-1]
 gi|29611762|sp|Q8EIK8|GSHB_SHEON RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|24346389|gb|AAN53907.1|AE015527_9 glutathione synthetase [Shewanella oneidensis MR-1]
          Length = 315

 Score =  301 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 128/310 (41%), Positives = 192/310 (61%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+     L + +     N +PL + 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLMAAQERGYQLFYMEMADLAIVNGVAMGNMRPLKVM 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
                ++ LGE K   LS+++V+L+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  NDANHWFELGEAKDTPLSELNVVLMRKDPPFDTEYIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDANRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L +   +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTQYGNQYAMAQAFIPEITKGDKRILVVDGEPVPYALARIPKKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+  D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVAQPLSDSDWKIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD 300

Query: 302 VASLFWDGIE 311
           +  + +D IE
Sbjct: 301 ITGMLFDAIE 310


>gi|260753464|ref|YP_003226357.1| glutathione synthetase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258552827|gb|ACV75773.1| glutathione synthetase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 316

 Score =  301 bits (771), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 137/315 (43%), Positives = 214/315 (67%), Gaps = 1/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ + +VK+  DS+FA+ L AQ RGY+++HY    L  ++ ++ A   P+ +
Sbjct: 1   MHLKVAVQMDPLESVKIAGDSSFALMLAAQKRGYKLWHYLASDLSYKEGRVVAKAHPVQV 60

Query: 63  DEKKEQYYSLGEEKIIDLS-QMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
           +  +  +Y+   E+ IDL   +DV+L+RQDPPF++ YIT+T+LLE+I  +TL+VNNP  +
Sbjct: 61  NAVQGSHYTEEPEEEIDLESDVDVVLMRQDPPFDLAYITATHLLERITNKTLVVNNPAAV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           RN+PEK++V +F++ MPPTLI+RD+ Q+  F+    +I++KPLYGN G+ VF I    +N
Sbjct: 121 RNAPEKLYVLDFAQFMPPTLITRDVEQLRAFHKRHHEIVVKPLYGNAGSAVFYIGRDGKN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
             +L E+  E + EP M+Q+++P +  GDKRI+L++G+  GA+NR+P + + RSN+  GG
Sbjct: 181 IGALSELFGEVWREPYMVQAFIPDVSKGDKRIILVDGEVAGAINRVPRQGEIRSNLGVGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
            AE   LT+ + +IC+ +G  L ++GL F GIDVI  Y+TEINVTSPT I  + R    N
Sbjct: 241 TAEAASLTEKEKEICQILGPELAKQGLLFVGIDVIAGYLTEINVTSPTGIVAMDRFNDSN 300

Query: 302 VASLFWDGIEKIKET 316
           VA + WD IE   ++
Sbjct: 301 VAGMIWDKIENKIKS 315


>gi|241762669|ref|ZP_04760739.1| glutathione synthetase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241372740|gb|EER62462.1| glutathione synthetase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 316

 Score =  301 bits (771), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 137/315 (43%), Positives = 213/315 (67%), Gaps = 1/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ + +VK+  DS+FA+ L AQ RGY+++HY    L  ++ ++ A   P+ +
Sbjct: 1   MHLKVAVQMDPLESVKIAGDSSFALMLAAQKRGYKLWHYLASDLSYKEGRVVAKAHPVQV 60

Query: 63  DEKKEQYYSLGEEKIIDLS-QMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
           +  +  +Y+   E+ IDL   +DV+L+RQDPPF++ YIT+T+LLE+I  +TL+VNNP  +
Sbjct: 61  NAVQGSHYTEEPEEEIDLESDVDVVLMRQDPPFDLAYITATHLLERITNKTLVVNNPAAV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           RN+PEK++V +F++ MPPTLI+RD+ Q+  F+    +I++KPLYGN G+ VF I    +N
Sbjct: 121 RNAPEKLYVLDFAQFMPPTLITRDVEQLRAFHKRHHEIVVKPLYGNAGSAVFYIGRDGKN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
             +L E+  E + EP M Q+++P +  GDKRI+L++G+  GA+NR+P + + RSN+  GG
Sbjct: 181 IGALSELFGEVWREPYMAQAFIPDVSKGDKRIILVDGEVAGAINRVPRQGEIRSNLGVGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
            AE   LT+ + +IC+ +G  L ++GL F GIDVI  Y+TEINVTSPT I  + R    N
Sbjct: 241 TAEAASLTEKEKEICQILGPELAKQGLLFVGIDVIAGYLTEINVTSPTGIVAMDRFNDSN 300

Query: 302 VASLFWDGIEKIKET 316
           VA + WD IE   ++
Sbjct: 301 VAGMIWDKIENKIKS 315


>gi|162147887|ref|YP_001602348.1| glutathione synthetase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542504|ref|YP_002274733.1| glutathione synthetase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786464|emb|CAP56046.1| Glutathione synthetase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530181|gb|ACI50118.1| glutathione synthetase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 334

 Score =  301 bits (771), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 155/328 (47%), Positives = 220/328 (67%), Gaps = 16/328 (4%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKI------- 53
           M +   +A+QM+ ++ + +  DSTFA+ LEAQ RGY++F Y    L +R+ +        
Sbjct: 1   MSRPLKVAVQMDPLAGIDINGDSTFALMLEAQARGYELFVYHVQGLSLREGRTDGHAGGT 60

Query: 54  -----YANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKI 108
                 A  +P  +      + +LGEE+++DLS MDVIL+RQDPPF+M YIT+T++LE +
Sbjct: 61  RTERLTARARPARVQRVAGDHAALGEERVLDLSGMDVILMRQDPPFDMAYITATHMLEHV 120

Query: 109 NPETL----IVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPL 164
           +        +VN+P  +RN+PEK+ VT + +LMPPTL++ D+  I  F  + +DII+KPL
Sbjct: 121 HGTGPGRALVVNDPESVRNAPEKLLVTHYPDLMPPTLVTWDVQAIRDFRAQWRDIIVKPL 180

Query: 165 YGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV 224
           +GNGG GVFRI   D N +SL+EM F +  EPLMIQ Y   +R GDKRI+L +G+P+GA+
Sbjct: 181 FGNGGAGVFRIREDDENLNSLLEMHFARSREPLMIQRYEAAVRRGDKRIILADGQPIGAI 240

Query: 225 NRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEIN 284
           NR+P++ + RSN+H GGKA   +LT  D +IC+ IG  LRE+GL F GIDVIGD++TEIN
Sbjct: 241 NRVPAQGEARSNMHVGGKAAKVELTPRDREICEAIGPMLREKGLIFVGIDVIGDWLTEIN 300

Query: 285 VTSPTCIREIHRNGGENVASLFWDGIEK 312
           VTSPT ++EI R    N A L WD I +
Sbjct: 301 VTSPTGLQEIDRFDDINSAGLIWDCILR 328


>gi|117921882|ref|YP_871074.1| glutathione synthetase [Shewanella sp. ANA-3]
 gi|117614214|gb|ABK49668.1| glutathione synthase [Shewanella sp. ANA-3]
          Length = 315

 Score =  301 bits (771), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 126/310 (40%), Positives = 194/310 (62%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+     L M +     N +PL + 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLMAAQERGYQLFYMEMADLAMVNGVAMGNMRPLKVI 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
               +++ LG+ +   LS+++V+L+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  NDANKWFELGDAQDTPLSELNVVLMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDANRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L +   +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTQYGNQYAMAQAFIPEITKGDKRILVVDGEPVPYALARIPKKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L++ D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVAQPLSESDWKIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD 300

Query: 302 VASLFWDGIE 311
           +  + +D IE
Sbjct: 301 ITGMLFDAIE 310


>gi|15595604|ref|NP_249098.1| glutathione synthetase [Pseudomonas aeruginosa PAO1]
 gi|116054138|ref|YP_788581.1| glutathione synthetase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218889149|ref|YP_002438013.1| glutathione synthetase [Pseudomonas aeruginosa LESB58]
 gi|254237358|ref|ZP_04930681.1| glutathione synthetase [Pseudomonas aeruginosa C3719]
 gi|254243506|ref|ZP_04936828.1| glutathione synthetase [Pseudomonas aeruginosa 2192]
 gi|20138354|sp|Q9I697|GSHB_PSEAE RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|9946262|gb|AAG03796.1|AE004478_1 glutathione synthetase [Pseudomonas aeruginosa PAO1]
 gi|115589359|gb|ABJ15374.1| glutathione synthetase' [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169289|gb|EAZ54800.1| glutathione synthetase [Pseudomonas aeruginosa C3719]
 gi|126196884|gb|EAZ60947.1| glutathione synthetase [Pseudomonas aeruginosa 2192]
 gi|218769372|emb|CAW25132.1| glutathione synthetase [Pseudomonas aeruginosa LESB58]
          Length = 317

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 187/310 (60%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+ +  K+DS+ A+ L AQ RG+ +F+     LY +        +PL +
Sbjct: 1   MSVRLGIVMDPIARINFKKDSSLAMLLAAQARGWSLFYMEQQDLYQKAGVARGRMRPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++ L  E    L ++DVIL+R+DPPF+  ++ STYLLE+      L+VN P  +
Sbjct: 61  FNDASRWFELEAESDQPLHELDVILMRKDPPFDNEFVYSTYLLEQAERAGALVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK F T+F++  PPT++SR    +  F  E +DII+KPL G GG+ +FR   GD N
Sbjct: 121 RDCNEKFFATQFTQCTPPTMVSRRSDILREFAAEHRDIILKPLDGMGGSSIFRHREGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L +   + +M Q YLP+I+DGDKRIL+++G+PV     RIP++ + R N+ AG
Sbjct: 181 LSVILETLTQHGSQQIMAQRYLPEIKDGDKRILMIDGEPVPYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L++ D  I   +G  LRERGL F G+DVIGDY+TEINVTSPTCIREI +    
Sbjct: 241 GRGVAQPLSERDRWIAAEVGPHLRERGLLFVGLDVIGDYLTEINVTSPTCIREIDQAFDT 300

Query: 301 NVASLFWDGI 310
            +     D I
Sbjct: 301 RIGDKLMDAI 310


>gi|56552809|ref|YP_163648.1| glutathione synthetase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56544383|gb|AAV90537.1| glutathione synthetase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 316

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 136/315 (43%), Positives = 213/315 (67%), Gaps = 1/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ + +VK+  DS+FA+ L AQ RGY+++HY    L  ++ ++ A   P+ +
Sbjct: 1   MHLKVAVQMDPLESVKIAGDSSFALMLAAQKRGYKLWHYLASDLSYKEGRVVAKAHPVQV 60

Query: 63  DEKKEQYYSLGEEKIIDLS-QMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
           +  +  +Y+   E+ IDL   +DV+L+RQDPPF++ YIT+T+LLE+I  +TL+VNNP  +
Sbjct: 61  NAVQGSHYTEESEEEIDLESDVDVVLMRQDPPFDLAYITATHLLERITNKTLVVNNPAAV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           RN+PEK++V +F++ MPPTLI+RD+ Q+  F+    +I++KPLYGN G+ VF I    +N
Sbjct: 121 RNAPEKLYVLDFAQFMPPTLITRDVEQLRAFHKRHHEIVVKPLYGNAGSAVFYIGRDGKN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
             +L E+  E + EP M Q+++P +  GDKRI+L++G+  GA+NR+P + + RSN+  GG
Sbjct: 181 IGALSELFGEVWREPYMAQAFIPDVSKGDKRIILVDGEVAGAINRVPRQGEIRSNLGVGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
            AE   LT+ + +IC+ +G  L ++GL F GIDVI  Y+TEINVTSPT I  + R    +
Sbjct: 241 TAEAASLTEKEKEICQILGPELAKQGLLFVGIDVIAGYLTEINVTSPTGIVAMDRFNDSD 300

Query: 302 VASLFWDGIEKIKET 316
           VA + WD IE   ++
Sbjct: 301 VAGMIWDKIENKIKS 315


>gi|114048822|ref|YP_739372.1| glutathione synthetase [Shewanella sp. MR-7]
 gi|113890264|gb|ABI44315.1| glutathione synthase [Shewanella sp. MR-7]
          Length = 315

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 194/310 (62%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+     L M +     N +PL++ 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLMAAQERGYQLFYMEMADLAMVNGVAMGNMRPLTVI 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
               +++ LGE +   LS+++V+L+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  NDANKWFELGEAQDTPLSELNVVLMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDANRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L +   +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTQYGNQYAMAQAFIPEITKGDKRILVVDGEPVPYALARIPKKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+  D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVAQPLSDSDWKIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD 300

Query: 302 VASLFWDGIE 311
           +  + +D IE
Sbjct: 301 ITGMLFDAIE 310


>gi|127514153|ref|YP_001095350.1| glutathione synthetase [Shewanella loihica PV-4]
 gi|126639448|gb|ABO25091.1| glutathione synthase [Shewanella loihica PV-4]
          Length = 315

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 190/310 (61%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+++     L M +     N + L++ 
Sbjct: 1   MIKLGIVMDPISDINIKKDSSFAMLMAAQSRGYQLYYMEMQDLAMVNGVAMGNMRRLTVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  + +Y L E     L+ +DVIL+R+DPPF+  ++ +TY+LE+     TLIVN P  +R
Sbjct: 61  QDPQSWYQLEEAVDTPLADLDVILMRKDPPFDTEFVYATYMLERAEEQGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  FY E  DII+KPL G GG+ +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPDTIVTRDAQRIRAFYQEKGDIILKPLDGMGGSSIFRVKAQDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  M Q+++P I  GDKRIL+++G PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTNHGQQYAMAQAFIPDITAGDKRILVVDGVPVPYSLARIPQKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +     L++ D  I   IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGVAQPLSESDWAIANAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDVD 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|325273062|ref|ZP_08139370.1| glutathione synthetase [Pseudomonas sp. TJI-51]
 gi|324101796|gb|EGB99334.1| glutathione synthetase [Pseudomonas sp. TJI-51]
          Length = 317

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 134/315 (42%), Positives = 199/315 (63%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY  + K  A  +PL++
Sbjct: 1   MSVRLGIVMDPIASISYKKDSSLAMLLAAQARGWSLFYMEQRDLYQGEGKARARMRPLNV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                +++ LGEE+   L+++DVIL+R+DPPF+M ++ STYLLE+  N   L+VN P  +
Sbjct: 61  FADPARWFELGEEQDSPLAELDVILMRKDPPFDMEFVYSTYLLEQAENDGVLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GGT +FR  +GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRPDIIREFAAKHGDVILKPLDGMGGTSIFRHRVGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTALGAQQIMAQAYLPAIKDGDKRILMIDGEPVDYCLARIPASGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I  ++G +LRE+GL F G+DVIGDY+TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLSDRDRWIAAQVGPTLREKGLLFVGLDVIGDYLTEINVTSPTCIREIDNAYNT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++     D I++  +
Sbjct: 301 DIGGKLMDAIDRQLQ 315


>gi|16124396|ref|NP_418960.1| glutathione synthetase [Caulobacter crescentus CB15]
 gi|221233079|ref|YP_002515515.1| glutathione synthetase [Caulobacter crescentus NA1000]
 gi|20138320|sp|Q9ABS9|GSHB_CAUCR RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|13421252|gb|AAK22128.1| glutathione synthetase [Caulobacter crescentus CB15]
 gi|220962251|gb|ACL93607.1| glutathione synthetase [Caulobacter crescentus NA1000]
          Length = 317

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 142/313 (45%), Positives = 213/313 (68%), Gaps = 1/313 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I  + +  D++F + +EAQ RG++++ YTPD+L   D +++A  QP+ +
Sbjct: 1   MSLRVAVQMDPILGINIDTDTSFLMMMEAQSRGHKLWFYTPDKLSQEDGRVFARAQPVEV 60

Query: 63  DEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
              K  +  LGE  ++D+   +DV+L+RQDPPF+M YIT+T+ LEK++P TL+VNNP  +
Sbjct: 61  FADKGAHARLGETVMLDMKDDIDVVLMRQDPPFDMAYITATHFLEKVHPHTLVVNNPAEV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           RN+PEK+FVT+F  + PPTLI+ D   I  F     DI++KPLYG GG+GV R+   D N
Sbjct: 121 RNAPEKLFVTDFPGVQPPTLITSDHEAIYDFRARHGDIVLKPLYGGGGSGVARLLADDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
             +L+E+      E ++ Q ++P +  GDKR+LL++G+PVGA+NR+P+    RSN+  GG
Sbjct: 181 LDALLELHAMIGREQVIAQKFVPAVSKGDKRVLLVDGEPVGAINRVPASGQVRSNLRVGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +AE  +LT  DL++CK I   L+ RGL F GIDVIG+Y+TEINVTSPT  +++ R  G N
Sbjct: 241 RAEAVELTARDLELCKIIAPELKRRGLLFVGIDVIGEYLTEINVTSPTGAQQLKRFTGVN 300

Query: 302 VASLFWDGIEKIK 314
            A + W+ IE I+
Sbjct: 301 AAEVLWNRIEDIR 313


>gi|71734441|ref|YP_272781.1| glutathione synthetase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71554994|gb|AAZ34205.1| glutathione synthetase [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 319

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 127/315 (40%), Positives = 185/315 (58%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLYQDAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+D PF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDLPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEKHGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSP  IREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPGGIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D I+K  +
Sbjct: 301 NIGGLLIDAIDKKLQ 315


>gi|238759324|ref|ZP_04620490.1| Glutathione synthetase [Yersinia aldovae ATCC 35236]
 gi|238702485|gb|EEP95036.1| Glutathione synthetase [Yersinia aldovae ATCC 35236]
          Length = 317

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 131/311 (42%), Positives = 200/311 (64%), Gaps = 3/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+DS+FA+ LEAQ RG+++ +     LY+R     A T+ L++ 
Sbjct: 1   MIKLGIVMDPISSINIKKDSSFAMLLEAQQRGWELHYMEMGDLYLRGGDGRARTRLLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           + K+ ++S G E+ I L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R
Sbjct: 61  QDKDDWFSFGTEQDIALHDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR    I +F+ E  DII+KPL G GGT +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRSKDHIRKFHQEHGDIILKPLDGMGGTSIFRVKRDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTELGSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTCIREI       
Sbjct: 241 RGEARPLSESDWKIARAVAPVLKKKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFPDM 300

Query: 301 NVASLFWDGIE 311
           ++  +  D IE
Sbjct: 301 SITGMLMDAIE 311


>gi|37525152|ref|NP_928496.1| glutathione synthetase [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|39931315|sp|Q7M7H8|GSHB_PHOLL RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|36784578|emb|CAE13478.1| glutathione synthase (glutathione synthase) (GSH synthetase)
           (GSH-S) [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 316

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 122/315 (38%), Positives = 194/315 (61%), Gaps = 3/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+ LEAQ R +++ +     LY+   +  A T+ L ++
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLLEAQRRSWELHYMEMSDLYLHQGEARARTRLLQVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              +Q+Y    E+ + L  +DVIL+R+DPPF+  YI +TY+LE+     TLIVN P  +R
Sbjct: 61  NHPQQWYQFDREQDLALETLDVILMRKDPPFDTEYIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL++R+   +  F+ +  D+I KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVTRNAAHLREFHQKHGDVIFKPLDGMGGASIFRLKKDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 GVIIETLTEHGNRFCMAQNFLPAIKEGDKRVLIVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +  +L+E+GL F G+D+IGD +TEINVTSPTC REI       
Sbjct: 241 RGEARPLSESDWAIARAVAPTLQEKGLIFVGLDIIGDKLTEINVTSPTCAREIEAAFPDI 300

Query: 301 NVASLFWDGIEKIKE 315
           ++  +  + IE+  E
Sbjct: 301 SITGMLMNAIEERLE 315


>gi|113969033|ref|YP_732826.1| glutathione synthetase [Shewanella sp. MR-4]
 gi|113883717|gb|ABI37769.1| glutathione synthase [Shewanella sp. MR-4]
          Length = 315

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 193/310 (62%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+     L M +     N +PL + 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLMAAQERGYQLFYMEMADLAMVNGVAMGNMRPLQVI 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
               +++ LGE +   LS+++V+L+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  NDANKWFELGEAQDTPLSELNVVLMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDANRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L +   +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTQYGNQYAMAQAFIPEITKGDKRILVVDGEPVPYALARIPKKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+  D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVAQPLSDSDWKIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD 300

Query: 302 VASLFWDGIE 311
           +  + +D IE
Sbjct: 301 ITGMLFDAIE 310


>gi|198246039|ref|YP_002217070.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|197940555|gb|ACH77888.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|326624842|gb|EGE31187.1| glutathione synthase [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 315

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 201/310 (64%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIAHINIKKDTSFAMLLEAQRRGYELHYMEMANLYLINGEARARTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGSEQEIKLADLDVILMRKDPPFDTEFIYATYILERAEEEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFADLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKEGDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|16761870|ref|NP_457487.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29143357|ref|NP_806699.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|213163040|ref|ZP_03348750.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213417361|ref|ZP_03350503.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. E01-6750]
 gi|213424111|ref|ZP_03357004.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213580647|ref|ZP_03362473.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
 gi|213648201|ref|ZP_03378254.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
 gi|213850165|ref|ZP_03381063.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|289828648|ref|ZP_06546458.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|20138177|sp|P58581|GSHB_SALTI RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|25293533|pir||AG0877 glutathione synthetase [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504172|emb|CAD02919.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29138991|gb|AAO70559.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
          Length = 315

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 201/310 (64%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RGY++ +     LY+ + +  A T+ LS++
Sbjct: 1   MIKLGIVMDPIAHINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEARACTRTLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGSEQEIKLADLDVILMRKDPPFDTEFIYATYILERAEEEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFADLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKEGDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|229593124|ref|YP_002875243.1| glutathione synthetase [Pseudomonas fluorescens SBW25]
 gi|229364990|emb|CAY53125.1| glutathione synthetase [Pseudomonas fluorescens SBW25]
          Length = 317

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 132/315 (41%), Positives = 194/315 (61%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY  D +  A  +PL +
Sbjct: 1   MSVRVGIVMDPIASISYKKDSSLAMLLAAQARGWTLFYMEQRDLYQGDGEARARMRPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
               E+++ L +E    LS +DVIL+R+DPPF+M ++ STYLLE+      LIVN P  +
Sbjct: 61  FANPEKWFELSDEIDSPLSDLDVILMRKDPPFDMEFVYSTYLLEQAERAGVLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPT++SR    +  F  +  D+I+KPL G GGT +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTVVSRRADVLREFAAKHGDVILKPLDGMGGTSIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTALGTQQIMGQAYLPAIKDGDKRILMIDGEPVDYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I  ++G +LRE+GL F G+DVIG+ +TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAAQVGPTLREKGLLFVGLDVIGENLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  +    IE+  +
Sbjct: 301 NIGEMLMAAIERKLQ 315


>gi|319427611|gb|ADV55685.1| glutathione synthetase, GshB [Shewanella putrefaciens 200]
          Length = 317

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 129/314 (41%), Positives = 192/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+     L M +    AN +PL++ 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLMAAQERGYQLFYMEMADLAMVNGVAMANMRPLTVF 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
               +++ LGE     +S++DVIL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  NDASKWFELGEATDTPMSELDVILMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDAKRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTSYGQQYAMAQAFIPEITQGDKRILVVDGEPVPYALARIPMKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+  D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVAQPLSDSDWAIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD 300

Query: 302 VASLFWDGIEKIKE 315
           +     D IE   +
Sbjct: 301 ITGRLMDAIEARVK 314


>gi|163749087|ref|ZP_02156337.1| glutathione synthetase [Shewanella benthica KT99]
 gi|161331157|gb|EDQ02046.1| glutathione synthetase [Shewanella benthica KT99]
          Length = 317

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 198/314 (63%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + + +DS+FA+ L AQ RGYQ+F+     L M + K  AN + L++ 
Sbjct: 1   MIKLGIVMDPISDININKDSSFAMLLAAQSRGYQLFYMEMRDLAMVNGKAMANMRALTVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  + ++ LGE     +S +DV+L+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QDPDNWFELGEAIDTPMSDLDVVLMRKDPPFDTEFIYATYMLERAEEEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD T+I  FY E  DII+KPL G GG+ +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPDTIVTRDETRIRNFYQEKGDIILKPLDGMGGSSIFRVKKDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L +   +  MIQ+++P I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTDNGQQYAMIQAFIPDITSGDKRILVIDGEPVPYSLARIPKKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +     L++ D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCI+EI      +
Sbjct: 241 RGVAQPLSESDWHIARSIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAYDVD 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARIK 314


>gi|120597612|ref|YP_962186.1| glutathione synthetase [Shewanella sp. W3-18-1]
 gi|146294249|ref|YP_001184673.1| glutathione synthetase [Shewanella putrefaciens CN-32]
 gi|120557705|gb|ABM23632.1| glutathione synthase [Shewanella sp. W3-18-1]
 gi|145565939|gb|ABP76874.1| glutathione synthase [Shewanella putrefaciens CN-32]
          Length = 317

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 129/314 (41%), Positives = 193/314 (61%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+     L M +    AN +PL++ 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLMAAQERGYQLFYMEMADLAMVNGVAMANMRPLTVF 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
               +++ LGE     +S++DVIL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  NDASKWFELGEATDTPMSELDVILMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDAKRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTSYGQQYAMAQAFIPEITQGDKRILVVDGEPVPYALARIPMKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+  D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVAQPLSDSDWAIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARVK 314


>gi|62181605|ref|YP_218022.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62129238|gb|AAX66941.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322716088|gb|EFZ07659.1| glutathione synthetase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 315

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 126/310 (40%), Positives = 200/310 (64%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RGY++ +     LY+ + +  A T+ L+++
Sbjct: 1   MIKLGIVMDPIAHINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLNVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y  G E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFGSEQEIKLADLDVILMRKDPPFDTEFIYATYILERAEEEGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   F++L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFADLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKEGDPNI 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G  L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPMLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|315121861|ref|YP_004062350.1| glutathione synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495263|gb|ADR51862.1| glutathione synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 319

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 250/315 (79%), Positives = 288/315 (91%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI NIAIQM+HIST+  KEDSTFAIALEAQ+RG QIFHYTPDQL++R++KIYA  +PL
Sbjct: 1   MIKISNIAIQMDHISTINPKEDSTFAIALEAQIRGSQIFHYTPDQLFIRENKIYAYVEPL 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + +E YYSL E+++++LSQMDVILIRQ+PPFNMHYIT+TYLLEKIN +TLI+NNPFW
Sbjct: 61  FLYDNQENYYSLREKQLVNLSQMDVILIRQNPPFNMHYITNTYLLEKINSKTLILNNPFW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IRNSPEKIFVTEFSELMPPTLISRDI QIT+FYLEMKDIIIKPLYGNGG GVFRIT  DR
Sbjct: 121 IRNSPEKIFVTEFSELMPPTLISRDIPQITKFYLEMKDIIIKPLYGNGGNGVFRITPEDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           NFSSLIE+LF+KYPEPL+IQSYLPQ+R+GDKRILLL+GKPVGA+NRIPSE DNRSNIHAG
Sbjct: 181 NFSSLIEILFDKYPEPLIIQSYLPQVRNGDKRILLLDGKPVGAINRIPSEKDNRSNIHAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           GKAELT+LT  + DIC RIG SL+ERGLFFTGIDVIG+YITEINVTSPTCIREI+++GG 
Sbjct: 241 GKAELTELTNREKDICHRIGPSLQERGLFFTGIDVIGNYITEINVTSPTCIREIYKHGGN 300

Query: 301 NVASLFWDGIEKIKE 315
           N+ASLFWD +E+  +
Sbjct: 301 NIASLFWDAVEEKVQ 315


>gi|295691354|ref|YP_003595047.1| glutathione synthetase [Caulobacter segnis ATCC 21756]
 gi|295433257|gb|ADG12429.1| glutathione synthetase [Caulobacter segnis ATCC 21756]
          Length = 317

 Score =  300 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 144/313 (46%), Positives = 218/313 (69%), Gaps = 1/313 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ +  + +  D+TF + +EAQ RG++++ YTPD+L + D +++A  QPL +
Sbjct: 1   MSLRVAVQMDPVLGINIDTDTTFLMMMEAQTRGHRLWFYTPDKLSLEDGRVFARAQPLEV 60

Query: 63  DEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
             +K  +  LGE  ++D+   +DV+L+RQDPPF+M YIT+T+ LEK++P TL+VNNP  +
Sbjct: 61  FAEKGAHAKLGEPVLLDMKDDVDVVLMRQDPPFDMAYITATHFLEKVHPHTLVVNNPAEV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           RN+PEK+FVT+F  + PPTLI+ D   I  F     DI++KPLYG GG+GV R+   D N
Sbjct: 121 RNAPEKLFVTDFPGVQPPTLITSDHEAIYDFRARHGDIVLKPLYGGGGSGVARLLKDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
             +L+E+      E ++ Q ++P +  GDKR+LL++G+PVGA+NR+P++   RSN+  GG
Sbjct: 181 LDALLELHAMIGREQVIAQKFVPAVSKGDKRVLLVDGEPVGAINRVPADGQVRSNLRVGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +AE  +LT  D+++CK IG  L+ RGL F GIDVIG+Y+TEINVTSPT  +++ R  G N
Sbjct: 241 RAEAVELTARDIELCKIIGPELKRRGLIFVGIDVIGEYLTEINVTSPTGAQQLLRFSGVN 300

Query: 302 VASLFWDGIEKIK 314
            A++ WD IE I+
Sbjct: 301 AAAVLWDRIEDIR 313


>gi|114561728|ref|YP_749241.1| glutathione synthetase [Shewanella frigidimarina NCIMB 400]
 gi|114333021|gb|ABI70403.1| glutathione synthase [Shewanella frigidimarina NCIMB 400]
          Length = 317

 Score =  300 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 131/310 (42%), Positives = 197/310 (63%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ L+AQ RGYQ+F+     L M + K  A  + LS+ 
Sbjct: 1   MIKLGIVMDPISDINIKKDSSFAMLLDAQARGYQLFYMEMHDLAMVNGKAMATMRELSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +Q+++LGE     L+++DVIL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  QDADQWFTLGESVDTPLAELDVILMRKDPPFDTEFIYATYMLERAEEEGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+   +DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDAKRIRAFHQLKQDIILKPLDGMGGTSIFRVKKDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTSYGQQYAMAQAFIPEITQGDKRILVVDGEPVPYALARIPMKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L++ D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCI+EI      N
Sbjct: 241 SGVAQPLSESDWKIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAFDVN 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|78486166|ref|YP_392091.1| glutathione synthetase [Thiomicrospira crunogena XCL-2]
 gi|78364452|gb|ABB42417.1| glutathione synthase [Thiomicrospira crunogena XCL-2]
          Length = 321

 Score =  300 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 132/316 (41%), Positives = 204/316 (64%), Gaps = 7/316 (2%)

Query: 6   NIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEK 65
            + I M+ I+ +K  +DS+FA+ LEAQ RG+++F+  P+ +++R+ + YA    L + ++
Sbjct: 5   KVGIVMDPIAEIKPYKDSSFAMLLEAQRRGHELFYMQPEDIFLRNGQPYATVSELKVWDR 64

Query: 66  KE-----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPF 119
            +     Q+Y  G    + LS +D+ILIRQDPPFN  Y+ +T++LE       L+VN P 
Sbjct: 65  AQSDTTSQFYGFGASYDVALSSLDIILIRQDPPFNNDYLYATHMLELAEAEGALVVNKPQ 124

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R++ EK+F + F   +PPTL+S + TQ+  F    +D+I+KPL   GG  +FR+   D
Sbjct: 125 SLRDANEKLFASWFPNCIPPTLVSANATQLKTFIETHQDVILKPLDAMGGASIFRVKQND 184

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N + +IE + +     +M Q YLP+I+ GDKRILL+NG+PV   + RIP+E + R NI 
Sbjct: 185 PNINVIIETMTDHGQHHIMAQIYLPEIKQGDKRILLINGEPVPYALARIPAEGETRGNIA 244

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGGK    +L++ DL +C++I  +L+ +GL F G+DVIGDYITEINVTSPTCIRE+    
Sbjct: 245 AGGKGIGIELSERDLWLCEQIAPTLQRKGLHFVGLDVIGDYITEINVTSPTCIRELDAQY 304

Query: 299 GENVASLFWDGIEKIK 314
             N+A   +D +E ++
Sbjct: 305 KLNIAGQLFDHLESLR 320


>gi|238754606|ref|ZP_04615960.1| Glutathione synthetase [Yersinia ruckeri ATCC 29473]
 gi|238707237|gb|EEP99600.1| Glutathione synthetase [Yersinia ruckeri ATCC 29473]
          Length = 319

 Score =  300 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 128/312 (41%), Positives = 198/312 (63%), Gaps = 3/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+ +EAQ RGY++ +   + LY+   +  A T+ L++ 
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLMEAQRRGYELHYMEMNDLYLHAGEGRARTRLLTVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           E    ++S G E+ + L  ++VIL+R+DPPF+  +I +TY+LE+     TL+VN P  +R
Sbjct: 61  EDYNAWFSFGTEQDLPLDDLNVILMRKDPPFDTEFIYATYILERAEIKGTLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F EL P TL+SR+   I +F+ +  DII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPELTPDTLVSRNKDLIRKFHQQHGDIILKPLDGMGGASIFRVKKDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I +GDKRIL+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 SVIIETLTEHGSRFCMAQNFLPAITEGDKRILVVDGEPVPYCLARIPAQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   L++ D  I + +  +L+E+GL F G+D+IGD +TEINVTSPTC REI       
Sbjct: 241 RGEARPLSESDWKIARAVAPTLKEKGLIFVGLDIIGDRLTEINVTSPTCAREIEAAFPQV 300

Query: 301 NVASLFWDGIEK 312
           +V  +  D IEK
Sbjct: 301 SVTGMLMDAIEK 312


>gi|146337347|ref|YP_001202395.1| glutathione synthetase [Bradyrhizobium sp. ORS278]
 gi|146190153|emb|CAL74145.1| glutathione synthetase [Bradyrhizobium sp. ORS278]
          Length = 313

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 150/313 (47%), Positives = 221/313 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+A+QM+ I+ + ++ DSTFA+ LEAQ RG+ + +YTPD+L +R  ++YA  Q L++
Sbjct: 1   MKLNVAVQMDPIARINIRGDSTFAMLLEAQRRGHGLCYYTPDKLSLRGEELYAPVQALTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++   +++LGE K   L+  DV+L+RQDPPF++ YITST+ LE+I+P+TL+VN+P  +R
Sbjct: 61  RDEVGDHFTLGEPKPTALTSFDVVLLRQDPPFDLAYITSTHFLERIHPKTLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV  F +LMPPTLISRD+ +I  F  +   +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMNFPQLMPPTLISRDLDEINAFRDQHGAVVMKPLHGHGGAAVFRVMPQDMNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLFDMFSVTFKEPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAADDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A+ T L+  + +IC  +G  LR+RGL   GIDVI   +TEINVTSPT IR I R GG ++
Sbjct: 241 AQATDLSAREREICDTLGPELRKRGLLLVGIDVIDGNLTEINVTSPTGIRAISRLGGPDI 300

Query: 303 ASLFWDGIEKIKE 315
           A+  WD IE  + 
Sbjct: 301 AARVWDVIEAKRR 313


>gi|146305442|ref|YP_001185907.1| glutathione synthetase [Pseudomonas mendocina ymp]
 gi|145573643|gb|ABP83175.1| glutathione synthase [Pseudomonas mendocina ymp]
          Length = 318

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 127/314 (40%), Positives = 195/314 (62%), Gaps = 2/314 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSLRLGIVMDPIASISFKKDSSLAMLLAAQARGWSLFYMEQQDLYQVRGQARARMRPLEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
               +++++L  E+   L+++DVIL+R+DPPF+  ++ STYLLE+      L+VN P  +
Sbjct: 61  FNDPQRWFALDAEQDTPLAELDVILMRKDPPFDNEFVYSTYLLEQAERDGVLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK F T+F    PPTL++R    + +F  E +DII+KPL G GG+ +FR   GD N
Sbjct: 121 RDCNEKFFATQFPRYTPPTLVTRRPDIVRQFADEHRDIILKPLDGMGGSQIFRHREGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M+Q+YLP I+DGDKRIL+++G+P+     RIP+  + R N+ AG
Sbjct: 181 LSVILEALTLHGRQQIMVQAYLPAIKDGDKRILMIDGEPIPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT+ D +I   +G +LRE+GL F G+DVIGD++TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLTERDREIAAAVGPTLREKGLIFVGLDVIGDHLTEINVTSPTCIREIDAAFDA 300

Query: 301 NVASLFWDGIEKIK 314
            +     D I + +
Sbjct: 301 RIGERLMDCIARKR 314


>gi|330812354|ref|YP_004356816.1| glutathione synthetase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380462|gb|AEA71812.1| glutathione synthetase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 317

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 195/315 (61%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+++F+     LY  + +  A  +PL +
Sbjct: 1   MSVRVGIVMDPIASISYKKDSSLAMLLAAQKRGWELFYMEQRDLYQAEGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
               E+++ LG E    LS +DVIL+R+DPPF+M ++ STYLLE+      L+VN P  +
Sbjct: 61  FANPEKWFELGTESDALLSDLDVILMRKDPPFDMEFVYSTYLLEQAENAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPT++SR    +  F     D+I+KPL G GG+ +FR T G  N
Sbjct: 121 RDCNEKLFATLFPQCTPPTIVSRRPDVLREFADHHGDVILKPLDGMGGSSIFRHTAGHPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +MIQ YLP I DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTLHGKQQIMIQGYLPAIVDGDKRILMIDGEPVDYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT  D  I  ++G +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLTDKDRWIAAQVGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++  +  D I++  +
Sbjct: 301 DIGGMLMDAIDQKLK 315


>gi|330961160|gb|EGH61420.1| glutathione synthetase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 319

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 186/315 (59%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG+ +F+     LY    +     +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLYQNAGQARGRMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEIDAGLDDLDVILMRKDPPFDMEFVYTTYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEQQGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLTDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D I K  +
Sbjct: 301 NIGGLLMDAIGKKLQ 315


>gi|319403654|emb|CBI77239.1| glutathione synthetase [Bartonella rochalimae ATCC BAA-1498]
          Length = 312

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 180/307 (58%), Positives = 237/307 (77%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IAIQM+HI+ +K++ D+TFA+AL AQ RG+ +FHYTPD L++RD  + A  +PL++ +
Sbjct: 1   MKIAIQMDHIAMIKIRGDTTFALALAAQERGHSLFHYTPDSLFIRDGCVIAQLEPLTVRD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           ++  +Y LGE    +L  MDV+L+RQDPPF+MHYIT+T+ LE+I+P+TL+VN+P W+RNS
Sbjct: 61  EEGSHYQLGESVRTELMDMDVVLLRQDPPFDMHYITTTHFLERIHPKTLVVNDPMWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEKIFVTEF +LMP T+I++DI +I  F     DII+KPLYGNGG GVF +   DRNF+S
Sbjct: 121 PEKIFVTEFFDLMPETIITKDIEEIKAFRSRFGDIILKPLYGNGGAGVFHLKHDDRNFAS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L+EM  + Y EP ++Q YL  +R GDKRI+LL+G+PVGA+NRIP+  D RSNIH GG  E
Sbjct: 181 LVEMFEKSYKEPFIVQRYLEGVRRGDKRIILLDGEPVGAINRIPTATDVRSNIHVGGHVE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ D +IC RIG SL++RGL   GIDVIGDYITEINVTSPT +REI R GG ++AS
Sbjct: 241 YIGLTERDYEICARIGPSLKKRGLLLVGIDVIGDYITEINVTSPTGVREIKRFGGADIAS 300

Query: 305 LFWDGIE 311
           LFWD +E
Sbjct: 301 LFWDIVE 307


>gi|148251798|ref|YP_001236383.1| glutathione synthetase [Bradyrhizobium sp. BTAi1]
 gi|146403971|gb|ABQ32477.1| glutathione synthase [Bradyrhizobium sp. BTAi1]
          Length = 313

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 149/313 (47%), Positives = 220/313 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+A+QM+ I+ + ++ DSTFA+ LEAQ RG+ + +YTPD+L +R  ++YA  Q L++
Sbjct: 1   MKLNVAVQMDPIARINIRGDSTFALLLEAQRRGHGLSYYTPDKLSLRGEELYAPVQALAV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++   +++L E K   L+  DV+L+RQDPPF++ YITST+ LE+I+P+TL+VN+P  +R
Sbjct: 61  RDEIGDHFTLSEPKPTALASFDVVLLRQDPPFDLAYITSTHFLERIHPKTLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV  F +LMPPTLISRD+ +I  F  +   +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMNFPQLMPPTLISRDLDEINAFRAQHGAVVMKPLHGHGGAAVFRVMPQDMNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLFDMFSVTFKEPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAADDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A+ T+L+  + +IC  +G  LR RGL   GIDVI   +TEINVTSPT IR I R GG ++
Sbjct: 241 AQATELSPREREICDTLGPELRARGLLLVGIDVIDGNLTEINVTSPTGIRAISRLGGPDI 300

Query: 303 ASLFWDGIEKIKE 315
           A+  WD IE  + 
Sbjct: 301 AARVWDVIEAKRR 313


>gi|121602356|ref|YP_989481.1| glutathione synthetase [Bartonella bacilliformis KC583]
 gi|120614533|gb|ABM45134.1| glutathione synthase [Bartonella bacilliformis KC583]
          Length = 312

 Score =  298 bits (764), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 185/311 (59%), Positives = 240/311 (77%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA QM+HIST++++ D+TFA+AL AQ RG+ +FHYTPD+L M +  I A  +PL++ +
Sbjct: 1   MKIAFQMDHISTIQIQGDTTFALALAAQERGHHLFHYTPDRLSMHNGCIIAWLEPLTVHD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           K+  +Y LG+    +L  MDV+L+RQDPPF+MHYIT+T+LLE+I+P+ L+VN+P W+RNS
Sbjct: 61  KEGDHYQLGKPVRTELMDMDVVLLRQDPPFDMHYITTTHLLERIHPKILVVNDPVWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEKIFVTEFS+LMP TLI++DI ++  F   + DIIIKPLYGNGG GVF +   DRN +S
Sbjct: 121 PEKIFVTEFSDLMPETLITKDIEEVKAFRTTVGDIIIKPLYGNGGAGVFHLKQDDRNLTS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L+EM  + Y EP ++Q YL  +R GDKRI+LL+G PVGA+NR+P+E D RSN+H GG+AE
Sbjct: 181 LLEMFEKSYREPFIVQRYLDGVRKGDKRIILLDGMPVGAINRVPAETDVRSNMHVGGRAE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
            T LT+ D +IC RIG  LRERG F  GIDVIGDYITEINVTSPT IREI R GG ++AS
Sbjct: 241 NTDLTERDHEICARIGSVLRERGFFLVGIDVIGDYITEINVTSPTGIREIKRFGGADIAS 300

Query: 305 LFWDGIEKIKE 315
           LFWD IE  + 
Sbjct: 301 LFWDIIESKRS 311


>gi|220936066|ref|YP_002514965.1| glutathione synthetase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997376|gb|ACL73978.1| glutathione synthetase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 310

 Score =  298 bits (764), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 127/307 (41%), Positives = 200/307 (65%), Gaps = 2/307 (0%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+ I+ + +K+DSTFA+ L A+ RG+ +F+     L++ + +++A  + L + ++   ++
Sbjct: 1   MDPIAHINIKKDSTFAMLLAARRRGWPVFYMEQQDLWLAEGRVHARMRALEVRDQAVDWF 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRNSPEKIF 129
           +LGE     L+++D +L+R+DPPF+M Y+ STYLLE       L+VN P  +R++ EK+F
Sbjct: 61  TLGEAMERPLAELDAVLMRKDPPFDMEYLYSTYLLELAEREGCLVVNRPRSLRDANEKLF 120

Query: 130 VTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEML 189
              F +  P T++SRD+ ++ RF  E +DI++KPL G GG  VFRI  GD N   ++E +
Sbjct: 121 TAWFPQCCPETVVSRDMARLRRFLGEQQDIVVKPLDGMGGASVFRIRQGDPNTGVILETI 180

Query: 190 FEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGKAELTKL 248
            +     +M Q +LP+  +GDKRILL++G+PV   + RIP+  + R+N+ AGG+ E   L
Sbjct: 181 TQHGKRTVMAQRFLPEYVEGDKRILLVDGEPVPYALARIPASGEARANLAAGGRGEGVPL 240

Query: 249 TKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWD 308
           T+ D  IC+++  +LRERGL F G+DVIGDY+TEINVTSPTCIRE+    G ++     D
Sbjct: 241 TERDRWICQQVAPALRERGLLFVGLDVIGDYLTEINVTSPTCIRELDAQYGLDIGGQLMD 300

Query: 309 GIEKIKE 315
            I +  E
Sbjct: 301 AIARHLE 307


>gi|119773712|ref|YP_926452.1| glutathione synthetase [Shewanella amazonensis SB2B]
 gi|119766212|gb|ABL98782.1| glutathione synthase [Shewanella amazonensis SB2B]
          Length = 316

 Score =  298 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 126/310 (40%), Positives = 187/310 (60%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGY++F+     L M   +  A   PL + 
Sbjct: 1   MIKLGIVMDPISDINIKKDSSFAMLMAAQSRGYELFYMEMQDLAMVKGEARARMHPLKVM 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIR 122
           +  + ++ LG+     L+++DVIL+R+DPPF+  YI +TY+LE+      LIVN P  +R
Sbjct: 61  QNADCWFELGDAVEQPLAELDVILMRKDPPFDTEYIYATYMLERAEEAGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+ E  DII+KPL G GG  +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPLTMVTRDAGRIREFHAEHGDIILKPLDGMGGASIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L        M Q ++P+I  GDKRIL+++G+PV     RIP + + R N+ AGG
Sbjct: 181 GVIIETLTNHGNCYAMAQVFIPEITAGDKRILVVDGEPVPYCLARIPKQGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +     L+  D  I K +G  L+ RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 RGVAQPLSDADWRIAKALGPELKRRGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDVD 300

Query: 302 VASLFWDGIE 311
           +  +  + IE
Sbjct: 301 ITGMLMNAIE 310


>gi|152983841|ref|YP_001345902.1| glutathione synthetase [Pseudomonas aeruginosa PA7]
 gi|150958999|gb|ABR81024.1| glutathione synthase [Pseudomonas aeruginosa PA7]
          Length = 317

 Score =  298 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 126/310 (40%), Positives = 185/310 (59%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+ +  K+DS+ A+ L AQ RG+ +F+     LY +        +PL +
Sbjct: 1   MSVRLGIVMDPIARINFKKDSSLAMLLAAQARGWSLFYMEQQDLYQKAGVARGRMRPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++ L  E    L ++DVIL+R+DPPF+  ++ STYLLE+      L+VN P  +
Sbjct: 61  FNDASRWFELEAESDQPLHELDVILMRKDPPFDNEFVYSTYLLEQAERAGALVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK F T+F++  PPT++SR    +  F  E +DII+KPL G GG+ +FR   GD N
Sbjct: 121 RDCNEKFFATQFTQCTPPTMVSRRSDILREFAAEHRDIILKPLDGMGGSSIFRHREGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YLP+I+DGDKRIL+++G+ V     RIP++ + R N+ AG
Sbjct: 181 LSVILETLTRHGSQQIMAQRYLPEIKDGDKRILMIDGEAVPYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L++ D  I   +G  LRERGL F G+DVIGDY+TEINVTSPTCIREI +    
Sbjct: 241 GRGVAQPLSERDRWIAAEVGPHLRERGLLFVGLDVIGDYLTEINVTSPTCIREIDQAFDT 300

Query: 301 NVASLFWDGI 310
            +     D I
Sbjct: 301 RIGDKLMDAI 310


>gi|197284241|ref|YP_002150113.1| glutathione synthetase [Proteus mirabilis HI4320]
 gi|227357856|ref|ZP_03842204.1| glutathione synthetase [Proteus mirabilis ATCC 29906]
 gi|194681728|emb|CAR40883.1| glutathione synthetase [Proteus mirabilis HI4320]
 gi|227161966|gb|EEI46984.1| glutathione synthetase [Proteus mirabilis ATCC 29906]
          Length = 318

 Score =  298 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 199/311 (63%), Gaps = 3/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++K+K+D++FA+ LEAQ RG++I +   + LY+   +  A+T+ LS++
Sbjct: 1   MIKLGIVMDPISSIKIKKDTSFAMLLEAQRRGWEIHYMEMNDLYLNQGEARAHTRLLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E  E+++  G+E+ I L  +D IL+R+DPPF+  +I +TY+LE+  +  TLIVN P  +R
Sbjct: 61  ENPEKWFEFGQEQDIALGSLDTILMRKDPPFDTEFIYATYILERAEDMGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F  L P TL++R+   +  F+ +  D+I KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPSLTPNTLVTREAKHLRAFHEKHGDVIFKPLDGMGGASIFRLKKDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L E      M Q++LP+I DGDKRIL+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 GVIIETLTEHGHRFCMAQNFLPEIVDGDKRILVVDGEPVPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D  I +++   L+++GL F G+DVIGD +TEINVTSPTC REI       
Sbjct: 241 RGEARPLTESDWAIARQVAPILKQKGLIFVGLDVIGDRLTEINVTSPTCAREIEAAYPEV 300

Query: 301 NVASLFWDGIE 311
           ++  +  D IE
Sbjct: 301 SITGMLMDAIE 311


>gi|319406572|emb|CBI80214.1| glutathione synthetase [Bartonella sp. 1-1C]
          Length = 312

 Score =  298 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 179/307 (58%), Positives = 236/307 (76%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IAIQM+HI+T++++ D+TFA+AL AQ RG+ +FHYTPD L++RD  + A  +PL++ +
Sbjct: 1   MKIAIQMDHIATIEIRGDTTFALALAAQERGHSLFHYTPDSLFIRDGCVIAQLEPLTVRD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           ++  +Y LGE    +L  MDV+L+RQDPPF+M+YIT+T+ LE+I+P+TL+VN+P W+RNS
Sbjct: 61  EEGSHYQLGESVRTELIDMDVVLLRQDPPFDMNYITTTHFLERIHPKTLVVNDPMWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEKIFVTEF +LMP T+I++DI +I  F     DII KPLYGNGG GVF +   D NF+S
Sbjct: 121 PEKIFVTEFFDLMPETIITKDIEEIKAFRSRFGDIIFKPLYGNGGAGVFYLKHDDCNFAS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           LIEM  + Y EP ++Q YL  +R GDKRI+LL+G+PVGA+NRIP+  D RSNIH GG  E
Sbjct: 181 LIEMFEKSYKEPFIVQRYLEGVRRGDKRIILLDGEPVGAINRIPTATDVRSNIHVGGHVE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ D +IC RIG SL++RGL   GIDVIGDYITEINVTSPT +REI R GG ++AS
Sbjct: 241 YIGLTERDYEICARIGPSLKKRGLLLVGIDVIGDYITEINVTSPTGVREIKRFGGADIAS 300

Query: 305 LFWDGIE 311
           LFWD +E
Sbjct: 301 LFWDIVE 307


>gi|254500980|ref|ZP_05113131.1| glutathione synthase [Labrenzia alexandrii DFL-11]
 gi|222437051|gb|EEE43730.1| glutathione synthase [Labrenzia alexandrii DFL-11]
          Length = 314

 Score =  298 bits (763), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 149/313 (47%), Positives = 225/313 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HI ++ +  DS FA+ LEAQ RG++++HYTPD+L +R  +++   +P+++
Sbjct: 1   MPIKVAVQMDHIESINIAGDSAFAMMLEAQKRGHELYHYTPDRLALRGDEVFCALEPVTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++K  +++LGE    D+ ++DV+L+RQDPPF++ YI +T++L+KI+P+TL+VN+P  +R
Sbjct: 61  RDEKGNHFTLGERTRTDMREIDVVLMRQDPPFDLSYIAATHILDKIHPDTLVVNDPTEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FVTEF +LMPPTLI++D  +I  F  E  DI++KPL+G+GG  VFRIT  D N+
Sbjct: 121 NAPEKLFVTEFPDLMPPTLITKDRAEIDLFREEYGDIVMKPLFGHGGAAVFRITKDDLNY 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +     + EP +IQ +LP ++ GDKRILL+NG+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLYDFFAATFREPWVIQQFLPNVKHGDKRILLVNGEFAGAVNRVPAAGDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
              + LT+ + +IC R+G SLRE+GL   GIDVI   +TEINVT+PT IR I   GG +V
Sbjct: 241 PTDSDLTEREREICARLGPSLREKGLILVGIDVIDGMLTEINVTAPTGIRAIQNLGGPDV 300

Query: 303 ASLFWDGIEKIKE 315
           A+  WD +E+  +
Sbjct: 301 AAKVWDVLEQKIK 313


>gi|328541660|ref|YP_004301769.1| glutathione synthetase protein [polymorphum gilvum SL003B-26A1]
 gi|326411412|gb|ADZ68475.1| Glutathione synthetase protein [Polymorphum gilvum SL003B-26A1]
          Length = 314

 Score =  298 bits (763), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 155/313 (49%), Positives = 226/313 (72%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+HIS++ +  DS FA+ LEAQ RG+ +FHYTPD+L +    ++A  +P+ +
Sbjct: 1   MTLKVAVQMDHISSINIAGDSAFALMLEAQARGHALFHYTPDRLALVGGSVFARLEPVQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++K  ++SLGE +  DL+++DVIL+RQDPPF+M Y+ +T+LLEKI+P TL+VN+P  +R
Sbjct: 61  RDEKGNHFSLGEARRTDLAEIDVILMRQDPPFDMAYVAATHLLEKIHPATLVVNDPLHVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FVTEF++LMPPTLI+RD  +I  F  E +DI++KPL+G+GG  VFRIT  D N+
Sbjct: 121 NAPEKLFVTEFADLMPPTLITRDRAEIDAFRAEHRDIVMKPLFGHGGAAVFRITEDDLNY 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +     + EP +IQ +LP +R GDKRILL++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLYDFFAATFREPWVIQRFLPNVRHGDKRILLVDGEFAGAVNRVPAPGDLRSNMVRGGS 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
              ++L+  +  IC R+G +LRE+GL   GIDVI  Y+TEINVT+PT IR + R GG ++
Sbjct: 241 PAESELSDRERAICARLGPALREKGLILVGIDVIDGYLTEINVTAPTGIRAVRRLGGPDI 300

Query: 303 ASLFWDGIEKIKE 315
           A+  W+ IE  + 
Sbjct: 301 AARVWEVIEAKRR 313


>gi|121606624|ref|YP_983953.1| glutathione synthetase [Polaromonas naphthalenivorans CJ2]
 gi|120595593|gb|ABM39032.1| glutathione synthase [Polaromonas naphthalenivorans CJ2]
          Length = 317

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 121/311 (38%), Positives = 186/311 (59%), Gaps = 3/311 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQL-YMRDSKIYANTQPLSLD 63
            N+    + + + K+ +D+TFA+  EAQ RG++I       L + R S + A+ + ++L 
Sbjct: 1   MNLLFIADPLESFKIYKDTTFAMMREAQRRGHRISACEQQDLMWQRGSAVMAHVRDITLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
                ++     + + L +   +L+R+DPPF+  Y  +T+LLE+       + N P  +R
Sbjct: 61  GDATDWFKETGTRAVALKEFGAVLMRKDPPFDSEYFYATHLLEQAERDGAKVFNKPRALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF + + PTL++RD   I RF+ E +DII+KPL G GG G+FR+     N 
Sbjct: 121 DHPEKLAIMEFPQFIGPTLVTRDAEDIKRFHAEHQDIILKPLDGMGGMGIFRVGPDGLNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
            S+ E L     + LM+Q +LP+I  GDKR+L++ GKPV   + RIP   + R N+ AGG
Sbjct: 181 GSITETLNRHGAQSLMVQKFLPEIVKGDKRVLVIGGKPVPFSLARIPQGSEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L+  DL+I + +G  L  RGL   G+DVIGDY+TEINVTSPTC +EIH   G +
Sbjct: 241 KGVAQPLSTRDLEIAEALGPILAARGLLLAGVDVIGDYVTEINVTSPTCFQEIHDQMGFD 300

Query: 302 VASLFWDGIEK 312
           VA++F D +E+
Sbjct: 301 VAAMFIDALEQ 311


>gi|311696403|gb|ADP99276.1| glutathione synthetase [marine bacterium HP15]
          Length = 317

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 129/312 (41%), Positives = 191/312 (61%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+ L AQ RG++I +     LY+   +  A+T+ L++
Sbjct: 1   MTVRLGIVMDPIEDIHFKKDSSLAMLLAAQKRGWEIEYMELPDLYLDGGRAMAHTRDLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW-I 121
               E +Y  G  +   L  +DVIL+R+DPP +  ++ +TY+LE    +  +V NP   +
Sbjct: 61  HMDPENWYGFGPSQDRALGDLDVILMRKDPPVDREFLMATYILEAAEQQGALVVNPASTL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F++L PP L+SR  ++   FY E  D+I+KP+ G GG  +FRI   D N
Sbjct: 121 RDCNEKLFATQFTDLTPPLLVSRSASRFREFYAEHGDVIMKPVDGMGGHSIFRIRENDFN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              +IE L        M Q Y+P+I DGDKRILL++G+PV   + RIPS  +NR N+ AG
Sbjct: 181 LGVIIETLTNYGTHQAMAQKYIPEISDGDKRILLIDGEPVPYSLARIPSHGENRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E  +LT  D +IC+R+   ++E+GL F G+DVIGDY+TEINVTSPTCIRE+    G 
Sbjct: 241 GRGEGRELTARDREICERVAPVIKEKGLIFVGLDVIGDYLTEINVTSPTCIRELDAAFGI 300

Query: 301 NVASLFWDGIEK 312
           ++  L  D I K
Sbjct: 301 DIGGLLMDAIAK 312


>gi|304411142|ref|ZP_07392757.1| glutathione synthetase [Shewanella baltica OS183]
 gi|307306437|ref|ZP_07586180.1| glutathione synthetase [Shewanella baltica BA175]
 gi|304350335|gb|EFM14738.1| glutathione synthetase [Shewanella baltica OS183]
 gi|306910728|gb|EFN41156.1| glutathione synthetase [Shewanella baltica BA175]
          Length = 317

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 129/310 (41%), Positives = 193/310 (62%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGY++F+     L M +    AN +PL++ 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLMAAQDRGYELFYMEMADLAMVNGVAMANMRPLTVI 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
               ++Y LGE +   +S++DVIL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  NDASKWYELGESQDTPMSELDVILMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDAKRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTSYGQQYAMAQAFIPEITKGDKRILVVDGEPVPYALARIPMKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+  D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVAQPLSDSDWAIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|254482711|ref|ZP_05095949.1| glutathione synthase [marine gamma proteobacterium HTCC2148]
 gi|214037070|gb|EEB77739.1| glutathione synthase [marine gamma proteobacterium HTCC2148]
          Length = 318

 Score =  298 bits (762), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 128/310 (41%), Positives = 188/310 (60%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I+ +  K+D+T A+   A  R +Q+F+     LY+RD +  A+  PL++
Sbjct: 1   MTIKLGVVMDPIADINYKKDTTLAMLWAATARDWQLFYMEQKDLYLRDGEARASMSPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            +  + +Y L   +   L+ +DVIL+R+DPPF+  YI STY+LE      +LIVN    +
Sbjct: 61  FQNPDNWYDLKAPQDCSLADLDVILMRKDPPFDNEYIYSTYILEDAERRGSLIVNRCQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+S EK+F T+F +  PP L+SRD+ ++ +F+ E  D+I KPL G GGT +FR    D N
Sbjct: 121 RDSNEKVFATQFPQCCPPVLVSRDMARLRQFHKEHNDVIFKPLDGMGGTAIFRAREDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L E   + +M Q Y+P+I DGDKRIL++NG+ V     RIP   + R N+ AG
Sbjct: 181 VSVILETLTEYGQQSIMAQRYIPEIVDGDKRILVINGEAVPYCLARIPLAGELRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G      LT  D  I +++   LRERG+ F G+DVIG+Y+TEINVTSPTCIREI      
Sbjct: 241 GTGRAQPLTDRDRWIAEQVAPFLRERGILFAGLDVIGEYLTEINVTSPTCIREIDAGYDL 300

Query: 301 NVASLFWDGI 310
           ++A    D I
Sbjct: 301 DIAGDLMDCI 310


>gi|254784482|ref|YP_003071910.1| glutathione synthase [Teredinibacter turnerae T7901]
 gi|237686345|gb|ACR13609.1| glutathione synthase [Teredinibacter turnerae T7901]
          Length = 319

 Score =  298 bits (762), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 128/316 (40%), Positives = 194/316 (61%), Gaps = 2/316 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M     I + M+ IS +  K+D+T A+ L AQ RG+Q+F+     L +      AN   L
Sbjct: 1   MSHTLRIGVVMDPISNISFKKDTTLAMLLAAQERGHQLFYMEIQDLLLDQGSARANMATL 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPF 119
           S+      +++LGE+ ++DLS++DV+L+R+DPPF+  YI +TY+LE+     TLIVN P 
Sbjct: 61  SVANDAANWFTLGEKSLLDLSELDVVLMRKDPPFDNQYIYATYILERAEQQGTLIVNKPQ 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R+  EK+F T+F +  PP  +SRD   +  F+ +  D+I KPL G GG+G+FR    D
Sbjct: 121 SLRDCNEKVFATQFPQCCPPVTVSRDTRLLREFHQQHDDVIFKPLDGMGGSGIFRCRADD 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIH 238
            N S ++E L +     +M Q ++P IR+GDKR+L++NG+P+     RIP+E + R N+ 
Sbjct: 181 PNVSVILETLTDAGASFIMAQKFIPDIRNGDKRVLVVNGEPIPYCLARIPAEGETRGNLA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG      L++ D  I  ++  +L+E+GL F G+D+IGDY+TEINVTSPTC+REI    
Sbjct: 241 AGGSGVAQPLSERDRWIVAQVAPTLKEKGLLFVGLDIIGDYLTEINVTSPTCVREIDAAF 300

Query: 299 GENVASLFWDGIEKIK 314
              +A      IE I+
Sbjct: 301 DTRIAEKLMLAIEGIR 316


>gi|222112421|ref|YP_002554685.1| glutathione synthetase [Acidovorax ebreus TPSY]
 gi|221731865|gb|ACM34685.1| glutathione synthetase [Acidovorax ebreus TPSY]
          Length = 316

 Score =  298 bits (762), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 125/315 (39%), Positives = 188/315 (59%), Gaps = 3/315 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQL-YMRDSKIYANTQPLSLD 63
            N+ I  + I   K+ +D+TFA+  EAQ RG+++    P  + ++R  ++ A  + ++L 
Sbjct: 1   MNLLIVADPIEQFKIYKDTTFAMMREAQRRGHRLAVCEPRHIHWLRGGRVTARVRDITLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              E +++ GE ++  L+    +L+R+DPPF+  Y  +T+LLE+       + N P  +R
Sbjct: 61  GHAENWFTAGELRLAALADFGAVLMRKDPPFDSEYFYATHLLEQAEREGARVFNKPRALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF + + PTL++RD   I RF+ E  DII+KPL G GG G+FR+     N 
Sbjct: 121 DHPEKLAILEFPQFIGPTLVTRDAQDIRRFHEEHHDIILKPLDGMGGMGIFRVGPDGMNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L  +  + +M+Q +LP+I +GDKRIL++ G PV     RIP   + R N+ AGG
Sbjct: 181 GSIIETLNREGSQSVMVQKFLPEIAEGDKRILVIGGTPVPYCLARIPQGSEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 LT  D +I   +G  LRERGL   G+DVIGD +TEINVTSPTC +EI    G +
Sbjct: 241 LGVARPLTARDQEIGAALGSVLRERGLLLAGVDVIGDCVTEINVTSPTCFQEIFDQTGCD 300

Query: 302 VASLFWDGIEKIKET 316
           VA+LF D +E    T
Sbjct: 301 VAALFIDALESALST 315


>gi|70733113|ref|YP_262886.1| glutathione synthetase [Pseudomonas fluorescens Pf-5]
 gi|68347412|gb|AAY95018.1| glutathione synthetase [Pseudomonas fluorescens Pf-5]
          Length = 317

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 128/315 (40%), Positives = 193/315 (61%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY       A  +PL +
Sbjct: 1   MSVRVGIVMDPIASISYKKDSSLAMLLAAQERGWTLFYMEQRDLYQGAGVARARMRPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
               ++++ L  E    LS +DVIL+R+DPPF+M ++ STYLLE+      L+VN P  +
Sbjct: 61  FANPQKWFELDAEIDCPLSDLDVILMRKDPPFDMEFVYSTYLLEQAESAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPT++SR    +  F  +  D+I+KPL G GGT +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTVVSRRADVLREFAAQHGDVILKPLDGMGGTSIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTVLGSQQIMAQAYLPAIKDGDKRILMIDGEPVDYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I  ++G +LR +GL F G+DVIG+++TEINVTSPTCIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAAQVGPTLRAKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+ ++  D I++  +
Sbjct: 301 NIGAMLMDAIDQKLK 315


>gi|238918249|ref|YP_002931763.1| glutathione synthase, [Edwardsiella ictaluri 93-146]
 gi|238867817|gb|ACR67528.1| glutathione synthase, putative [Edwardsiella ictaluri 93-146]
          Length = 316

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 128/310 (41%), Positives = 192/310 (61%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+D++FA+ LEAQ R YQ+ +     LY++  +  A T+ LS+ 
Sbjct: 1   MIKLGIVMDPIASINIKKDTSFAMLLEAQHRDYQLHYMEMSDLYLQQGEARAQTRLLSVS 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIR 122
           + K  +Y    E+ I L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  DDKTSWYRFDGEQDIALADLDVILMRKDPPFDTEFIYATYILERAEARGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R    +  F+    DII+KPL G GG  +FRI   D N 
Sbjct: 121 DCNEKLFTAWFADLTPDTLVTRSAAHLRDFHARHGDIILKPLDGMGGASIFRIQQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q+YLP I DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHGKRFCMAQNYLPAIVDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D  I +++   L+E+GL F G+D+IGD +TEINVTSPTC REI      +
Sbjct: 241 RGEARPLSESDWAIARKVAPMLKEKGLIFVGLDIIGDRLTEINVTSPTCAREIEAAFPVS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|292490367|ref|YP_003525806.1| glutathione synthetase [Nitrosococcus halophilus Nc4]
 gi|291578962|gb|ADE13419.1| glutathione synthetase [Nitrosococcus halophilus Nc4]
          Length = 320

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 200/310 (64%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I+T+ +K+DSTFA+ LEAQ RG+ + +    +LY++D   YA  + L +
Sbjct: 1   MTIRLGVVMDPIATLNIKKDSTFAMLLEAQSRGWTLGYMEQSELYLKDGHAYALLRELMV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            +    +Y LG+   + L+++D+IL+R+DPPF+M Y+ +TYLLE+      L+VN P  +
Sbjct: 61  KDDPASWYQLGQPHPVSLTELDLILMRKDPPFDMEYVYTTYLLERAEQAGVLVVNKPSSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK++   F +  PPTL++R  T +  F  E +DI++KPL   GG  +FR+   D N
Sbjct: 121 RDANEKLYTAWFPQCCPPTLVTRKATLLRDFLAEQQDIVLKPLDTMGGASIFRVRQEDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            + +IE L  +    +M Q YLP+IR GDKRIL+++G+P+   + RIP+  + R N+ AG
Sbjct: 181 LAVIIETLTHQGQRQVMAQRYLPEIRFGDKRILMVDGQPIPYALARIPAPGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  IC+++G +L+ RGL F G+DVIGDY+TEINVTSPTCIRE+    G 
Sbjct: 241 GRGEGIPLSARDYWICEQVGPTLKARGLIFVGLDVIGDYLTEINVTSPTCIRELDALYGL 300

Query: 301 NVASLFWDGI 310
           N+++   D +
Sbjct: 301 NISAQLMDCL 310


>gi|119945033|ref|YP_942713.1| glutathione synthetase [Psychromonas ingrahamii 37]
 gi|119863637|gb|ABM03114.1| glutathione synthase [Psychromonas ingrahamii 37]
          Length = 318

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 127/314 (40%), Positives = 193/314 (61%), Gaps = 2/314 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               I I M+ I  +K+ +DS+FA+ LEAQ RG+++++     L + + + +A+++ L++
Sbjct: 1   MTIKIGIVMDPIKDIKIHKDSSFAMLLEAQSRGWELYYLEMQDLSLENGRCFASSKKLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                 +Y L +     LS +D +L+R+DPPF+  YI +TYLLE+      LIVN P  +
Sbjct: 61  QRDPNNFYQLEDAIDHPLSDLDAVLMRKDPPFDTEYIYATYLLERAEQEGCLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   FSE  P TL++R+  +I  F+ + KD+I+KPL G GG  +FRI   D N
Sbjct: 121 RDANEKLFTAWFSEFTPTTLVTRNSLKIREFHKKHKDVILKPLDGMGGASIFRIKEDDVN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              +IE L E      M Q ++P+I  GDKRIL+++G+P+   + RIP+  + R N+ AG
Sbjct: 181 VGVIIETLTEHQTRYCMAQVFMPEITAGDKRILIIDGEPMPYALARIPALGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L++ D  I   IG  L+E+GL F G+DVIG+ ITEINVTSPTCI+EI    G 
Sbjct: 241 GRGVAQPLSESDWHIANTIGPKLKEKGLIFVGLDVIGNKITEINVTSPTCIQEIDNAYGT 300

Query: 301 NVASLFWDGIEKIK 314
           N+++   D IEK  
Sbjct: 301 NISAKLMDAIEKRI 314


>gi|152999347|ref|YP_001365028.1| glutathione synthetase [Shewanella baltica OS185]
 gi|217972023|ref|YP_002356774.1| glutathione synthetase [Shewanella baltica OS223]
 gi|151363965|gb|ABS06965.1| glutathione synthetase [Shewanella baltica OS185]
 gi|217497158|gb|ACK45351.1| glutathione synthetase [Shewanella baltica OS223]
          Length = 317

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 130/310 (41%), Positives = 193/310 (62%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+     L M +    AN +PL++ 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLMAAQDRGYQLFYMEMADLAMVNGVAMANMRPLTVI 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
               ++Y LGE +   +S++DVIL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  NDASKWYELGESQDTPMSELDVILMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDAKRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTSYGQQYAMAQAFIPEITKGDKRILVVDGEPVPYALARIPMKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+  D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVAQPLSDSDWAIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|330501375|ref|YP_004378244.1| glutathione synthetase [Pseudomonas mendocina NK-01]
 gi|328915661|gb|AEB56492.1| glutathione synthetase [Pseudomonas mendocina NK-01]
          Length = 318

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 196/314 (62%), Gaps = 2/314 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSLRLGIVMDPIASISFKKDSSLAMLLAAQARGWSLFYMEQQDLYQVRGQARARVRPLEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
               +++++LG E+   L+++DVIL+R+DPPF+  ++ STYLLE+      L+VN P  +
Sbjct: 61  FNDPQRWFTLGMEQDTPLAELDVILMRKDPPFDNEFVYSTYLLEQAERDGVLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK F T+F +  PPTL+SR    + +F  E +DII+KPL G GG+ +FR   GD N
Sbjct: 121 RDCNEKFFATQFPQYTPPTLVSRRADIVRQFADEHRDIILKPLDGMGGSQIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M+Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTLHGQQQIMVQAYLPAIKDGDKRILMIDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT+ D +I   +G +LRE+GL F G+DVIGD++TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLTERDREIAAAVGPTLREKGLIFVGLDVIGDHLTEINVTSPTCIREIDAAFDT 300

Query: 301 NVASLFWDGIEKIK 314
            +     D I   +
Sbjct: 301 RIGERLMDCIANKR 314


>gi|159045369|ref|YP_001534163.1| glutathione synthetase [Dinoroseobacter shibae DFL 12]
 gi|157913129|gb|ABV94562.1| glutathione synthetase [Dinoroseobacter shibae DFL 12]
          Length = 315

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 149/312 (47%), Positives = 210/312 (67%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+A QM+ I+ V +  DS+F +A EAQ RG+ +F Y P  L      + A      +
Sbjct: 1   MSLNVAFQMDPITEVDIAADSSFRLAEEAQSRGHSLFVYGPADLTYDRGALKATGHSCRV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
                Q   LG  + +DLS MDV+ +RQDPPF+M YIT+T+LL+ +  +TL+VN+PFW+R
Sbjct: 61  QRVAGQPAILGARETVDLSTMDVVWLRQDPPFDMGYITTTHLLDMVGSQTLVVNDPFWVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+ V +F +L PPT+I+R++  + +F  E  D+I+KPLYGNGG GVFR+T  DRN 
Sbjct: 121 NAPEKLLVLQFPDLTPPTMIARNLDDLKKFKAEFGDVILKPLYGNGGAGVFRLTPEDRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           +SL E+      EPL++Q +LP +  GDKRI+L++G P+GA+NR+P+  + RSN+H GG+
Sbjct: 181 NSLHELFSAINREPLIMQQFLPDVARGDKRIILVDGAPIGAINRVPAAGETRSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT  D +IC RIG  LRE+G  F GIDVIG ++TEINVTSPT ++E+ R  G N 
Sbjct: 241 PEPVTLTDRDREICDRIGPFLREKGQVFVGIDVIGPFLTEINVTSPTGLQELERFDGTNG 300

Query: 303 ASLFWDGIEKIK 314
           A+L WD IE  +
Sbjct: 301 AALIWDAIEARR 312


>gi|226328797|ref|ZP_03804315.1| hypothetical protein PROPEN_02697 [Proteus penneri ATCC 35198]
 gi|225201983|gb|EEG84337.1| hypothetical protein PROPEN_02697 [Proteus penneri ATCC 35198]
          Length = 320

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 200/311 (64%), Gaps = 3/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++K+K+D++FA+ LEAQ RG++I +   + LY+   +  A+T+ LS++
Sbjct: 1   MIKLGIVMDPISSIKIKKDTSFAMLLEAQRRGWEIHYMEMNDLYLHQGEARAHTRLLSVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E  E+++  G+E+ I L ++D IL+R+DPPF+  +I +TY+LE+  +  TLIVN P  +R
Sbjct: 61  ENPEKWFEFGQEQDIALGELDTILMRKDPPFDTEFIYATYILERAEDMGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F  L P TL++R+   +  F+ +  D+I KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFPTLTPDTLVTREAKHLRAFHEKHGDVIFKPLDGMGGASIFRLKKDDPNV 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             +IE L E      M Q++LP+I +GDKRIL+++G+PV     RIP++ + R N+ AGG
Sbjct: 181 GVIIETLTEHGHRFCMAQNFLPEIVNGDKRILVVDGEPVPYCLARIPAKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D  I +++   L+++GL F G+DVIGD +TEINVTSPTC REI       
Sbjct: 241 RGEARPLTESDWAIARQVAPILKQKGLIFVGLDVIGDRLTEINVTSPTCAREIEAAYPDV 300

Query: 301 NVASLFWDGIE 311
           ++  +  D IE
Sbjct: 301 SITGMLMDAIE 311


>gi|121596193|ref|YP_988089.1| glutathione synthetase [Acidovorax sp. JS42]
 gi|120608273|gb|ABM44013.1| glutathione synthase [Acidovorax sp. JS42]
          Length = 316

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 125/315 (39%), Positives = 188/315 (59%), Gaps = 3/315 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQL-YMRDSKIYANTQPLSLD 63
            N+ I  + I   K+ +D+TFA+  EAQ RG+++    P  + ++R  ++ A  + ++L 
Sbjct: 1   MNLLIVADPIEQFKIYKDTTFAMMREAQRRGHRLAVCEPRHIHWLRGGRVTARVRDITLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              E +++ GE ++  L+    +L+R+DPPF+  Y  +T+LLE+       + N P  +R
Sbjct: 61  GHAENWFTAGELRLAALADFGAVLMRKDPPFDSEYFYATHLLEQAEREGARVFNKPRALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF + + PTL++RD   I RF+ E  DII+KPL G GG G+FR+     N 
Sbjct: 121 DHPEKLAILEFPQFIGPTLVTRDARDIRRFHEEHHDIILKPLDGMGGMGIFRVGPDGMNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L  +  + +M+Q +LP+I +GDKRIL++ G PV     RIP   + R N+ AGG
Sbjct: 181 GSIIETLNREGSQSVMVQKFLPEIAEGDKRILVIGGTPVPYCLARIPQGSEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 LT  D +I   +G  LRERGL   G+DVIGD +TEINVTSPTC +EI    G +
Sbjct: 241 LGVARPLTARDQEIGAALGSVLRERGLLLAGVDVIGDCVTEINVTSPTCFQEIFDQTGCD 300

Query: 302 VASLFWDGIEKIKET 316
           VA+LF D +E    T
Sbjct: 301 VAALFIDALESALST 315


>gi|114707809|ref|ZP_01440703.1| glutathione synthetase [Fulvimarina pelagi HTCC2506]
 gi|114536798|gb|EAU39928.1| glutathione synthetase [Fulvimarina pelagi HTCC2506]
          Length = 313

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 173/309 (55%), Positives = 237/309 (76%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+H+S+++++ DSTFAI LEAQ RG++++HYTP++L MR S + A  + + L
Sbjct: 1   MGLKVAVQMDHVSSIQIRGDSTFAIGLEAQKRGHELWHYTPERLSMRGSTLTARAERMDL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            E +  +++LG  + IDLS++DVIL+RQDPPF+M YITST+LLE++ P TL+VN+P  +R
Sbjct: 61  REVEGDHFTLGATERIDLSEIDVILLRQDPPFDMSYITSTHLLERVQPRTLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEKIFVTEF +LMP TLI++DI ++  F  E  ++I+KPLYGNGG GVF IT  D+N 
Sbjct: 121 NAPEKIFVTEFPDLMPETLITKDIEEVKAFRAEFGEMIMKPLYGNGGAGVFHITKEDKNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
           SS +EM    Y EP + Q YLP +R GDKRI+L++G+  GA+NR+P+E D RSN+H GG+
Sbjct: 181 SSFMEMFGMLYREPFICQRYLPGVRKGDKRIILIDGEIAGAINRVPAETDARSNMHVGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           AE T+LT+ D +IC RI  +L+ERGL F GIDVIGD +TEINVTSPT IRE+ R GG ++
Sbjct: 241 AEATELTERDREICARIAPALKERGLIFVGIDVIGDVMTEINVTSPTGIREVKRFGGADI 300

Query: 303 ASLFWDGIE 311
           ASL WD IE
Sbjct: 301 ASLLWDAIE 309


>gi|126175724|ref|YP_001051873.1| glutathione synthetase [Shewanella baltica OS155]
 gi|125998929|gb|ABN63004.1| glutathione synthase [Shewanella baltica OS155]
          Length = 317

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 130/310 (41%), Positives = 193/310 (62%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+     L M +    AN +PL++ 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLMAAQDRGYQLFYMEMADLAMVNGVAMANMRPLTVI 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
               ++Y LGE +   +S++DVIL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  NDASKWYELGESQDTPMSELDVILMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDAKRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTSYGQQYAMAQAFIPEITKGDKRILVIDGEPVPYALARIPMKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+  D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVAQPLSDSDWAIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|88812472|ref|ZP_01127721.1| glutathione synthetase [Nitrococcus mobilis Nb-231]
 gi|88790258|gb|EAR21376.1| glutathione synthetase [Nitrococcus mobilis Nb-231]
          Length = 320

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 197/314 (62%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + + M+ I ++   +D+T A+ LEA+ RG+ I +     L +RD + + N+  L + 
Sbjct: 1   MIKLGVVMDPIGSITPYKDTTLAMLLEAERRGWAIRYLELGDLSLRDGQAWGNSSELHVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIR 122
           + + ++Y LG+ +   L++++VIL+R+DPP +  Y+ +TY+LE      TL+VN P  +R
Sbjct: 61  DDRHRWYELGKRQRHPLAELEVILMRKDPPVSNEYLYATYILEAAERAGTLVVNRPQGLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F T F +   PTL+S    ++  F  E    ++KPL+G GG  VF +  GD N 
Sbjct: 121 DAQEKLFATHFPQCCAPTLVSAAADELRGFIHEQGKAVLKPLHGMGGESVFVLEQGDPNT 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L +     LM Q Y+ +IR GDKRILL+ G+PV  V  RIP+  + R NI AGG
Sbjct: 181 SVIIETLSDHGRRQLMAQRYIEEIRSGDKRILLVAGEPVPYVLARIPAHGETRGNIAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E  +L+  D  IC+++  +LRERGL F G+DVIGDY+TEINVTSPTC+RE+  + G N
Sbjct: 241 RGEGIELSDRDRWICEQVAPALRERGLLFVGLDVIGDYLTEINVTSPTCVRELDAHYGIN 300

Query: 302 VASLFWDGIEKIKE 315
           ++   +D IE+  +
Sbjct: 301 ISGKLFDLIEQYLQ 314


>gi|319898361|ref|YP_004158454.1| glutathione synthetase [Bartonella clarridgeiae 73]
 gi|319402325|emb|CBI75864.1| glutathione synthetase [Bartonella clarridgeiae 73]
          Length = 312

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 181/307 (58%), Positives = 237/307 (77%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IAIQM+HI+T++++ D+TFA+AL AQ RG+ +FHYTPD L++RD  + A  +PL + +
Sbjct: 1   MKIAIQMDHIATLQIRGDTTFALALAAQERGHSLFHYTPDCLFIRDGCVIARLEPLIVCD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           ++  +Y LGE    +L  MDV+L+RQDPPF+M YIT+T+ LE+I+P+TL+VN+P W+RNS
Sbjct: 61  EEGSHYQLGESIRTELLDMDVVLLRQDPPFDMSYITTTHFLERIHPKTLVVNDPVWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEKIFVTEF +LMP TLI++DI ++  F     DIIIKPLYGNGG GVF +   DRNF+S
Sbjct: 121 PEKIFVTEFFDLMPETLITKDIEEMKAFRSMFGDIIIKPLYGNGGAGVFHLKQDDRNFAS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           LIEM  + Y EP ++Q YL  +R+GDKRI+LL+G+PVGA+NRIP+  D RSNIH GG+ E
Sbjct: 181 LIEMFEKIYREPFIVQRYLESVREGDKRIILLDGEPVGAINRIPTATDVRSNIHVGGRVE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ D +IC RIG +L++RG    GIDVIGDYITEINVTSPT IREI R GG ++AS
Sbjct: 241 CIDLTERDYEICARIGPALKKRGFLLVGIDVIGDYITEINVTSPTGIREIKRFGGADIAS 300

Query: 305 LFWDGIE 311
           LFWD IE
Sbjct: 301 LFWDIIE 307


>gi|71278064|ref|YP_267996.1| glutathione synthetase [Colwellia psychrerythraea 34H]
 gi|71143804|gb|AAZ24277.1| glutathione synthetase [Colwellia psychrerythraea 34H]
          Length = 320

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 131/312 (41%), Positives = 194/312 (62%), Gaps = 2/312 (0%)

Query: 2   KKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
            K+  + I M+ IS VKV +DS+ A+ LEAQ RGY++++     LY+   +  A T  + 
Sbjct: 4   NKVIKLGIVMDPISQVKVAKDSSMAMMLEAQQRGYELYYMEMKDLYLDQGQCRATTHRVK 63

Query: 62  LDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFW 120
           + +  E +Y L + + I +S++D +L+R+DPPF+  +I +TYLLE+     TLIVN P  
Sbjct: 64  VFDDSEHWYELSDPQDIAVSELDAVLMRKDPPFDTEFIYATYLLERAEVEGTLIVNKPQS 123

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +R+  EK+F   FSE  P TL++R   +I  F+ +++D+IIKPL G GG  +FRI   D 
Sbjct: 124 LRDCNEKLFTAWFSEFTPKTLVTRSSDKIREFHNKLQDVIIKPLDGMGGASIFRIKADDV 183

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHA 239
           N   +IE L     +  M+Q ++P+I DGDKRIL++NG+P+     RIP++ + R N+ A
Sbjct: 184 NVGVIIETLTNHGEQYAMVQEFMPEIADGDKRILIVNGEPMPYCLARIPAQGETRGNLAA 243

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG+     L+  D  I   I   L++RGL+F G+DVIGD +TEINVTSPTCIREI     
Sbjct: 244 GGRGVARPLSVSDKAIADAIAPELKKRGLYFVGLDVIGDKVTEINVTSPTCIREIEAAYP 303

Query: 300 ENVASLFWDGIE 311
            N++    D IE
Sbjct: 304 INISGKLMDAIE 315


>gi|83944828|ref|ZP_00957194.1| hypothetical protein OA2633_09374 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851610|gb|EAP89465.1| hypothetical protein OA2633_09374 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 314

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 149/313 (47%), Positives = 220/313 (70%), Gaps = 2/313 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS-L 62
           +  IA QM+ I+ V V  DSTF IALEA  RG++I+ Y P  L + + K+ A  Q +  L
Sbjct: 1   MLTIAFQMDPITAVNVNADSTFDIALEAFGRGHEIWVYEPKDLSLENGKVRATAQRVKTL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
              + ++ +L E +++DL  +D + +RQDPPF+M YIT+T++LE + PE L+VN+P  +R
Sbjct: 61  QRVQGEHVTLAEPEVLDLHTVDAVFLRQDPPFDMSYITTTHMLEHLMPEVLVVNDPRHVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKD-IIIKPLYGNGGTGVFRITLGDRN 181
           ++PEK+FVT F  +MPPTLI+    +I  F+      II+KPL+GNGG GVFRI     N
Sbjct: 121 DTPEKLFVTTFEGVMPPTLITSSEAEIRDFFERHDRDIIVKPLFGNGGAGVFRIRDSAEN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
            +SL+E+  +   +PLM Q+++P +R+GDKR++L++G+PVGA+NR+P+E + R+N+H GG
Sbjct: 181 IASLVELFGQTSRDPLMAQAFVPDVRNGDKRVILVDGEPVGAINRVPAEGEVRANMHVGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           KA  + LT+ DL+IC+ IG  L+ RGL F GIDVIGDY+TEINVTSPT I+E+ R  G +
Sbjct: 241 KAIQSDLTERDLEICRIIGPELKRRGLVFVGIDVIGDYLTEINVTSPTGIQELRRFSGVD 300

Query: 302 VASLFWDGIEKIK 314
           V++L  D +E  +
Sbjct: 301 VSALLIDWVEAKR 313


>gi|160901425|ref|YP_001567007.1| glutathione synthetase [Delftia acidovorans SPH-1]
 gi|160367009|gb|ABX38622.1| glutathione synthetase [Delftia acidovorans SPH-1]
          Length = 316

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 127/315 (40%), Positives = 186/315 (59%), Gaps = 3/315 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYM-RDSKIYANTQPLSLD 63
             I    + + + +  +D+TFA+  EAQ RG+ I    P QL   R  K+ A+ + + L 
Sbjct: 1   MQILFVADPLESFQTYKDTTFAMMREAQRRGHSIVACEPRQLSWQRGGKVVAHVRHIQLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              +Q++   +E + +L+  D IL+R+DPPF+  Y  ST+LLE+       + N P  +R
Sbjct: 61  GDAQQWFETTQEGLAELAGFDAILMRKDPPFDSEYFYSTHLLEQAEREGAKVFNKPRALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF + + PTL++R    I  F+ E +DII+KPL G GG G+FR+    RN 
Sbjct: 121 DHPEKLAILEFPQFIGPTLVTRSAQDIRAFHEEHQDIILKPLDGMGGMGIFRVGADGRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L +     +M+Q +LP+I  GDKR+L++ GKPV     RIP   + R N+ AGG
Sbjct: 181 GSIIETLNQGGASSVMVQKFLPEITQGDKRVLVIGGKPVPYCLARIPQGNEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L++ D  + + IG  L ERGL   G+DVIG  ITEINVTSPTC +EI+   G +
Sbjct: 241 KGVAQPLSEHDKAMAEEIGPILMERGLLLAGVDVIGQCITEINVTSPTCFQEIYDQTGCD 300

Query: 302 VASLFWDGIEKIKET 316
           VASLF D +E+   T
Sbjct: 301 VASLFVDALEQALAT 315


>gi|107099393|ref|ZP_01363311.1| hypothetical protein PaerPA_01000405 [Pseudomonas aeruginosa PACS2]
          Length = 317

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 126/310 (40%), Positives = 186/310 (60%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+ +  K+DS+ A+ L AQ R + +F+     LY +        +PL +
Sbjct: 1   MSVRLGIVMDPIARINFKKDSSLAMLLAAQARSWSLFYMEQQDLYQKAGVARGRMRPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++ L  E    L ++DVIL+R+DPPF+  ++ STYLLE+      L+VN P  +
Sbjct: 61  FNDASRWFELEAESDQPLHELDVILMRKDPPFDNEFVYSTYLLEQAERAGALVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK F T+F++  PPT++SR    +  F  E +DII+KPL G GG+ +FR   GD N
Sbjct: 121 RDCNEKFFATQFTQCTPPTMVSRRSDILREFAAEHRDIILKPLDGMGGSSIFRHREGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L +   + +M Q YLP+I+DGDKRIL+++G+PV     RIP++ + R N+ AG
Sbjct: 181 LSVILETLTQHGSQQIMAQRYLPEIKDGDKRILMIDGEPVPYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L++ D  I   +G  LRERGL F G+DVIGDY+TEINVTSPTCIREI +    
Sbjct: 241 GRGVAQPLSERDRWIAAEVGPHLRERGLLFVGLDVIGDYLTEINVTSPTCIREIDQAFDT 300

Query: 301 NVASLFWDGI 310
            +     D I
Sbjct: 301 RIGDKLMDAI 310


>gi|104783974|ref|YP_610472.1| glutathione synthetase [Pseudomonas entomophila L48]
 gi|95112961|emb|CAK17689.1| glutathione synthetase [Pseudomonas entomophila L48]
          Length = 317

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 197/315 (62%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+++  K+DS+ A+ L AQ RG+ +F+     LY  + K  A  +PL +
Sbjct: 1   MSVRLGIVMDPIASISYKKDSSLAMLLAAQARGWSLFYMEQRDLYQGEGKARARMRPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                +++ LGEE+   L  +DVIL+R+DPPF+M ++ STYLLE+     TL+VN P  +
Sbjct: 61  FADPARWFELGEEQDNLLGDLDVILMRKDPPFDMEFVYSTYLLEQAETDGTLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GGT +FR  +GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRPDIIRAFAAQHGDVILKPLDGMGGTSIFRHRVGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q+YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTALGAQQIMAQAYLPAIKDGDKRILMIDGEPVDYCLARIPASGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G +LR +GL F G+DVIG+++TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLSERDRWIAAQVGPTLRAKGLLFVGLDVIGEHLTEINVTSPTCIREIDAAYNT 300

Query: 301 NVASLFWDGIEKIKE 315
           ++ +   D I++  +
Sbjct: 301 DIGAKLMDAIDRQLK 315


>gi|153873038|ref|ZP_02001754.1| Glutathione synthetase, prokaryotic [Beggiatoa sp. PS]
 gi|152070498|gb|EDN68248.1| Glutathione synthetase, prokaryotic [Beggiatoa sp. PS]
          Length = 318

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 127/316 (40%), Positives = 195/316 (61%), Gaps = 2/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ I M+ I  +K+ +DS+FA+ L AQ RG+ +++     L++ D + +    PL +
Sbjct: 1   MSIHLGIIMDPIHKIKMAKDSSFAMLLAAQARGWTLWYMELKDLWLCDGEAFGAMCPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWI 121
            +  + +++LG  +   LS++ VIL+R+DPPF++ YI  TYLLE+     TL++N P  +
Sbjct: 61  HDDPDNWFTLGPSQTRPLSELSVILMRKDPPFDLEYIVVTYLLEQAEAAGTLVINKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK++   F +   PTL++R    +  F     +II+KPL G GG  +FR+  GD N
Sbjct: 121 RDANEKLYTAWFPDCCAPTLVTRRAACLRDFLQTHGEIILKPLDGMGGASIFRVIEGDIN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            S +IE + +     +M Q +LP+I  GDKRILLLNGKP+   + RIP+  ++R N+ AG
Sbjct: 181 TSVIIETITQHEQRFVMAQRFLPEIVQGDKRILLLNGKPIPFALARIPATGESRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G  E   LTK D  IC++IG  LR++GL F GIDVIG Y+TEINVTSPTCIRE+ +    
Sbjct: 241 GHGEGMPLTKRDKWICEQIGPVLRDKGLLFVGIDVIGHYLTEINVTSPTCIRELDKLYNL 300

Query: 301 NVASLFWDGIEKIKET 316
           ++A      IE+   +
Sbjct: 301 DIAGDLMTIIEEKLVS 316


>gi|49473891|ref|YP_031933.1| glutathione synthetase [Bartonella quintana str. Toulouse]
 gi|49239394|emb|CAF25732.1| Glutathione synthetase [Bartonella quintana str. Toulouse]
          Length = 312

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 179/311 (57%), Positives = 236/311 (75%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA+QM+HIST++++ D+TFA+AL AQ R + +FHYTPD+L M +  +    + L++ +
Sbjct: 1   MKIALQMDHISTLQIQGDTTFALALAAQERRHSLFHYTPDRLSMCNGCVIVRLEALTVHD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
           ++  +Y LG      L  MDV+L+RQDPPF+++YIT+T+LLE+I+P TL+VN+P W+RNS
Sbjct: 61  QEGHHYQLGNPVRTQLMDMDVVLLRQDPPFDLNYITTTHLLERIHPRTLVVNDPTWVRNS 120

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
           PEKIFVTEFS+LMP TLI++DI +IT F     DIIIKPLYGNGGTGVF +   D N +S
Sbjct: 121 PEKIFVTEFSDLMPETLITKDIEEITAFRATFGDIIIKPLYGNGGTGVFYLKRDDHNLAS 180

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE 244
           L+EM  + Y EP ++Q YL  +R GDKRI+LL+G PVGA+NRI +E+D RSN+H GG+AE
Sbjct: 181 LLEMFAQNYREPFIVQRYLDAVRKGDKRIILLDGTPVGAINRISAEMDVRSNMHVGGRAE 240

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              LT+ D +ICKRIG +LRERGL   GIDVIGDYITEINVTSPT IREI R GG ++A 
Sbjct: 241 NIDLTERDYEICKRIGPALRERGLLLVGIDVIGDYITEINVTSPTGIREIKRFGGPDIAH 300

Query: 305 LFWDGIEKIKE 315
           LFWD +E  + 
Sbjct: 301 LFWDVVESKRS 311


>gi|320330922|gb|EFW86896.1| glutathione synthetase [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330872147|gb|EGH06296.1| glutathione synthetase [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 319

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 128/315 (40%), Positives = 185/315 (58%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKNDSSLAMLLAAQERGWSLFYMEQKDLYQDAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD N
Sbjct: 121 RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEKHGDVILKPLDGMGGASIFRHRAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E L     + +M Q YL  I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILETLTAHGTQQIMAQGYLSAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSP CIREI    G 
Sbjct: 241 GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPACIREIDNAFGT 300

Query: 301 NVASLFWDGIEKIKE 315
           N+  L  D I+K  +
Sbjct: 301 NIGGLLMDAIDKKLQ 315


>gi|160873962|ref|YP_001553278.1| glutathione synthetase [Shewanella baltica OS195]
 gi|160859484|gb|ABX48018.1| glutathione synthetase [Shewanella baltica OS195]
 gi|315266196|gb|ADT93049.1| glutathione synthetase [Shewanella baltica OS678]
          Length = 317

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 129/315 (40%), Positives = 194/315 (61%), Gaps = 2/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ + AQ RGYQ+F+     L M +    AN +PL++ 
Sbjct: 1   MIKLGIVMDPINEINIKKDSSFAMLMAAQDRGYQLFYMEMADLAMVNGVAMANMRPLTVI 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
               +++ LGE +   +S++DVIL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  NDASKWFELGESQDTPMSELDVILMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   FSE  P T+++RD  +I  F+    DII+KPL G GGT +FR+   D N 
Sbjct: 121 DANEKLFTAWFSEFTPETIVTRDAKRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L     +  M Q+++P+I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTSYGQQYAMAQAFIPEITKGDKRILVVDGEPVPYALARIPMKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+  D  I + IG  L++RGL F G+DVIGD +TEINVTSPTCIREI      +
Sbjct: 241 SGVAQPLSDSDWAIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD 300

Query: 302 VASLFWDGIEKIKET 316
           +  +  D IE    T
Sbjct: 301 ITGMLMDAIEARINT 315


>gi|88705486|ref|ZP_01103197.1| Glutathione synthetase [Congregibacter litoralis KT71]
 gi|88700576|gb|EAQ97684.1| Glutathione synthetase [Congregibacter litoralis KT71]
          Length = 318

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 125/316 (39%), Positives = 186/316 (58%), Gaps = 2/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ IS +  K+DST A+   A  RG+ +++  P  L +           L +
Sbjct: 1   MSIKLGVVMDPISAISYKKDSTMAMLWAAADRGWSLYYMEPGDLSLDQGAPLGRMAELQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            +  + ++ LGE     L+ +DVIL+R+DPPF+  Y+ +TY+LE      TLIVN    +
Sbjct: 61  FKDPDHWFELGEASHRSLADLDVILMRKDPPFDNEYVYATYILEAAERLGTLIVNRCQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F +  PP L+S D  Q+  F+    D+I KPL G GGT +FR+   D N
Sbjct: 121 RDCNEKVFATQFPDCCPPVLVSGDTAQLKAFHQTHGDVIFKPLDGMGGTSIFRVREDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            + ++E L E   + +M Q YLP+I+DGDKRIL++ G+P+   + R+P + + R N+ AG
Sbjct: 181 LNVILETLTELNTQTIMAQRYLPEIKDGDKRILMIEGEPIPYGLARLPIKGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G      L++ DL I  ++G SL ERGL F G+DVIGDY+TEINVTSPTCIREI      
Sbjct: 241 GSGRAQPLSERDLWIAAQVGPSLVERGLIFVGLDVIGDYLTEINVTSPTCIREIDAAYDT 300

Query: 301 NVASLFWDGIEKIKET 316
           ++A    + IEK   +
Sbjct: 301 DIAGKLMNAIEKRLAS 316


>gi|120556671|ref|YP_961022.1| glutathione synthetase [Marinobacter aquaeolei VT8]
 gi|120326520|gb|ABM20835.1| glutathione synthase [Marinobacter aquaeolei VT8]
          Length = 317

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 125/312 (40%), Positives = 189/312 (60%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+   AQ RG++I +     LY+   +  A+T+ L++
Sbjct: 1   MTIRLGIVMDPIQDIHFKKDSSLAMLHAAQKRGWEIEYMELPDLYLAGGQARAHTRGLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW-I 121
               + +YS G  +   L  +DVIL+RQDPP +  ++ +TY+LE    +  +V NP   +
Sbjct: 61  HMDPDNWYSFGASQDRALGDLDVILMRQDPPVDREFLMATYILESAEQQGALVVNPAATL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F +L PP +++R   +   FY E  DII+KP+ G GG  +FR+   D N
Sbjct: 121 RDCNEKLFATQFEDLTPPLIVTRSAQRFREFYAEHGDIIMKPVDGMGGRSIFRVKENDAN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              +IE L        M Q ++P+I +GDKRILL+ G+PV   + RIPS  +NR N+ AG
Sbjct: 181 LGVIIETLTNYGSHQAMAQKFIPEITEGDKRILLIEGEPVPYALARIPSHGENRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E  +LT+ D  IC R+   ++E+GL F G+DVIGDY+TEINVTSPTCIRE+    G 
Sbjct: 241 GRGEGRELTERDRQICARVAPVIKEKGLMFVGLDVIGDYLTEINVTSPTCIRELDAAFGI 300

Query: 301 NVASLFWDGIEK 312
           ++A +  D IE+
Sbjct: 301 DIAGMLMDAIER 312


>gi|220920756|ref|YP_002496057.1| glutathione synthetase [Methylobacterium nodulans ORS 2060]
 gi|219945362|gb|ACL55754.1| glutathione synthetase [Methylobacterium nodulans ORS 2060]
          Length = 318

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 156/312 (50%), Positives = 222/312 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I ++++  D+TFA+ LEAQ RG+ + HYTP++L MRD ++ A  +PL +
Sbjct: 1   MALTVAVQMDPIQSIRIAGDTTFALLLEAQARGHTLLHYTPERLSMRDGRVTARAEPLRV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  + SLGE + IDL+ +DV+L+RQDPPF++ YIT+T+LLE+I+P TL+VNNPF +R
Sbjct: 61  QDVEGAHASLGEPERIDLASVDVVLMRQDPPFDLAYITATHLLERIHPATLVVNNPFEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FVT F ELMPPTLISRD  +I  F  E   +++KPL+G+GG  V R+T  D NF
Sbjct: 121 NAPEKLFVTHFPELMPPTLISRDKPEIEAFRAEHGSVVMKPLHGHGGAAVLRVTPEDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            S+ ++  + + EP +IQ +LP+I +GDKRI+L++G+P+GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSIFDLFAQTFREPWVIQRFLPKISEGDKRIILVDGEPLGAVNRVPARNDIRSNMVRGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
              T+L+  + +IC  IG  LR RGL   GIDVI   +TEINVTSPT IR I R GG ++
Sbjct: 241 GGATELSAREREICAVIGPELRRRGLILVGIDVIDGNLTEINVTSPTGIRAIKRLGGPDL 300

Query: 303 ASLFWDGIEKIK 314
           A   WD IE   
Sbjct: 301 AVAVWDAIEAKV 312


>gi|115522387|ref|YP_779298.1| glutathione synthetase [Rhodopseudomonas palustris BisA53]
 gi|115516334|gb|ABJ04318.1| glutathione synthase [Rhodopseudomonas palustris BisA53]
          Length = 313

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 152/312 (48%), Positives = 221/312 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+ +QM+ I+ + +  DSTFA+ LEAQ RG+++ + TPD++ +  S + A  QPL +
Sbjct: 1   MTLNVIVQMDPIARINIAGDSTFALLLEAQRRGHRLSYMTPDKVSLAGSDVVAGVQPLRV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++   +++LGE K ++L   DV+L+RQDPPF++ YIT+T+LLE+I+P TL+VNNP  +R
Sbjct: 61  QDQAGDHFTLGEAKRVNLRSFDVVLLRQDPPFDLGYITNTHLLERIHPHTLVVNNPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F++LMPPTLISRD  +I  F      +++KPL+G+GG  VFR+   D NF
Sbjct: 121 NAPEKLFVMDFADLMPPTLISRDKDEINAFREAHGAVVMKPLHGHGGAAVFRVLPQDMNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +M    + EP +IQ +LP+++ GDKRI+L++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLYDMFSVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAVDDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T LT  + +IC+R+G  LRERGL F GIDVI  ++TEINVTSPT IR I + GG +V
Sbjct: 241 AAATDLTPREREICERLGPHLRERGLLFVGIDVIDGHLTEINVTSPTGIRAIAKLGGPDV 300

Query: 303 ASLFWDGIEKIK 314
           A+  WD IE  +
Sbjct: 301 AAKVWDTIEAKR 312


>gi|119475416|ref|ZP_01615769.1| glutathione synthetase [marine gamma proteobacterium HTCC2143]
 gi|119451619|gb|EAW32852.1| glutathione synthetase [marine gamma proteobacterium HTCC2143]
          Length = 318

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 127/314 (40%), Positives = 188/314 (59%), Gaps = 2/314 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I ++ +K+D+T A+   A  RG+Q+ +     LY    +  A  +PL +
Sbjct: 1   MKIRLGVVMDPIESINIKKDTTLAMLWAASDRGWQLSYMRQQDLYQSGGEPRARVRPLEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
               + YY LGE + I+L ++DVIL+R+DPPF+  +I STY+LE      TL+VN P  +
Sbjct: 61  FRDTDDYYQLGEAEDINLGELDVILMRKDPPFDNEFIYSTYILEAAERLGTLVVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F E  PP ++SRD   +  F+ + KD+I KPL G GGT +FR+   D N
Sbjct: 121 RDCNEKMFATQFPECCPPLVVSRDNEILRDFHRQHKDVIFKPLDGMGGTSIFRVKENDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              ++E L +   + +M Q +L  I  GDKRILL++G+PV     RIPS+ + R N+ AG
Sbjct: 181 LGVILETLTDFGGQSIMAQRFLSDITKGDKRILLVDGEPVDYCLARIPSQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G      +T+ D  I  ++G +LRE+GL F GIDVIGDY+TEINVTSPTC+REI      
Sbjct: 241 GTGRAQPITERDRWIANQVGPTLREKGLLFVGIDVIGDYLTEINVTSPTCVREIDNAYDM 300

Query: 301 NVASLFWDGIEKIK 314
           ++     D I +  
Sbjct: 301 DIGGSLMDVISRKL 314


>gi|304392337|ref|ZP_07374278.1| glutathione synthase [Ahrensia sp. R2A130]
 gi|303295441|gb|EFL89800.1| glutathione synthase [Ahrensia sp. R2A130]
          Length = 320

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 176/314 (56%), Positives = 233/314 (74%), Gaps = 4/314 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A+QM+HISTV++  DSTFAI LEAQ RG+++FHY    L MRD  + A  +P+ + +
Sbjct: 6   LRVAVQMDHISTVQITGDSTFAIMLEAQARGHELFHYEVGNLAMRDGVVSAPCEPVQVRD 65

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP----ETLIVNNPFW 120
           ++  +++LGE K  DL+ MDVI +RQDPPF+M YIT+T+LLE+I+     +TL+VNNP  
Sbjct: 66  EEGNHFTLGEAKREDLASMDVIHMRQDPPFHMGYITATHLLERIHGEGPGKTLVVNNPAE 125

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RN+PEKIFVTEF +LMP TLISR    I  FY E  DII+KPLYGNGG GVFR+  GD+
Sbjct: 126 VRNAPEKIFVTEFPDLMPETLISRAPDDIRAFYKEFGDIIVKPLYGNGGAGVFRVQPGDQ 185

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N SSLIEM  E  PEP++ Q Y+ ++R GDKRI+L++G+ VGA+NRIP E + RSN+H G
Sbjct: 186 NLSSLIEMFHEMTPEPMIAQRYMSEVRAGDKRIILVDGEAVGAINRIPGEDEARSNMHVG 245

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE   +T+ + +IC RIG  L+ RG  F GIDVIGDY+TEINVTSPT IRE+ + GG 
Sbjct: 246 GRAEAIGMTEREHEICARIGPELKRRGFIFVGIDVIGDYMTEINVTSPTGIREVKKFGGA 305

Query: 301 NVASLFWDGIEKIK 314
           ++A+L WD IE  K
Sbjct: 306 DIAALLWDAIEAKK 319


>gi|167622640|ref|YP_001672934.1| glutathione synthetase [Shewanella halifaxensis HAW-EB4]
 gi|167352662|gb|ABZ75275.1| glutathione synthetase [Shewanella halifaxensis HAW-EB4]
          Length = 317

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 129/316 (40%), Positives = 194/316 (61%), Gaps = 3/316 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS + +K+DS+FA+ + AQ RGYQ+F+     L M + +  A    L++ 
Sbjct: 1   MIKLGIVMDPISEINIKKDSSFAMLMAAQSRGYQLFYMEMKDLAMVNGQAMATMSALTVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              +Q+Y L E     L+ +DVIL+R+DPPF+  +I +TY+LE+      LIVN P  +R
Sbjct: 61  NDPQQWYQLEEAIDTPLADLDVILMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK+F   F+E  P T+++RD  +I  F+    DII+KPL G GGT +FR+  GD N 
Sbjct: 121 DANEKLFTAWFAEFTPETIVTRDEQRIRAFHQAKGDIILKPLDGMGGTLIFRMKAGDPNT 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L E      M Q+++P I  GDKRIL+++G+PV   + RIP + + R N+ AGG
Sbjct: 181 GVIIETLTEYGQRYAMAQAFIPDITSGDKRILVVDGEPVPYSLARIPQKGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +     L++ D  I + IG  L+ RGL F G+DVIGD +TEINVTSPTCI+EI      +
Sbjct: 241 RGVAQPLSESDWHIARTIGPELKRRGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAFDVD 300

Query: 302 VASLFWDGIE-KIKET 316
           +  +  D IE +I ++
Sbjct: 301 ITGMLMDAIEARINKS 316


>gi|170739420|ref|YP_001768075.1| glutathione synthetase [Methylobacterium sp. 4-46]
 gi|168193694|gb|ACA15641.1| glutathione synthetase [Methylobacterium sp. 4-46]
          Length = 317

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 151/312 (48%), Positives = 220/312 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I ++++  D+TFA+ LEAQ RG+ + HYTPD+L MRD ++ A  + L +
Sbjct: 1   MALTVAVQMDPIQSIRIAGDTTFALLLEAQARGHTLLHYTPDRLSMRDGRVTARAEALRV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  + +LG  + +DL+ +DV+L+RQDPPF++ YIT+T+LLE+++P TL+VNNPF +R
Sbjct: 61  QDVEGAHAALGSPERVDLADLDVVLMRQDPPFDLAYITATHLLERVHPATLVVNNPFEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FVT F +LMPPTLISRD  +I  F  E   +++KPL+G+GG  V R+T  D NF
Sbjct: 121 NAPEKLFVTHFPDLMPPTLISRDRQEIEEFRAEHGSVVMKPLHGHGGAAVLRVTPDDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            S+ ++  + + E  +IQ +LP+I +GDKRI+L++G+P+GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSIFDLFSQTFREAWVIQRFLPRISEGDKRIILVDGEPLGAVNRVPARNDIRSNMVRGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
              T LT  + +IC  IG  LR RGL   GIDVI  ++TEINVTSPT IR I R GG ++
Sbjct: 241 GGATALTTREREICAAIGPELRRRGLILVGIDVIDGHLTEINVTSPTGIRAIKRLGGPDL 300

Query: 303 ASLFWDGIEKIK 314
           A   WD IE  +
Sbjct: 301 AVAVWDAIEAKR 312


>gi|327412915|emb|CAX67929.1| glutathione synthetase [Salmonella bongori]
          Length = 315

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 125/310 (40%), Positives = 201/310 (64%), Gaps = 2/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+D++FA+ LEAQ RGY++ +     LY+ + + +A+T+ L ++
Sbjct: 1   MIKLGIVMDLIANINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEAHAHTRILRVE 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  +++Y    E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYDKWYEFNGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK++   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLYTAWFSDLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKNGDPNM 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTELGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   L++ D +I +R+G +L+ +GL F G+D+IGD +TEINVTSPTC+REI      +
Sbjct: 241 RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS 300

Query: 302 VASLFWDGIE 311
           +  +  D IE
Sbjct: 301 ITGMLMDAIE 310


>gi|307824753|ref|ZP_07654976.1| glutathione synthetase [Methylobacter tundripaludum SV96]
 gi|307734111|gb|EFO04965.1| glutathione synthetase [Methylobacter tundripaludum SV96]
          Length = 315

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 125/311 (40%), Positives = 201/311 (64%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I  + +K+D++FA+ LEAQ RG+++ +   + L++R+ + YA T+ + +
Sbjct: 1   MPIKLGMVMDSIDHINIKKDTSFAMLLEAQSRGWELHYMELNDLFLRNGRAYARTRTIKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
              +++++    E+ I L ++DVI++R+DPPF+  YI +TYLLE+  +    ++N P  +
Sbjct: 61  QRDEKKWHEFTAEQDIPLDELDVIMMRKDPPFDQEYIYATYLLERAESMGVYVINKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   F +    TL++R+  +I  F LE  +II+KPL G GGT +F +  GD N
Sbjct: 121 RDANEKLFTAWFPQCCAETLVAREPARIRSFLLEQGEIILKPLDGMGGTSIFHLRQGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            S ++E + +     +M Q YLPQI DGDKRILL+NG+ +   + RIP++ + R N+ AG
Sbjct: 181 LSVILETMTQYNSRYVMAQKYLPQIVDGDKRILLVNGEVIPYALARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+AE   LT  D  I +++G +LR++GL F GIDVIGD +TEINVTSPTC++E+ R  G 
Sbjct: 241 GRAEGRPLTDRDRWIAEQVGPTLRDKGLVFVGIDVIGDTLTEINVTSPTCVQELDRQFGL 300

Query: 301 NVASLFWDGIE 311
           N+     D IE
Sbjct: 301 NICGQLMDHIE 311


>gi|225730205|gb|ACO24917.1| glutathione synthetase [Enterobacter aerogenes]
 gi|225730219|gb|ACO24930.1| glutathione synthetase [Escherichia coli]
          Length = 316

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 125/312 (40%), Positives = 198/312 (63%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M  IS++ +K+DS+FA+  EAQ RGY++F+     LYM   + +   +PL++
Sbjct: 1   MTIKLGIVMGPISSINIKKDSSFAMLEEAQKRGYELFYLEMKDLYMEAGRAFGTMRPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
                 +++LGE     LS +DVIL+R+DPPF+  +I + Y+LE+  +   LIVN P  +
Sbjct: 61  RRDYAHWFTLGEVVDQPLSTLDVILMRKDPPFDTEFIYAIYMLERAEDEGCLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK++   F+E  P TL++R   ++  F+ E KD+I+KPL G GG  +FR+   D N
Sbjct: 121 RDANEKLYTAWFAEHTPTTLVTRRADKLRAFHAEHKDVILKPLDGMGGASIFRMKEDDAN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              +IE L     +  M Q+YLP I++GDKR+L+++G+PV     RIP++ + R N+ AG
Sbjct: 181 VGVIIETLTAHGSQYCMAQTYLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I + +G +L+E+GL F G+D+IGD +TEINVTSPTCIREI      
Sbjct: 241 GRGEARPLSEADWAIARAVGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFPV 300

Query: 301 NVASLFWDGIEK 312
           +++++  D IE+
Sbjct: 301 HISAMLMDAIER 312


>gi|238763256|ref|ZP_04624221.1| Glutathione synthetase [Yersinia kristensenii ATCC 33638]
 gi|238698529|gb|EEP91281.1| Glutathione synthetase [Yersinia kristensenii ATCC 33638]
          Length = 310

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 130/304 (42%), Positives = 199/304 (65%), Gaps = 3/304 (0%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+ IS++ +K+DS+FA+ LEAQ RG+++ +     LY+R     A T+ LS+ + K+ ++
Sbjct: 1   MDPISSINIKKDSSFAMLLEAQRRGWELHYMEMGDLYLRGGDGRARTRLLSVKQDKDNWF 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRNSPEKIF 129
           S G E+ + L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R+  EK+F
Sbjct: 61  SFGVEQDLPLHDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLRDCNEKLF 120

Query: 130 VTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEML 189
            T F +L P TL+SR    I +F+ E  DII+KPL G GGT +FR+   D N S +IE L
Sbjct: 121 TTWFPDLTPDTLVSRSKEHIRKFHQEHGDIILKPLDGMGGTSIFRVKQDDPNLSVIIETL 180

Query: 190 FEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGKAELTKL 248
            E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG+ E   L
Sbjct: 181 TELGSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGGRGEARPL 240

Query: 249 TKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GENVASLFW 307
           ++ D  I + +  +L+++GL F G+D+IGD +TEINVTSPTCIREI       ++  +  
Sbjct: 241 SESDWAIARAVAPTLKKKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFPDVSITGMLM 300

Query: 308 DGIE 311
           D IE
Sbjct: 301 DAIE 304


>gi|304313293|ref|YP_003812891.1| Glutathione synthetase [gamma proteobacterium HdN1]
 gi|301799026|emb|CBL47269.1| Glutathione synthetase [gamma proteobacterium HdN1]
          Length = 318

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 133/310 (42%), Positives = 195/310 (62%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              +I + M+ I  +  K+DS+ A+   AQ RG+ +++     LY+RD +  A  + LS+
Sbjct: 1   MTLSIGVVMDPIQNIHYKKDSSLAMLWAAQARGWTLYYMEQQDLYLRDGEARATMRTLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
                Q++  G+E+   L  +DVIL+R+DPPFNM ++ +TYLLE      TLIVN    +
Sbjct: 61  HHDPAQWWQFGDERDAALGSLDVILMRKDPPFNMEFVYTTYLLEAAERTGTLIVNRAASL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F    PPTL+S    ++ +F  E  DI++KPL G GG+ VFR    D N
Sbjct: 121 RDCNEKLFATQFPACCPPTLVSASAVKLRQFAREQGDIVMKPLDGMGGSAVFRTHGSDEN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E+L +    P+M Q YLP+IR GDKRIL++NG+PV     RIP+E + R N+ AG
Sbjct: 181 LSVIMEVLTQYGRTPIMAQRYLPEIRKGDKRILVVNGEPVPFCLARIPAEGEARGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G   +  +T+ D  +C ++G +LRE+GL F G+DVIGDY+TEINVTSPTCIREI    G 
Sbjct: 241 GSGVVQPITERDRWLCAQVGSTLREKGLLFVGLDVIGDYLTEINVTSPTCIREIDAAAGT 300

Query: 301 NVASLFWDGI 310
           ++A +  + I
Sbjct: 301 DIAEMLMNAI 310


>gi|256821450|ref|YP_003145413.1| glutathione synthetase [Kangiella koreensis DSM 16069]
 gi|256794989|gb|ACV25645.1| glutathione synthetase [Kangiella koreensis DSM 16069]
          Length = 316

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 120/312 (38%), Positives = 193/312 (61%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I  V + +D++F + LEAQ RG+ +++     LY+   ++ A  Q L +
Sbjct: 1   MSYSLLMVMDPIDQVNIVKDTSFGLLLEAQRRGWDLYYCQQQDLYLEQGEVRAACQSLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
               +Q+++L   + + L Q   + +R+DPPF+M+YI STYLLE   N  TL+VNNP  +
Sbjct: 61  FNDPKQWFALQAPEQVPLHQFGSVFMRKDPPFDMNYIYSTYLLELAQNQGTLVVNNPRSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F   F +L P TL+S +   + +F +E +D I+KPL G GG  +FR+   D N
Sbjct: 121 RDCNEKLFTAWFPKLTPATLVSANARLLKQFVIEQQDTILKPLDGMGGASIFRVKQDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S +IE L E     +M Q ++P+I  GDKRIL++NG+ +  V  RIP + + R N+ AG
Sbjct: 181 TSVIIETLTEGGKHLVMAQRFIPEITQGDKRILIVNGEVIPYVLARIPQKGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G      +++ +  + + I   L +RGL+F G+DVIGD++TEINVTSPTC+RE+ +  G 
Sbjct: 241 GSGVPMPISEKEKQLAETIAPELVKRGLYFVGLDVIGDFVTEINVTSPTCMRELDKEYGI 300

Query: 301 NVASLFWDGIEK 312
           N+A+  + G+E+
Sbjct: 301 NIAAKLFQGLEQ 312


>gi|118591505|ref|ZP_01548902.1| glutathione synthetase [Stappia aggregata IAM 12614]
 gi|118435833|gb|EAV42477.1| glutathione synthetase [Stappia aggregata IAM 12614]
          Length = 314

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 149/313 (47%), Positives = 227/313 (72%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+H+S++ +  DS FA+ LEAQ RG++++HYTPD+L MR  +++   +P+ +
Sbjct: 1   MALKVAVQMDHVSSINIAGDSAFAMMLEAQSRGHELYHYTPDRLAMRGDEVFCALEPIEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + K  ++SLGE+   ++ +MDV+L+RQDPPF++ YI +T++LEKI+P+TL+VN+P  +R
Sbjct: 61  RDVKGDHFSLGEKSRFNMREMDVVLMRQDPPFDLSYIAATHILEKIHPDTLVVNDPAAVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FVTEF++LMPPTLI++D ++I  F  E  DI++KPL+G+GG  VFR+T  D N+
Sbjct: 121 NAPEKLFVTEFADLMPPTLITKDKSEIDLFRKEYGDIVMKPLFGHGGAAVFRVTQDDLNY 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +     + EP +IQ +LP ++ GDKRILL++G+  GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSLYDFFAATFREPWVIQQFLPNVKHGDKRILLVDGQFAGAVNRVPAAGDLRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
              ++LT+ + +IC R+G SL+E+GL   GIDVI   +TEINVT+PT IR I   GG +V
Sbjct: 241 PTDSELTEREREICARLGPSLKEKGLILVGIDVIDGNLTEINVTAPTGIRAIRNLGGPDV 300

Query: 303 ASLFWDGIEKIKE 315
           A + WD +E   +
Sbjct: 301 AGMVWDVLEAKVK 313


>gi|238787364|ref|ZP_04631163.1| Glutathione synthetase [Yersinia frederiksenii ATCC 33641]
 gi|238724626|gb|EEQ16267.1| Glutathione synthetase [Yersinia frederiksenii ATCC 33641]
          Length = 312

 Score =  295 bits (755), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 131/304 (43%), Positives = 198/304 (65%), Gaps = 3/304 (0%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+ IS++ +K+DS+FA+ LEAQ RG+++ +     LY+R     A T+ LS+ + KE ++
Sbjct: 1   MDPISSINIKKDSSFAMLLEAQRRGWELHYMEMGDLYLRGGDGRARTRLLSVKQDKESWF 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRNSPEKIF 129
           S G E+ + L  +DVIL+R+DPPF+  +I +TY+LE+  +  TL+VN P  +R+  EK+F
Sbjct: 61  SFGAEQDLPLHDLDVILMRKDPPFDTEFIYATYILERAEDKGTLVVNKPQSLRDCNEKLF 120

Query: 130 VTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEML 189
              FS+L P TL+SR    I +F+ E  DII+KPL G GGT +FR+   D N S +IE L
Sbjct: 121 TAWFSDLTPDTLVSRSKEHIRKFHQEHGDIILKPLDGMGGTSIFRVKQDDPNLSVIIETL 180

Query: 190 FEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGKAELTKL 248
            E      M Q++LP I++GDKR+L+++G+PV     RIP++ + R N+ AGG+ E   L
Sbjct: 181 TELGSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGGRGEARPL 240

Query: 249 TKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GENVASLFW 307
           ++ D  I + +   L+++GL F G+D+IGD +TEINVTSPTCIREI       ++  +  
Sbjct: 241 SESDWKIARAVAPVLKQKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFPDVSITGMLM 300

Query: 308 DGIE 311
           D IE
Sbjct: 301 DAIE 304


>gi|254420120|ref|ZP_05033844.1| glutathione synthase [Brevundimonas sp. BAL3]
 gi|196186297|gb|EDX81273.1| glutathione synthase [Brevundimonas sp. BAL3]
          Length = 317

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 140/312 (44%), Positives = 210/312 (67%), Gaps = 1/312 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  +AIQM+ I  V +  D++F +A  AQ RG+Q++ Y    L + + ++Y   +P+++ 
Sbjct: 1   MLKVAIQMDPIEAVDIAGDTSFLMAETAQARGHQLWVYDFRTLALEEGRLYCRARPITVR 60

Query: 64  EKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            +   +   G+   +DL   +DVIL+RQDPPF+M Y+T+TYLLE ++P TL+VN+P  +R
Sbjct: 61  REVGNHVDFGDWVKLDLAEDVDVILMRQDPPFDMAYVTATYLLETVHPRTLVVNDPAQVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++PEK+ VT F  L PPTLIS D   +  F+ +  ++++KPL+GNGG+GV ++   D N 
Sbjct: 121 SAPEKLLVTAFPGLQPPTLISADPVALNAFHEQHGEVVLKPLHGNGGSGVVKLRADDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            +LIE+      +PL+IQ ++P +  GDKRILL++G+PVGA+NR+P+    RSN+H GG 
Sbjct: 181 DALIEIHAVGSRDPLVIQKFIPAVSKGDKRILLIDGEPVGAINRVPAAGAVRSNLHVGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A   +LT  DL+IC  IG +LRERGL F GIDVIGDY+TEINVTSPT  +++    G + 
Sbjct: 241 AMPVELTPRDLEICAAIGPTLRERGLIFVGIDVIGDYLTEINVTSPTGAQQLKTFTGVDA 300

Query: 303 ASLFWDGIEKIK 314
            +L WD IE  +
Sbjct: 301 TALMWDVIEAKR 312


>gi|323137181|ref|ZP_08072260.1| glutathione synthetase [Methylocystis sp. ATCC 49242]
 gi|322397539|gb|EFY00062.1| glutathione synthetase [Methylocystis sp. ATCC 49242]
          Length = 317

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 146/312 (46%), Positives = 216/312 (69%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  +A+QM+ +  +    DSTFA+ LEA+ RG++++ YTPDQL +   ++ A    + + 
Sbjct: 1   MLEVAVQMDPLERINFAGDSTFALMLEAKRRGHRLWFYTPDQLSLEGGRLTARAHHIDVF 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRN 123
           +  ++YY+LGE + IDL +MDV L+RQDPPF++ YITST+ LE+I    L+VN+P  +RN
Sbjct: 61  DDPDRYYTLGEAREIDLIEMDVALLRQDPPFDLAYITSTHFLERIQSRVLVVNDPAHVRN 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
           +PEK+FV EF++LMPPT+I+RD   I RF     DI++KPLYG+GG  VF++T  D NF 
Sbjct: 121 APEKVFVMEFADLMPPTVITRDRAAIERFRATYGDIVMKPLYGHGGAAVFKVTPRDPNFG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKA 243
           SL +M    + EP ++Q +LP++  GDKRILL++G  +GA+NR+P++ D RSN+  GG A
Sbjct: 181 SLFDMFHTTFREPWVVQQFLPEVARGDKRILLIDGVAMGAINRVPAQDDIRSNMVRGGAA 240

Query: 244 ELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVA 303
             T+L   + +IC R+G  L+ RGL F GIDVI  ++TEINVTSPT +R + R GG ++A
Sbjct: 241 AATELDAREQEICARLGPELKRRGLLFVGIDVIDGHLTEINVTSPTGLRALKRVGGPDLA 300

Query: 304 SLFWDGIEKIKE 315
              +D IE   +
Sbjct: 301 VPLFDAIEARLK 312


>gi|307943345|ref|ZP_07658689.1| glutathione synthase [Roseibium sp. TrichSKD4]
 gi|307772975|gb|EFO32192.1| glutathione synthase [Roseibium sp. TrichSKD4]
          Length = 316

 Score =  295 bits (754), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 153/312 (49%), Positives = 222/312 (71%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IA+QM+HIS++ +  DS FA+ LEAQ RG++++HYTPD+L M    ++    P+ +
Sbjct: 1   MALKIAVQMDHISSINIAGDSAFALMLEAQARGHELYHYTPDRLAMIGDDVFCALDPVEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            ++K  +++LGE++ +++  +DV+L+RQDPPF++ YI +T++LEKI+P TL+VNNP  +R
Sbjct: 61  RDEKGNHFTLGEKQRLNMLDVDVVLMRQDPPFDLSYIAATHILEKIHPNTLVVNNPTEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FVTEF +LMPPTLI+RD  +I  F  E  DI++KPL+G+GG  VFR+T  D N+
Sbjct: 121 NAPEKLFVTEFPDLMPPTLITRDRDEIDLFRAEYGDIVMKPLFGHGGAAVFRVTRDDLNY 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL +     + EP +IQ +LP ++ GDKRILL++G+  GAVNR+P+E D RSN+  GG 
Sbjct: 181 GSLYDFFAATFREPWVIQQFLPNVKHGDKRILLVDGEFAGAVNRVPAEGDLRSNMVRGGS 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
              + LT  +L+IC R+G SLRE+GL   GIDVI   +TEINVT+PT IR I   GG +V
Sbjct: 241 PTDSDLTDRELEICVRLGPSLREKGLVLVGIDVIDGMLTEINVTAPTGIRAIQNLGGPDV 300

Query: 303 ASLFWDGIEKIK 314
           A+  WD +E   
Sbjct: 301 AAKVWDVLEAKV 312


>gi|94309188|ref|YP_582398.1| glutathione synthetase [Cupriavidus metallidurans CH34]
 gi|93353040|gb|ABF07129.1| glutathione synthetase [Cupriavidus metallidurans CH34]
          Length = 317

 Score =  295 bits (754), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 189/310 (60%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I    + + T K  +DSTFA+  EA  RG+++F     QL +  + + A  +PL L +
Sbjct: 1   MRILFITDPLETFKTYKDSTFAMMTEAAARGHELFFCLQSQLSLSANVVEAMVRPLELTD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRN 123
             + +Y LG+  ++ LS  D +L+R+DPPF+M Y+TST+LLE        + N P  IR+
Sbjct: 61  DAQAWYRLGDAALMPLSAFDAVLMRKDPPFDMEYVTSTWLLELAEAQGARVFNKPRAIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +  + + PTL++RD  +I  F+ E KDII+KPL G GG GVFR+     N  
Sbjct: 121 HSEKLAIGQHPQFITPTLVTRDAGRIREFHAEHKDIIVKPLDGMGGMGVFRVGADAMNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           +++E L +     LM+Q Y+P I+DGDKRILL+ GKPV   + RIP   + R N+ AGG 
Sbjct: 181 AIVETLGDNGARTLMVQRYIPAIKDGDKRILLIGGKPVPYSLARIPQGTEIRGNLAAGGV 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
               +L+  D +I + +   L ++GL   G+DVIGDY+TE+NVTSPTC +EI +  G NV
Sbjct: 241 GRAQELSARDREIAETLAPGLWKQGLLLVGLDVIGDYLTEVNVTSPTCFQEIAQQTGFNV 300

Query: 303 ASLFWDGIEK 312
           A +F D +E+
Sbjct: 301 AGMFIDALEQ 310


>gi|317493539|ref|ZP_07951960.1| glutathione synthase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918482|gb|EFV39820.1| glutathione synthase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 317

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 135/311 (43%), Positives = 196/311 (63%), Gaps = 3/311 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ IS++ +K+D++FA+ LEAQ RGY++ +   + LYM   +  A TQ LS+ 
Sbjct: 1   MIKLGIVMDPISSINIKKDTSFAMLLEAQRRGYELHYMEMNDLYMYVGEGRARTQLLSVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           E K  +Y    E+ I LS +DVIL+R+DPPF+  +I +TY+LE+  +  TLIVN P  +R
Sbjct: 61  EDKAGWYEFHGEQDIALSDLDVILMRKDPPFDTEFIYATYILERAEDKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   F++L P TL++R    I  FY +  DII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKLFTAWFADLTPDTLVTRKAEHIREFYAKHGDIILKPLDGMGGASIFRVKAEDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L E      M Q++LP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTEHSSRFCMAQNFLPAIKDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG-GE 300
           + E   LT+ D  I +++   L+E+GL F G+D+IGD +TEINVTSPTC REI       
Sbjct: 241 RGEARPLTESDWAIARKVAPVLKEKGLIFVGLDIIGDRLTEINVTSPTCAREIEAAFPDV 300

Query: 301 NVASLFWDGIE 311
           +V  +  D IE
Sbjct: 301 SVTGMLMDAIE 311


>gi|167644150|ref|YP_001681813.1| glutathione synthetase [Caulobacter sp. K31]
 gi|167346580|gb|ABZ69315.1| glutathione synthetase [Caulobacter sp. K31]
          Length = 317

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 148/315 (46%), Positives = 219/315 (69%), Gaps = 1/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ +  + ++ D+TF +  EAQVRG++++ YTPD+L M D +++A  QPL L
Sbjct: 1   MSLRVAVQMDPVLGINIETDTTFLMMWEAQVRGHKLWFYTPDKLSMEDGRVFARAQPLVL 60

Query: 63  DEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
            + +  +  LGE  I+D+   +DV+L+RQDPPF+M YIT+T+ LEK++P TL+VNNP  +
Sbjct: 61  TKTQGAHAELGESMILDMKDDVDVVLMRQDPPFDMAYITATHFLEKVHPHTLVVNNPAEV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           RN+PEK+FVT+F  + PPTLI+ D   I  F     DI++KPLYG GG+GV R+   D N
Sbjct: 121 RNAPEKLFVTDFPGVQPPTLITSDHEAIYDFRARHGDIVLKPLYGGGGSGVARLLADDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
             +L+E+      E ++ Q ++P +  GDKRILL++G+PVGAVNR+P+    RSN+  GG
Sbjct: 181 LDALLELHAMIGREQVIAQKFVPAVVKGDKRILLVDGEPVGAVNRVPAAGQVRSNLRVGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +AE  +LTK DL++C  I   L+ RGL F GIDVIG+Y+TEINVTSPT  +++ R GG +
Sbjct: 241 RAEAVELTKRDLELCAIIAPELKRRGLLFVGIDVIGEYLTEINVTSPTGAQQLKRFGGAD 300

Query: 302 VASLFWDGIEKIKET 316
            A++ WD I+++  T
Sbjct: 301 AAAILWDRIDELSST 315


>gi|241766098|ref|ZP_04764010.1| glutathione synthetase [Acidovorax delafieldii 2AN]
 gi|241363880|gb|EER59191.1| glutathione synthetase [Acidovorax delafieldii 2AN]
          Length = 317

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 184/311 (59%), Gaps = 3/311 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQL-YMRDSKIYANTQPLSLD 63
             +    + + + K+ +D+TFA+  EAQ RG+ +    P  L + R S++ A  + ++L 
Sbjct: 1   MKLLFIADPLESFKIYKDTTFAMMREAQRRGHTLAACLPQDLVWQRGSQVSARVRDVALT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
                +++    +   L+  D +L+R+DPPF+  Y  +T+LLE+       + N P  +R
Sbjct: 61  GDPTDWFAAQPLRSATLASFDAVLMRKDPPFDSEYFYATHLLEQAEREGARVFNKPRALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF + + PTL++RD   I RF+ E +DII+KPL G GG G+FR+     N 
Sbjct: 121 DHPEKLAIMEFPQFIGPTLVTRDPQDIQRFHAEHQDIILKPLDGMGGMGIFRVGPDGLNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+ E L     + +M+Q +LP+I DGDKR+L++ GKPV     RIP   + R N+ AGG
Sbjct: 181 GSITETLNRHGTQSVMVQKFLPEIVDGDKRVLIIGGKPVPFCLARIPQGSEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L+  D +I + +G  L  RGL   G+DVIG+ +TEINVTSPTC +EIH+  G +
Sbjct: 241 KGVARPLSPRDWEIAEALGPVLHSRGLLLAGVDVIGESVTEINVTSPTCFQEIHQQTGCD 300

Query: 302 VASLFWDGIEK 312
           VA LF D +E+
Sbjct: 301 VAYLFVDALEE 311


>gi|284007790|emb|CBA73645.1| glutathione synthetase [Arsenophonus nasoniae]
          Length = 321

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 130/313 (41%), Positives = 198/313 (63%), Gaps = 4/313 (1%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQP-LSL 62
           +  + I M+ IST+K+K+DS++A+ LEAQ RGY+I +     LY+   + Y +T+  +++
Sbjct: 1   MIKLGIVMDPISTIKIKKDSSYAMLLEAQRRGYEIHYMEMGDLYLLQGEAYGHTKQLINI 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            +    +Y  G E+ I L  +DVIL+R+DPPF+  YI +TY+LE+     +LIVN P  +
Sbjct: 61  QQDTTPWYEFGAEQDIALKNLDVILMRKDPPFDTEYIYATYILERAEQAGSLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F   F++L P TL++R+  ++  F+ +  D+I KPL G GG  +FR+T  D N
Sbjct: 121 RDCNEKLFTAWFAKLTPDTLVTRNNKKLREFHQKHGDVIFKPLDGMGGASIFRLTKDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S +IE L +      M Q YLP I++GDKR+L+++G+PV     RIP++ + R N+ AG
Sbjct: 181 VSVIIETLTQHGQRFCMAQDYLPAIKEGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN-GG 299
           G  E   LT  D  I + +   L+E+GL F G+D+IGD +TEINVTSPTCIREI      
Sbjct: 241 GYGEARPLTGSDWKIARTVAPILKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAAFSD 300

Query: 300 ENVASLFWDGIEK 312
            ++  + +D IEK
Sbjct: 301 ISITGMLFDAIEK 313


>gi|319787989|ref|YP_004147464.1| glutathione synthetase [Pseudoxanthomonas suwonensis 11-1]
 gi|317466501|gb|ADV28233.1| glutathione synthetase [Pseudoxanthomonas suwonensis 11-1]
          Length = 316

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 185/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I ++K+ +D+TFA+ LEAQ RG+++ +  P  L +RD +  A   PL +
Sbjct: 1   MPLDVVVVMDPIGSIKIAKDTTFAMLLEAQRRGHRLHYVRPGGLSLRDGRALAIAAPLRV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWI 121
            + K  ++ LG+   +      V+L+R+DPPF+  Y+  T++L+        +VNNP  +
Sbjct: 61  RDDKAGWFELGDYAELPFGPGQVVLMRKDPPFDGEYLYDTHILDMAKAAGAEVVNNPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPT ISRD  ++  F  E   +++KPL G GG  +F    GD N
Sbjct: 121 RDFNEKLAAQLFPQCCPPTRISRDPAELKAFAAEHGRVVLKPLDGMGGRSIFLSQAGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L E   +  + Q Y+P+I +GDKRILL++G PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTEGGRKLALAQRYIPEITEGDKRILLIDGVPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L + D  I  ++G  +R RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLGERDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|296446938|ref|ZP_06888873.1| glutathione synthetase [Methylosinus trichosporium OB3b]
 gi|296255505|gb|EFH02597.1| glutathione synthetase [Methylosinus trichosporium OB3b]
          Length = 318

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 151/308 (49%), Positives = 219/308 (71%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           + +IA+QM+ +  +    DSTFA+ LEAQ RG+ ++HYTPD L +   ++ A  + L++ 
Sbjct: 1   MIDIAVQMDPLERINFAGDSTFALMLEAQRRGHALWHYTPDALSLVAGRLTAPARALTVF 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRN 123
           +   +YY  GE +++DL+ +DV+L+RQDPPF++ YITST+LLE+I    L+VN+P  +RN
Sbjct: 61  DDPARYYEFGERRVLDLAGVDVVLLRQDPPFDLAYITSTHLLEQIQSRVLVVNDPAAVRN 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
           +PEK+FV EF+ELMPPTLISRD   I  F  E  +I++KPLYG+GG  VF++ + D NF 
Sbjct: 121 APEKLFVMEFAELMPPTLISRDRQAIEAFRAEQGEIVMKPLYGHGGASVFKVAVSDPNFG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKA 243
           SL ++    + EP + Q +LP +  GDKRILL++G+P+GA+NRIP+E D RSN+  GG A
Sbjct: 181 SLFDLFHTMFREPWVSQRFLPAVVLGDKRILLVDGEPLGAINRIPAENDIRSNMVRGGAA 240

Query: 244 ELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVA 303
             T LT+ + +IC R+G  L+ RGL F GIDVI  ++TEINVTSPT +R + R GG ++A
Sbjct: 241 AATALTEREREICARLGPQLKARGLLFVGIDVIDGHLTEINVTSPTGLRALARVGGPDLA 300

Query: 304 SLFWDGIE 311
           +  +D IE
Sbjct: 301 APIFDAIE 308


>gi|302381630|ref|YP_003817453.1| glutathione synthetase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192258|gb|ADK99829.1| glutathione synthetase [Brevundimonas subvibrioides ATCC 15264]
          Length = 316

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 137/314 (43%), Positives = 209/314 (66%), Gaps = 1/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  +A+QM+ I  V +  D+TF + +EAQ RG+ ++ Y    L + D  +    +P+ + 
Sbjct: 1   MLRVAVQMDPIEGVNIASDTTFFLMMEAQQRGHPLWVYDFRTLALEDGSLSCRARPVVIR 60

Query: 64  EKKEQYYSLGEEKIIDLS-QMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
           +    + +LG+E  +DL   +DVIL+RQDPPF+M Y+T+TYLLE ++P TL+VN+P  +R
Sbjct: 61  QVHGDHVTLGDEVKLDLDKDVDVILMRQDPPFDMAYVTATYLLETVHPRTLVVNDPAEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++PEK+F T F  + PPTLIS D   +  F+    D+++KPL+G  G+GV R+  GD N 
Sbjct: 121 SAPEKLFATHFEGVQPPTLISADPVALVDFHERHGDVVLKPLHGAAGSGVVRLKAGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            +LIE+      +PL+IQ ++P +  GDKRI+L++G+PVGA+NR+P++   RSN+  GG 
Sbjct: 181 EALIEIHMAGSRDPLVIQKFIPAVSKGDKRIILIDGEPVGAINRVPADGQVRSNLRVGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A   +LT  DL+IC  +G +L+E+GL F GIDVIGDY+TEINVTSPT   ++    G + 
Sbjct: 241 AAPVELTPRDLEICAIVGPALKEKGLLFVGIDVIGDYLTEINVTSPTGAVQLKDFTGIDA 300

Query: 303 ASLFWDGIEKIKET 316
           A++ WD IE   +T
Sbjct: 301 AAILWDVIEAKLKT 314


>gi|89091935|ref|ZP_01164890.1| glutathione synthetase [Oceanospirillum sp. MED92]
 gi|89083670|gb|EAR62887.1| glutathione synthetase [Oceanospirillum sp. MED92]
          Length = 315

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K+DS+ A+   AQ +G+++++     L+  D K  A   PL +
Sbjct: 1   MTIKLGIVMDPIDNITFKKDSSLAMLWAAQQKGWELWYMEQHHLFSLDGKAQAKMAPLEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
              +  ++  GE    DLS ++VIL+R+DPPF+  +I +TYLLE+     +LIVN P  +
Sbjct: 61  RMDENDWFDRGEYVTRDLSDLNVILMRKDPPFDNEFIYTTYLLEQAEKEGSLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T F E  PP L+S++   + +F+ E  D+I KPL G GG+ ++RI     N
Sbjct: 121 RDFNEKLFATHFPECCPPVLVSKNDEMLRQFHKEHGDVIFKPLDGMGGSQIYRIKEDGLN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              +IE L +   + +M Q Y+P+I DGDKRILL++G+PV   + RIP++ + R N+ AG
Sbjct: 181 LGVIIETLTDHGQQTIMAQKYIPEIVDGDKRILLVDGEPVPYGLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E  +LT+ +  IC++I  +L+E+GL F G+DVIGDY+TEINVTSPTCIRE+    G 
Sbjct: 241 GRGEGRELTEREYWICEQIAPTLKEKGLLFVGLDVIGDYLTEINVTSPTCIRELDNQYGL 300

Query: 301 NVASLFWDGIEKIK 314
           ++     + IE+  
Sbjct: 301 DIGMQLMNAIEEKL 314


>gi|88859065|ref|ZP_01133706.1| glutathione synthetase [Pseudoalteromonas tunicata D2]
 gi|88819291|gb|EAR29105.1| glutathione synthetase [Pseudoalteromonas tunicata D2]
          Length = 317

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 125/316 (39%), Positives = 186/316 (58%), Gaps = 2/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I  + IS   +K+D+ FA+  EAQ RGY++ +   D L++R  + YA +    +
Sbjct: 1   MTIKLGIISDPISGFNIKKDTGFAMMEEAQKRGYEVHYMEMDDLFLRQGQAYATSAKAKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                 +Y L E++ I L+ +DVIL+R+DPPF+  YI +TY+LE+      L++N P  +
Sbjct: 61  FNDVNHWYELEEKQTIALADLDVILMRKDPPFDTEYIYATYILERAEQAGALVINKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   FSE  P TL++R   QI  F  E  DIIIKPL G GG  +FR+   D N
Sbjct: 121 RDANEKLFTAWFSEFTPDTLVTRSQQQIRHFLAEHGDIIIKPLDGMGGASIFRVKQDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              + E L E      M+Q+Y+P+I  GDKRIL+++G+ +     RIP   + R N+ AG
Sbjct: 181 IGVICETLTEHGARFAMVQNYVPEIVQGDKRILVVDGEVIPYCLARIPQGGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I   I   L+E+GL F G+DVIGD +TEINVT+PTC+REI      
Sbjct: 241 GRGEARPLSESDFKIANAIAPILKEKGLIFVGLDVIGDKLTEINVTAPTCVREIQAAFDI 300

Query: 301 NVASLFWDGIEKIKET 316
           ++  + +D IE+   T
Sbjct: 301 SITGILFDAIERRLST 316


>gi|87200097|ref|YP_497354.1| glutathione synthetase [Novosphingobium aromaticivorans DSM 12444]
 gi|87135778|gb|ABD26520.1| glutathione synthase [Novosphingobium aromaticivorans DSM 12444]
          Length = 315

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 132/312 (42%), Positives = 208/312 (66%), Gaps = 3/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYM-RDSKIYANTQPLS 61
               +A+QM+ + ++ +  DS+FA+ L AQ RG++++HY    L +  D ++ A+  P++
Sbjct: 1   MTLRVAVQMDPLHSINIAGDSSFALMLSAQERGHEVYHYDVGSLSLDEDDRLIAHANPVT 60

Query: 62  LDEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
           +   +  ++  GE + +DL   +DV+L+RQDPPF+M YIT+T+LLE+I  ETL+VNNP  
Sbjct: 61  VQRIEGNHFQTGERRRLDLGRDIDVVLMRQDPPFHMGYITATHLLERIESETLVVNNPRS 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RN+PEK+ V ++   MPPTL++R + ++  F  +   I+IKP++GNGG  +FR++    
Sbjct: 121 VRNAPEKVMVLDYRRFMPPTLVTRSVEEVRSFQKKHGAIVIKPIHGNGGKAIFRVSEEGE 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N  +L E+  + +PEP M+Q++LP++  GDKRI+L++G+  GA+NR P   + RSN+  G
Sbjct: 181 NLGALFEVFNQTWPEPHMVQAFLPEVAKGDKRIVLVDGEIAGAINRKPGVGEFRSNLAVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGD-YITEINVTSPTCIREIHRNGG 299
           G AE T+LT+ + +IC  +G  L+  GL F GIDVIG  Y+TEINVTSPT I  I +  G
Sbjct: 241 GYAEKTELTQEEQEICAALGPELKRLGLIFVGIDVIGGKYLTEINVTSPTGIVAIDKFNG 300

Query: 300 ENVASLFWDGIE 311
            +   + WD IE
Sbjct: 301 TDTPGMIWDAIE 312


>gi|126664525|ref|ZP_01735509.1| glutathione synthetase [Marinobacter sp. ELB17]
 gi|126630851|gb|EBA01465.1| glutathione synthetase [Marinobacter sp. ELB17]
          Length = 317

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 124/315 (39%), Positives = 190/315 (60%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  ++ K+DS+ A+   AQ RG+Q+ +  P+ LY+   +  A ++ L++
Sbjct: 1   MTVRLGIVMDPIDRIQFKKDSSLAMLWAAQQRGWQLVYMEPEDLYLNGGQARARSRNLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWI 121
                 +YS   E  I L  +DVIL+RQDPP +  ++ +TY+L        L++N P  +
Sbjct: 61  RMDPNDWYSFESEADIALGDLDVILMRQDPPVDREFLMATYILSAAEVQGALVMNPPATL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F +L PP +++    ++  FY E KDII+KP+ G GG+ +FRI   D N
Sbjct: 121 RDCNEKLFATQFEDLTPPLIVTCSSARLRAFYAEHKDIIMKPIDGMGGSSIFRIKENDGN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              +IE L E      M Q ++P I  GDKRIL++ G+PV   + RIPS  +NR N+ AG
Sbjct: 181 LGVIIETLTEHGTRQAMAQKFVPAITQGDKRILMIEGEPVPYALARIPSAGENRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E  +LT  D +IC R+   ++ +GL F G+DVIGDY+TEINVTSPTCIRE+    G 
Sbjct: 241 GRGEGRELTDRDREICARVAPVIKAKGLMFVGLDVIGDYLTEINVTSPTCIRELDAAFGI 300

Query: 301 NVASLFWDGIEKIKE 315
           +++++  D I K  +
Sbjct: 301 DISAMLMDAIAKRLQ 315


>gi|56461317|ref|YP_156598.1| glutathione synthetase [Idiomarina loihiensis L2TR]
 gi|56180327|gb|AAV83049.1| Glutathione synthase [Idiomarina loihiensis L2TR]
          Length = 314

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 119/313 (38%), Positives = 191/313 (61%), Gaps = 2/313 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           ++ +A+ M+ I+TVK ++D++F + LEAQ RGYQ F+     L + + +  A  + + + 
Sbjct: 1   MKKLAMVMDPIATVKTEKDTSFRLLLEAQARGYQCFYLEMGDLVIDNGQPMAFAREVRVQ 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIR 122
           ++K  +YSL + +   L   DVI++R+DPPF+  ++ +T +LE      +L+VN P  +R
Sbjct: 61  DQKTDFYSLSDNEYRPLEDFDVIMMRKDPPFDSEFLYATQILELAEQRGSLVVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F + F++ +  TL+S     I  F+ +  ++I+KPL G GG  +F++     N 
Sbjct: 121 DCNEKLFTSWFADSIADTLVSSRADVIKAFHKKHGEVILKPLDGMGGASIFKVGADGSNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
             +IE L EK     M+Q YLP+I+DGDKRIL+++G+PV   + RIPS  + R N+ AGG
Sbjct: 181 GVIIETLTEKGQRYAMVQKYLPEIKDGDKRILIIDGEPVPYSLARIPSAGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+  D  + +++   L++RGL   G+DVIGD ITEINVTSPTC+REI      N
Sbjct: 241 SGRAQPLSDSDWALARKVAPELKKRGLIIVGLDVIGDRITEINVTSPTCMREIENAYDIN 300

Query: 302 VASLFWDGIEKIK 314
           +A L +  IE+  
Sbjct: 301 IAELVFKAIEEKL 313


>gi|320321973|gb|EFW78069.1| glutathione synthetase [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 320

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 128/316 (40%), Positives = 185/316 (58%), Gaps = 3/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I  +  K DS+ A+ L AQ RG+ +F+     LY    +  A  +PL +
Sbjct: 1   MSVRLGIVMDPIERISYKNDSSLAMLLAAQERGWSLFYMEQKDLYQDAGQARARMKPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
                +++    E    L  +DVIL+R+DPPF+M ++ +TYLLE+      L+VN P  +
Sbjct: 61  FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL 120

Query: 122 RNSPEKIFVT-EFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           R+  EK+F T  F +  PPTL+SR    I  F  +  D+I+KPL G GG  +FR   GD 
Sbjct: 121 RDCNEKLFATLLFPQCTPPTLVSRRADIIREFAEKHGDVILKPLDGMGGASIFRHRAGDP 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHA 239
           N S ++E L     + +M Q YL  I+DGDKRIL+++G+PV     RIP+  + R N+ A
Sbjct: 181 NLSVILETLTAHGTQQIMAQGYLSAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAA 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG+ E   L+  D  I ++IG +LRE+GL F G+DVIG+++TEINVTSP CIREI    G
Sbjct: 241 GGRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPACIREIDNAFG 300

Query: 300 ENVASLFWDGIEKIKE 315
            N+  L  D I+K  +
Sbjct: 301 TNIGGLLMDAIDKKLQ 316


>gi|254515812|ref|ZP_05127872.1| glutathione synthase [gamma proteobacterium NOR5-3]
 gi|219675534|gb|EED31900.1| glutathione synthase [gamma proteobacterium NOR5-3]
          Length = 318

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 132/316 (41%), Positives = 187/316 (59%), Gaps = 2/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ IS +  K+DST A+   A  RG+ +F+  P  L +           L +
Sbjct: 1   MSFTLGVVMDPISAISYKKDSTMAMLWAAADRGWSLFYMEPGDLSLDQGAPLGRMAELQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
               E++YSLGE     L+ +DVIL+R+DPPF+  Y+ +TY+LE      TLIVN    +
Sbjct: 61  FRDPERWYSLGEASHRSLADLDVILMRKDPPFDNEYVYATYILEAAERLGTLIVNRCQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F E  PP L+S D  Q+  F+    D+I KPL G GGT +FR+   D N
Sbjct: 121 RDCNEKVFATQFPECCPPVLVSGDTAQLKAFHKTHGDVIFKPLDGMGGTSIFRVKEDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            + ++E L E   + +M Q YLP+I+DGDKRIL++ GKPV   + R+PS+ + R N+ AG
Sbjct: 181 LNVILETLTEFGKQTIMAQRYLPEIKDGDKRILMIEGKPVPYGLARLPSQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G      L++ DL I  ++G SL ERGL F G+DVIGDY+TEINVTSPTCIREI      
Sbjct: 241 GTGRAQPLSERDLWIAAQVGPSLLERGLIFVGLDVIGDYLTEINVTSPTCIREIDAAYDT 300

Query: 301 NVASLFWDGIEKIKET 316
           ++A      I+K   +
Sbjct: 301 DIAGQLMTAIDKRLNS 316


>gi|218528931|ref|YP_002419747.1| glutathione synthetase [Methylobacterium chloromethanicum CM4]
 gi|218521234|gb|ACK81819.1| glutathione synthetase [Methylobacterium chloromethanicum CM4]
          Length = 320

 Score =  291 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 144/309 (46%), Positives = 217/309 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I ++++  D+TF + LEAQ RG+ ++ YTPD+L M+   + A  QP+++
Sbjct: 1   MALTVAVQMDPIQSIRIAGDTTFGLMLEAQARGHSLYTYTPDRLSMQGRLVTAYAQPVTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  + +LG  + IDL+++DV+L+RQDPPF+M Y+T+T++LEK+   TL+VN+P  +R
Sbjct: 61  QDVEGAHANLGAPERIDLAEVDVVLMRQDPPFDMAYVTATHMLEKVAGRTLVVNDPAEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F ELMPPTLISRD  +I  F  E   + +KPL+G+GG  VFR+T  D NF
Sbjct: 121 NAPEKLFVLDFPELMPPTLISRDRAEIEAFRKEHGTVAMKPLHGHGGAAVFRVTEEDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            S+ ++    + E  ++Q +L +I +GDKRI+L++G+P+GA+NR+P++ D RSN+  GG 
Sbjct: 181 GSMFDLFTATFREQWVVQRFLEKITEGDKRIILVDGEPMGAINRVPAKGDIRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  + LT+ + +IC  IG  LR RGL   GIDVI  ++TEINVTSPT IR I R GG ++
Sbjct: 241 AGASDLTEREREICATIGPELRRRGLILVGIDVIDGHLTEINVTSPTGIRTIKRLGGPDL 300

Query: 303 ASLFWDGIE 311
           A   WD IE
Sbjct: 301 AVSVWDAIE 309


>gi|254559625|ref|YP_003066720.1| glutathione synthetase [Methylobacterium extorquens DM4]
 gi|254266903|emb|CAX22702.1| glutathione synthetase [Methylobacterium extorquens DM4]
          Length = 320

 Score =  291 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 144/309 (46%), Positives = 217/309 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I ++++  D+TF + LEAQ RG+ ++ YTPD+L M+   + A  QP+++
Sbjct: 1   MALTVAVQMDPIQSIRIAGDTTFGLMLEAQARGHSLYTYTPDRLSMQGRLVTAYAQPVTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  + +LG  + IDL+++DV+L+RQDPPF+M Y+T+T++LEK+   TL+VN+P  +R
Sbjct: 61  QDVEGAHATLGAPERIDLAEVDVVLMRQDPPFDMAYVTATHMLEKVAGRTLVVNDPAEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F ELMPPTLISRD  +I  F  E   + +KPL+G+GG  VFR+T  D NF
Sbjct: 121 NAPEKLFVLDFPELMPPTLISRDRAEIEAFRKEHGTVAMKPLHGHGGAAVFRVTEEDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            S+ ++    + E  ++Q +L +I +GDKRI+L++G+P+GA+NR+P++ D RSN+  GG 
Sbjct: 181 GSMFDLFTATFREQWVVQRFLEKITEGDKRIILVDGEPMGAINRVPAKGDIRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  + LT+ + +IC  IG  LR RGL   GIDVI  ++TEINVTSPT IR I R GG ++
Sbjct: 241 AGASDLTEREREICATIGPELRRRGLILVGIDVIDGHLTEINVTSPTGIRTIKRLGGPDL 300

Query: 303 ASLFWDGIE 311
           A   WD IE
Sbjct: 301 AVSVWDAIE 309


>gi|238897813|ref|YP_002923492.1| glutathione synthetase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465570|gb|ACQ67344.1| glutathione synthetase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 327

 Score =  291 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 134/317 (42%), Positives = 201/317 (63%), Gaps = 5/317 (1%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
            I+ + I M+ IS++ +K+D++FAI LEAQ RG+++ +     L +RD    A T+ LS+
Sbjct: 1   MIKKMGIVMDPISSINIKKDTSFAILLEAQNRGWELHYMEMGDLALRDGDAMARTRLLSV 60

Query: 63  DEKKEQYYSLGEEKII---DLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNP 118
            + ++ +Y   E        L Q+DVIL+R+DPPF+M +I +TY+LE+     TL+VN P
Sbjct: 61  KQDEKNWYYFTEHGETANLPLEQLDVILMRKDPPFDMAFIYATYILERAETKGTLVVNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             +R+  EK+F + FSE  P TL+S ++ ++  F+ E KDII+KPL G GG  +FRIT  
Sbjct: 121 QSLRDCNEKLFTSWFSEFTPATLVSSNMDKLRGFHKEQKDIILKPLDGMGGESIFRITKE 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNI 237
           D N S ++E L +   +  M Q +LP+I +GDKR+L+++G PV     RIP++ + R N+
Sbjct: 181 DTNLSVILETLTKNGHQLCMAQKFLPEITEGDKRVLVVDGDPVPYCLARIPAQGETRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGGK E+  LT  D  I   IG  L+ERGL F G+D+IG ++TEINVTSPTC REI   
Sbjct: 241 AAGGKGEVRPLTNSDWKIANSIGPVLKERGLLFVGLDIIGHHLTEINVTSPTCAREIETE 300

Query: 298 GGENVASLFWDGIEKIK 314
              ++ ++  + IEK  
Sbjct: 301 CHISITAMLMNAIEKNL 317


>gi|119503499|ref|ZP_01625582.1| glutathione synthetase [marine gamma proteobacterium HTCC2080]
 gi|119460561|gb|EAW41653.1| glutathione synthetase [marine gamma proteobacterium HTCC2080]
          Length = 319

 Score =  291 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 122/311 (39%), Positives = 194/311 (62%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
             R+I + M+ IST+  K+D++ A+   A+ RG+++++     LY+   +  A  +PL +
Sbjct: 1   MSRDIGVVMDPISTINYKKDTSLALLWAARDRGWRLWYMEQSDLYLNAGQARARMRPLEV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            E  + +Y+LG  +  DL+ +D IL+R+DPPF+M ++ +T+LLE      TLIVN    +
Sbjct: 61  RETADDFYTLGTPEDKDLADLDAILMRKDPPFDMEFVYTTHLLENAERRGTLIVNRCASL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK++ TEF +  P  ++SRD  Q+  F+ +  D++ KPL G GG+ +FR+  GD N
Sbjct: 121 RDCNEKLYATEFPQCCPTLIVSRDPLQLRAFHQQHGDVVFKPLDGMGGSSIFRVREGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            S ++E L +   + +M Q YLP I +GDKRIL+++G+P+   + R+P   + R N+ AG
Sbjct: 181 LSVILETLTQNGQQTIMGQVYLPDIINGDKRILMVDGEPIPYALARVPLAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G   +  LT  D  I +++G  LR RGL F G+DVIG+++TEINVTSPTC+REI      
Sbjct: 241 GSGRVQALTDRDRWIAEQVGPDLRSRGLLFVGLDVIGEHLTEINVTSPTCLREIEAEASP 300

Query: 301 NVASLFWDGIE 311
           N+A+     IE
Sbjct: 301 NIAAKLMTCIE 311


>gi|77361514|ref|YP_341089.1| glutathione synthetase [Pseudoalteromonas haloplanktis TAC125]
 gi|76876425|emb|CAI87647.1| glutathione synthetase [Pseudoalteromonas haloplanktis TAC125]
          Length = 316

 Score =  291 bits (746), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 122/312 (39%), Positives = 188/312 (60%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I  + IS   +K+D+ FA+ ++AQ RGY+I++   D L +R  + YA      +
Sbjct: 1   MAIKLGIISDPISGFNIKKDTGFAMMMQAQARGYEIYYMEMDDLSLRQGQAYATAAKAQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            +    +Y L ++  I L  +DVIL+R+DPPF+  YI +TY+LE+     TLIVN P  +
Sbjct: 61  FDDPNNWYQLEQKTTIALGDLDVILMRKDPPFDTEYIYATYILERAEQAGTLIVNKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   FSE  P TL++R   QI  F  + KDII+KPL G GG  +FR+   D N
Sbjct: 121 RDANEKLFTAWFSEYTPDTLVTRSQKQIREFLAQHKDIILKPLDGMGGASIFRVKADDAN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              + E L E      M+Q+Y+P+I  GDKR+L+++G+ +     RIP   + R N+  G
Sbjct: 181 IGVICETLTEHGSRFAMVQNYVPEITQGDKRVLVVDGEVIPYCLARIPQNGETRGNLAVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ DL I + +  +L+E+GL F G+D+IGD +TEINVT+PTC++EI      
Sbjct: 241 GRGEARPLSESDLKIAQAVAPTLKEKGLIFVGLDIIGDKLTEINVTAPTCVKEIEAAYDI 300

Query: 301 NVASLFWDGIEK 312
           ++  + +D IEK
Sbjct: 301 SITGILFDAIEK 312


>gi|157831205|pdb|1GLV|A Chain A, Three-Dimensional Structure Of The Glutathione Synthetase
           From Escherichia Coli B At 2.0 Angstroms Resolution
          Length = 303

 Score =  291 bits (746), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 125/313 (39%), Positives = 194/313 (61%), Gaps = 13/313 (4%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
             + E L E      M Q+YLP I+DGDKR+L+++G+PV               +  GG 
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYC------------LARGGG 228

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      ++
Sbjct: 229 GEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSI 288

Query: 303 ASLFWDGIEKIKE 315
             +  D IE   +
Sbjct: 289 TGMLMDAIEARLQ 301


>gi|34499730|ref|NP_903945.1| glutathione synthetase [Chromobacterium violaceum ATCC 12472]
 gi|39931350|sp|Q7NQ65|GSHB_CHRVO RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|34105581|gb|AAQ61935.1| glutathione synthetase protein [Chromobacterium violaceum ATCC
           12472]
          Length = 314

 Score =  291 bits (745), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 109/310 (35%), Positives = 179/310 (57%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I    + +   K+ +D+TFA+  EA  RG+ I      QL +   ++  +   L++ +
Sbjct: 1   MRILFIADPLEHFKIYKDTTFAMMEEAHRRGHAISFAEAHQLSVEGGRLQVDACDLAVTD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWIRN 123
           ++  +Y LG +    L+    +++R+DPPF+M Y+ ++ L          +  +   +R+
Sbjct: 61  ERPDWYKLGPKLRQPLTAFSAVVMRKDPPFDMEYLYASQLFTLAEAQGVKVFTSGQALRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ +  F EL+ PTLIS +  ++  F  + +D+I+KPL   GG  +FR+   D N S
Sbjct: 121 FNEKLAILHFPELISPTLISGEAHRLRAFVNQHQDVILKPLDSMGGDSIFRVKPDDPNLS 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
            +IE +  +    +M Q Y+P+IRDGDKRIL+++G PV     RIP+  + R N+ AGG+
Sbjct: 181 VIIETITWRGKRTVMAQRYIPEIRDGDKRILVIDGVPVDHCLARIPAAGETRGNLAAGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   L+  D +I + +G  L++RG+   G+DVIG+Y+TE+NVTSPTC REI    G NV
Sbjct: 241 GEARPLSARDREIAETVGPELKKRGILLAGLDVIGNYLTEVNVTSPTCFREIMDQTGVNV 300

Query: 303 ASLFWDGIEK 312
           A L+ D +E+
Sbjct: 301 AGLYIDALER 310


>gi|163850372|ref|YP_001638415.1| glutathione synthetase [Methylobacterium extorquens PA1]
 gi|163661977|gb|ABY29344.1| glutathione synthetase [Methylobacterium extorquens PA1]
          Length = 320

 Score =  291 bits (745), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 144/309 (46%), Positives = 217/309 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I ++++  D+TF + LEAQ RG+ ++ YTPD+L M+   + A  QP+++
Sbjct: 1   MALTVAVQMDPIQSIRIAGDTTFGLMLEAQARGHSLYTYTPDRLSMQGRLVTAYAQPVTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  + +LG  + IDL+++DV+L+RQDPPF+M Y+T+T++LEK+   TL+VN+P  +R
Sbjct: 61  QDVEGAHATLGAAERIDLAEVDVVLMRQDPPFDMAYVTATHMLEKVAGRTLVVNDPAEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F ELMPPTLISRD  +I  F  E   + +KPL+G+GG  VFR+T  D NF
Sbjct: 121 NAPEKLFVLDFPELMPPTLISRDRAEIEAFRKEHGTVAMKPLHGHGGAAVFRVTEEDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            S+ ++    + E  ++Q +L +I +GDKRI+L++G+P+GA+NR+P++ D RSN+  GG 
Sbjct: 181 GSMFDLFTATFREQWVVQRFLEKITEGDKRIILVDGEPMGAINRVPAKGDIRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  + LT+ + +IC  IG  LR RGL   GIDVI  ++TEINVTSPT IR I R GG ++
Sbjct: 241 AGASDLTEREREICATIGPELRRRGLILVGIDVIDGHLTEINVTSPTGIRTIKRLGGPDL 300

Query: 303 ASLFWDGIE 311
           A   WD IE
Sbjct: 301 AVSVWDAIE 309


>gi|58040291|ref|YP_192255.1| glutathione synthetase [Gluconobacter oxydans 621H]
 gi|58002705|gb|AAW61599.1| Glutathione synthetase [Gluconobacter oxydans 621H]
          Length = 325

 Score =  291 bits (745), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 152/321 (47%), Positives = 222/321 (69%), Gaps = 9/321 (2%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYM-----RDSKIYA 55
           M +   +A+QM+ +  V +  DSTFA+ LEAQ RGY+++ Y    L +     +  ++ A
Sbjct: 1   MSRSLRVAVQMDPLEYVNIDGDSTFAMMLEAQARGYELWVYPVTTLSLVEGQGKGGRVQA 60

Query: 56  NTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP----E 111
             + + +  ++  + + GEE+++DL Q DVIL+RQDPPF+M YIT+T++LE ++      
Sbjct: 61  RARRVEVRRERGNHATFGEEQVLDLGQTDVILMRQDPPFDMGYITATHMLEHVHGVGEGR 120

Query: 112 TLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTG 171
           +L+VN+P  +RN+PEK+ VT F  LMPPTL++ D  +I  F  + +DII+KPLYGNGG+G
Sbjct: 121 SLVVNDPVAVRNAPEKLLVTHFPHLMPPTLVTWDTREILAFREKYQDIIVKPLYGNGGSG 180

Query: 172 VFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEV 231
           +FRI   D N  +L+EM F +  EPLMIQ Y P +R GDKRI+L++GK +GA+NR+P+  
Sbjct: 181 IFRIKPDDENLGALLEMHFARSREPLMIQRYEPAVRQGDKRIILVDGKAIGAINRVPATG 240

Query: 232 DNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCI 291
           + RSN+H GG+A   +LT  D +IC+ IG  LR+ GL FTGIDVIG+++TEINVTSPT +
Sbjct: 241 EARSNMHVGGRAMSVELTARDREICESIGPYLRDHGLIFTGIDVIGNWLTEINVTSPTGL 300

Query: 292 REIHRNGGENVASLFWDGIEK 312
           +E+ R  G N A L WD IE+
Sbjct: 301 QELDRFDGINSAGLIWDAIER 321


>gi|330721794|gb|EGG99777.1| Glutathione synthetase [gamma proteobacterium IMCC2047]
          Length = 314

 Score =  291 bits (745), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 122/302 (40%), Positives = 193/302 (63%), Gaps = 2/302 (0%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+ I+ +  K+DS+ A+   AQ RG+Q+ +     LY+ +    A T+PL +   ++ ++
Sbjct: 1   MDPITDINYKKDSSLAMLWAAQQRGWQLHYMEMPDLYLENGIAMARTRPLEVFHDEKHWF 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRNSPEKIF 129
            LGE    DL ++DVIL+R+DPPF+  ++ STY+L++  +   L+VN P  +R+  EK+F
Sbjct: 61  ELGEASDRDLGKLDVILMRKDPPFDNEFLYSTYILQRAEDQGALVVNRPQSLRDFNEKVF 120

Query: 130 VTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEML 189
            T+F +  PP L+SRD++++  F+ +  D+I KPL G GG  +FR    D N S ++E L
Sbjct: 121 ATQFPQCCPPVLVSRDMSRLRAFHHQQGDVIFKPLDGMGGASIFRCKEDDTNVSVILETL 180

Query: 190 FEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGKAELTKL 248
            +   +  M Q ++P+I  GDKRIL+++G+P    + RIPS+ ++R N+ AGG+AE  +L
Sbjct: 181 TQHGQQQAMAQRFIPEISAGDKRILMVDGEPFPYALARIPSQGESRGNLAAGGRAEGIEL 240

Query: 249 TKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWD 308
           +  D  IC+++   L+E GL F G+DVIGDY+TEINVTSPTCIR++      N+A    D
Sbjct: 241 SDRDRWICQQVAPKLKESGLLFVGLDVIGDYLTEINVTSPTCIRQLDELFNLNIADKLMD 300

Query: 309 GI 310
            I
Sbjct: 301 CI 302


>gi|148553497|ref|YP_001261079.1| glutathione synthetase [Sphingomonas wittichii RW1]
 gi|148498687|gb|ABQ66941.1| glutathione synthase [Sphingomonas wittichii RW1]
          Length = 315

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 135/315 (42%), Positives = 213/315 (67%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL-S 61
               +A+QM+ + T+ +  DSTFAI L+A  RG++++HY    L  RD ++ A  +P+  
Sbjct: 1   MSLRVAVQMDPLETINIAGDSTFAIMLDALRRGHRLWHYQAGDLCYRDGRVTAPARPIQK 60

Query: 62  LDEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
           L      ++++G+  +IDL   +DV+L+RQDPPF++ YIT+T+LLE++   TL+VN+P  
Sbjct: 61  LQRVAGDHFAVGDPVVIDLADDVDVVLMRQDPPFDLAYITATHLLERVQHATLVVNDPAS 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RN+PEK+FV +++E MPPT+I+R +     F+ E  ++++KPLYGN G+ VF +   D 
Sbjct: 121 VRNAPEKLFVLDYAEFMPPTMITRRLDDARAFHAEHGEVVVKPLYGNAGSAVFHVGRNDA 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N ++L E+  + + EP M+Q++LP +  GDKRI+L++GK  GA+NR+P E + RSN+ AG
Sbjct: 181 NLAALTELFGQVWREPFMVQAFLPDVSKGDKRIVLIDGKVAGAINRLPKEGEIRSNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+A+ T+L+  +++IC ++G  L  RGL F GIDVI  ++TEINVTSPT I  I R  G 
Sbjct: 241 GRADATELSPREVEICDKLGPDLAARGLLFVGIDVIAGHLTEINVTSPTGIVAIDRFNGT 300

Query: 301 NVASLFWDGIEKIKE 315
           +  ++ WD IE    
Sbjct: 301 DTPAMIWDAIEAKLR 315


>gi|85711780|ref|ZP_01042836.1| glutathione synthetase [Idiomarina baltica OS145]
 gi|85694395|gb|EAQ32337.1| glutathione synthetase [Idiomarina baltica OS145]
          Length = 316

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 117/309 (37%), Positives = 191/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A+ M+ I+ VK ++D++F + LEAQ RGYQ ++     L +   + YA  + +++ +
Sbjct: 1   MKLAMIMDPIAQVKTEKDTSFRLLLEAQARGYQSYYIEMADLLIDSGRPYAMARKVTVKD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRN 123
           +K  +Y LG+ + + L   DVI++R+DPPF+  ++ +T++ +       L+VNNP  +R+
Sbjct: 61  QKTDFYQLGDVEKLPLGDFDVIMMRKDPPFDSQFLYATHIFDLAQAEGALVVNNPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK++ + F E +  +L+S +  Q+  F+ +   +I+KPL G GG  +F++     N  
Sbjct: 121 CNEKLYTSWFPEFITDSLVSANAEQLKAFHKKHGTVILKPLDGMGGASIFKVNEDGANLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
            +IE L EK     M Q YLP+I+DGDKRIL++NG+PV   + RIPS  + R N+ AGG 
Sbjct: 181 VIIETLTEKGQRYAMAQKYLPEIKDGDKRILIINGEPVPYALARIPSAGETRGNLAAGGS 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                L++ D  I + IG +L+++GL+  G+DVIG+ ITEINVTSPTC+REI      N+
Sbjct: 241 GRPQPLSESDERIARAIGPTLKQKGLYLVGLDVIGERITEINVTSPTCMREIENAYDINI 300

Query: 303 ASLFWDGIE 311
           A+  +  IE
Sbjct: 301 AAQLFAAIE 309


>gi|226942479|ref|YP_002797552.1| glutathione synthetase [Azotobacter vinelandii DJ]
 gi|226717406|gb|ACO76577.1| glutathione synthase [Azotobacter vinelandii DJ]
          Length = 318

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 128/310 (41%), Positives = 181/310 (58%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+ +  K+DS+ A+   AQ RG+ + +  P  LY   ++  A  +PL +
Sbjct: 1   MSIRLGIVMDPIAQISFKKDSSLAMLQSAQARGWSLHYMEPQDLYQHGNEARARMRPLRV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            +   +++ L EE    L  +DVIL+R+DPPFN  Y+ +TYLLE       L+VN P  +
Sbjct: 61  FDDPARWFELQEENDTPLGDLDVILMRKDPPFNSEYVYATYLLELAEKAGCLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK F T+F +  PPTL+SR    +  F  E  D+I+KPL   GG  VFR   GD N
Sbjct: 121 RDCNEKFFATQFPQFTPPTLVSRRADILREFAAEHGDVILKPLDEMGGASVFRHREGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E+L E     +M Q YLP I+DGDKRIL+++G+PV     RIP+  + R N+ AG
Sbjct: 181 LSVILEVLTEHGARQIMAQRYLPAIKDGDKRILMVDGEPVPYCLARIPAPGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     LT+ D +I   +G  LR RGL F G+DVIG+++TEINVTSPTCIREI      
Sbjct: 241 GRGVAQPLTERDREIAAHVGPELRRRGLLFVGLDVIGEHLTEINVTSPTCIREIDNAYDT 300

Query: 301 NVASLFWDGI 310
            +     D I
Sbjct: 301 RIGERLMDAI 310


>gi|109897477|ref|YP_660732.1| glutathione synthetase [Pseudoalteromonas atlantica T6c]
 gi|109699758|gb|ABG39678.1| glutathione synthase [Pseudoalteromonas atlantica T6c]
          Length = 320

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 120/312 (38%), Positives = 188/312 (60%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I ++ +K+D++FA+ L AQ RGY+IF+     LY+ + K  A  + L++
Sbjct: 1   MTIKLGVVMDPIGSINIKKDTSFAMLLGAQARGYEIFYMEMGDLYLNNGKPMAQMRRLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
            E    ++ L +E+   L ++DVIL+R+DPPF+  ++ +T + E      TL+VN    +
Sbjct: 61  QEDASNWFELQDEENRGLGELDVILMRKDPPFDGEFLYATQMFELAEQTGTLVVNKAQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F + F EL+P TL++R    I  F+ + +D+I KPL G GGT +FR+     N
Sbjct: 121 RDFNEKLFTSWFPELIPDTLVTRSSKLIREFHAQHQDMICKPLDGMGGTSIFRVKPDGNN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              +IE L     +  M Q YLP+I+DGDKRIL+++G+ V   + R+P + + R N+ AG
Sbjct: 181 LGVIIETLTHLGTQYAMFQRYLPEIKDGDKRILIVDGQVVPYALARLPQKGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G      L++ DL +   I   L E+GL F G+DVIGD ITEINVTSPTC+REI      
Sbjct: 241 GTGRAQPLSESDLKLANTIAPLLVEKGLIFVGLDVIGDRITEINVTSPTCVREIEAAFPV 300

Query: 301 NVASLFWDGIEK 312
           ++  + +D +EK
Sbjct: 301 DIIGMLFDAVEK 312


>gi|91790372|ref|YP_551324.1| glutathione synthetase [Polaromonas sp. JS666]
 gi|91699597|gb|ABE46426.1| glutathione synthase [Polaromonas sp. JS666]
          Length = 318

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 115/318 (36%), Positives = 186/318 (58%), Gaps = 6/318 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMR-DSKIYANTQPLSLD 63
            NI    + +++ K+ +D+TFA+  EAQ RG++I    P  +  +   ++ A  + + L 
Sbjct: 1   MNILFVADSLASFKIYKDTTFAMMREAQRRGHRISACEPQDMSWQTGDRVTAQVRHIRLT 60

Query: 64  EKKEQYYSL---GEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPF 119
              + ++       ++   ++  D +++R+DPPF+  Y  ST+LLE+       + N P 
Sbjct: 61  GDADIWFVQDAARPDRREAVAAFDAVVMRKDPPFDSEYFYSTHLLEQAEREGAKVFNKPR 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R+ PEK+ + EF++   PTL++R  + I RF+ E +DII+KPL G GG G+FR+    
Sbjct: 121 ALRDHPEKLAILEFAQFSGPTLVTRSASDIKRFHTEHQDIILKPLDGMGGMGIFRVKEDG 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N  S+ E L +   + +M+Q +LP+I  GDKR+L++ GKPV   + RIP   + R N+ 
Sbjct: 181 LNLGSITETLNKNGAQSVMVQKFLPEIAKGDKRVLVIGGKPVPFSLARIPQGSEVRGNLA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG      L+  D +I   +G  L  RGL   G+DVIGDY+TEINVTSPTC +EIH   
Sbjct: 241 AGGLGVAQPLSARDFEIANALGPVLAARGLLLAGVDVIGDYVTEINVTSPTCFQEIHDQT 300

Query: 299 GENVASLFWDGIEKIKET 316
           G +V ++F D +E+  ++
Sbjct: 301 GFDVPAMFIDALEQALKS 318


>gi|332307599|ref|YP_004435450.1| glutathione synthetase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174928|gb|AEE24182.1| glutathione synthetase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 320

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 122/312 (39%), Positives = 189/312 (60%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I ++ +K+D++FA+ L AQ RGY+IF+     LY+ + K  A  + L++
Sbjct: 1   MTIKLGVVMDPIGSINIKKDTSFAMLLGAQARGYEIFYIEMGDLYLNNGKPMAQMRRLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
            E    ++ L  E+   L ++DVIL+R+DPPF+  ++ +T + E      TL+VN    +
Sbjct: 61  QEDANNWFELQAEENRGLGELDVILMRKDPPFDSEFLYATQMFELAEQTGTLVVNKAQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F + F EL+P TL++R    I  F+   +D+I KPL G GGT +FR+     N
Sbjct: 121 RDFNEKLFTSWFPELIPDTLVTRSAKLIREFHATHQDMICKPLDGMGGTSIFRVKPDGNN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              +IE L +   +  M Q YLP+I+DGDKRIL+++G+ V   + R+P + + R N+ AG
Sbjct: 181 LGVIIETLTKLGTQYAMFQRYLPEIKDGDKRILIVDGQVVPYALARLPQKGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           GK     L++ DL +   I   L E+GL F G+DVIGD ITEINVTSPTC+REI      
Sbjct: 241 GKGRAQPLSESDLKLANTIAPLLVEKGLIFVGLDVIGDRITEINVTSPTCVREIQAAYPV 300

Query: 301 NVASLFWDGIEK 312
           ++ ++ +D IEK
Sbjct: 301 DIVAMLFDAIEK 312


>gi|224826186|ref|ZP_03699289.1| glutathione synthetase [Lutiella nitroferrum 2002]
 gi|224601823|gb|EEG08003.1| glutathione synthetase [Lutiella nitroferrum 2002]
          Length = 314

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 109/310 (35%), Positives = 177/310 (57%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I    + +   K+ +D+TFA+  EA  RG+ +      QL +   ++  + + L+L  
Sbjct: 1   MKILFIADPLDHFKIYKDTTFAMMEEAARRGHALAVAEARQLSVEGGRLLVDARDLTLTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRN 123
            K  ++ L E +   L+     ++R+DPPF+M Y+ ++ L          + ++   +R+
Sbjct: 61  DKHDWFRLAEVQRQPLTAFSAAIMRKDPPFDMEYLYASQLFTLAEAQGVKVFSSGQALRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ +  F + + PTLIS +  ++  F  + +D+I+KPL   GG  +FR+T  D N S
Sbjct: 121 YNEKLAILNFPDCIAPTLISGESARLRAFVRQHQDVILKPLDSMGGDSIFRVTPDDPNLS 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
            ++E + ++    +M Q ++P+IRDGDKRIL+++G PV     RIP   + R N+ AGG+
Sbjct: 181 VILETITQRETRTVMAQRFIPEIRDGDKRILVIDGVPVDYCLARIPMAGETRGNLAAGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT  D +I   +G  L+ RG+ F G+DVIGDY+TE+NVTSPTC REI    G NV
Sbjct: 241 GEARPLTARDREIVAAVGPELQRRGILFAGLDVIGDYLTEVNVTSPTCFREIMDQTGINV 300

Query: 303 ASLFWDGIEK 312
           A L+ D +E+
Sbjct: 301 AGLYIDALER 310


>gi|152998318|ref|YP_001343153.1| glutathione synthetase [Marinomonas sp. MWYL1]
 gi|150839242|gb|ABR73218.1| glutathione synthetase [Marinomonas sp. MWYL1]
          Length = 315

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 128/315 (40%), Positives = 197/315 (62%), Gaps = 2/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ IS++  K+D++ A+   A  +G+Q+ +     L++ + K YA T+PL++
Sbjct: 1   MTIKLGIVMDPISSINYKKDTSLAMLWAAAEKGWQLIYMEQKDLFLDNGKAYAMTRPLNV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            +    +Y LGEE  + +  MDVIL+R+DPPF+  ++ ST +LE+      L+VN+P  +
Sbjct: 61  YKDPAHFYDLGEETKMAMGDMDVILMRKDPPFDSEFVYSTMILEQAERDGALVVNDPKSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F    PP L++R    +  F+ E  D+I KPL G GG+ +FRI   D N
Sbjct: 121 RDCNEKLFATQFPHCCPPVLVTRRADLLKSFHKEHGDVIFKPLDGMGGSSIFRIKPDDSN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            S +IE L     E +M Q ++P+I+DGDKRIL++NG+PV   + RIP+  + R N+ AG
Sbjct: 181 ISVIIETLTNMGVEQIMAQKFIPEIKDGDKRILVVNGEPVPFALARIPASGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   LT  D  IC+++  SL+E+ L F G+DVIGDY+TEINVTSPTC+RE+      
Sbjct: 241 GRGEGRPLTDRDRWICEQVIPSLKEKNLMFVGLDVIGDYLTEINVTSPTCVRELDTQFDL 300

Query: 301 NVASLFWDGIEKIKE 315
           N+A +  + IEK  +
Sbjct: 301 NIAMMLIEAIEKRLQ 315


>gi|300705299|ref|YP_003746902.1| glutathione synthetase [Ralstonia solanacearum CFBP2957]
 gi|299072963|emb|CBJ44320.1| glutathione synthetase (glutathione GSH synthase) [Ralstonia
           solanacearum CFBP2957]
          Length = 324

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 123/310 (39%), Positives = 181/310 (58%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I   ++ +ST K+ +DSTFA+  EA  RGY I+     QL +  + +     P++L  
Sbjct: 1   MRILFIVDPLSTFKIYKDSTFAMMREATARGYAIYTCLQSQLTLSGNAVETVATPIALTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
            +  +Y  G+ +++ L+  D +L+R+DPPF+M Y+ ST+LLE        + N P  IR+
Sbjct: 61  DEHDWYRAGDPRLLPLTGFDAVLMRKDPPFDMEYVNSTWLLEIAERQGARVFNKPQSIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F E   PT+++RD  ++  F+ E  D+I KPL G GG G+FRI     N  
Sbjct: 121 HSEKLAIAQFREFTAPTIVTRDAKRLREFHAEQGDVIFKPLDGMGGAGIFRIGADGMNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           S+IE L       +M Q Y+P IRDGDKRILL+ G PV   + R+P   + R N+ AGG 
Sbjct: 181 SVIETLTHNGTRTVMAQQYIPAIRDGDKRILLIGGSPVPHALARVPMVGEVRGNLAAGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                L++ D  I   +   L +RGL   G+DVIGDY+TE+NVTSPTC +EI +  G NV
Sbjct: 241 GRAQPLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFNV 300

Query: 303 ASLFWDGIEK 312
           A +F D +E+
Sbjct: 301 AGMFIDALER 310


>gi|329847434|ref|ZP_08262462.1| glutathione synthase [Asticcacaulis biprosthecum C19]
 gi|328842497|gb|EGF92066.1| glutathione synthase [Asticcacaulis biprosthecum C19]
          Length = 315

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 126/315 (40%), Positives = 199/315 (63%), Gaps = 1/315 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I  + +  D+TF + + AQ RG++++ Y P  L + D ++ A  + ++L
Sbjct: 1   MTLRVAVQMDPIEKINIASDTTFLLMMAAQDRGHELWVYEPQHLTLEDGRVSARGRKVTL 60

Query: 63  DEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
              K  + + G+ + +DL   +DV+L+RQDPPF++ YIT+TY LE I+P+TL+VNNP  +
Sbjct: 61  RPVKGDHVTAGDYQKLDLADDIDVVLMRQDPPFDIAYITATYFLETIHPKTLVVNNPTSV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++PEK+  T F  L PPT+IS D   +  F+    D I+KPL+G  G G+ ++  GDRN
Sbjct: 121 RDAPEKLLATRFEGLQPPTIISSDFEALNDFFDRHGDCILKPLHGAAGNGIIKLKAGDRN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
             SL+E+      EP+++Q ++P +  GDKRI+L++G+  G +NR+P+E   RSN+  GG
Sbjct: 181 LDSLVELFGNISREPVILQKFIPAVSAGDKRIILIDGEIAGGINRVPAEGGVRSNLRVGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           +AE   LT  D +IC+ +   L+E+ L F GIDVIGD++TEINVTSPT   ++      +
Sbjct: 241 RAEPLILTDRDREICEILKPVLKEKELMFVGIDVIGDFLTEINVTSPTGAVQLKAFENID 300

Query: 302 VASLFWDGIEKIKET 316
           V    W+ IE    +
Sbjct: 301 VGVTLWERIEAKLAS 315


>gi|240137447|ref|YP_002961918.1| glutathione synthetase [Methylobacterium extorquens AM1]
 gi|240007415|gb|ACS38641.1| glutathione synthetase [Methylobacterium extorquens AM1]
          Length = 320

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 144/309 (46%), Positives = 217/309 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I ++++  D+TF + LEAQ RG+ ++ YTPD+L M+   + A  QP+++
Sbjct: 1   MALTVAVQMDPIQSIRIAGDTTFGLMLEAQARGHSLYTYTPDRLSMQGRLVTAYAQPVTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  + +LG  + IDL+++DV+L+RQDPPF+M Y+T+T++LEK+   TL+VN+P  +R
Sbjct: 61  QDVEGAHATLGAPERIDLAEVDVVLMRQDPPFDMAYVTATHMLEKVAGRTLVVNDPAEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F ELMPPTLISRD  +I  F  E   + +KPL+G+GG  VFR+T  D NF
Sbjct: 121 NAPEKLFVLDFPELMPPTLISRDSAEIEAFRKEHGTVAMKPLHGHGGAAVFRVTEEDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            S+ ++    + E  ++Q +L +I +GDKRI+L++G+P+GA+NR+P++ D RSN+  GG 
Sbjct: 181 GSMFDLFSATFREQWVVQRFLEKITEGDKRIILVDGEPMGAINRVPAKGDIRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  + LT+ + +IC  IG  LR RGL   GIDVI  ++TEINVTSPT IR I R GG ++
Sbjct: 241 AGASDLTEREREICATIGPELRRRGLILVGIDVIDGHLTEINVTSPTGIRTIKRLGGPDL 300

Query: 303 ASLFWDGIE 311
           A   WD IE
Sbjct: 301 AVSVWDAIE 309


>gi|83746876|ref|ZP_00943923.1| Glutathione synthetase [Ralstonia solanacearum UW551]
 gi|207742190|ref|YP_002258582.1| glutathione synthetase (glutathione synthase) (gshsynthetase)
           (gsh-s) (gshase) protein [Ralstonia solanacearum
           IPO1609]
 gi|83726461|gb|EAP73592.1| Glutathione synthetase [Ralstonia solanacearum UW551]
 gi|206593578|emb|CAQ60505.1| glutathione synthetase (glutathione synthase) (gshsynthetase)
           (gsh-s) (gshase) protein [Ralstonia solanacearum
           IPO1609]
          Length = 324

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 125/310 (40%), Positives = 183/310 (59%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I   ++ +ST K+ +DSTFA+  EA  RGY I+     QL +  + +     P++L  
Sbjct: 1   MRILFIVDPLSTFKIYKDSTFAMMREATARGYAIYTCLQSQLTLSGNAVETVATPIALTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
            +  +Y  G+ +++ L+  D +L+R+DPPF+M Y+TST+LLE        + N P  IR+
Sbjct: 61  DEHDWYRAGDPRLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIAERQGARVFNKPQSIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F E   PT+++RD  ++  F+ E  D+I KPL G GGTG+FRI     N  
Sbjct: 121 HSEKLAIAQFREFTAPTIVTRDAKRLREFHAEQGDVIFKPLDGMGGTGIFRIGADGMNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           S+IE L       +M Q Y+P IRDGDKRILL+ G PV   + R+P   + R N+ AGG 
Sbjct: 181 SVIETLTHNGTRTVMAQQYIPAIRDGDKRILLIGGSPVPHALARVPMAGEVRGNLAAGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                L++ D  I   +   L +RGL   G+DVIGDY+TE+NVTSPTC +EI +  G NV
Sbjct: 241 GRAQPLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFNV 300

Query: 303 ASLFWDGIEK 312
           A +F D +E+
Sbjct: 301 AGMFIDALER 310


>gi|207727787|ref|YP_002256181.1| glutathione synthetase (glutathione synthase) (gshsynthetase)
           (gsh-s) (gshase) protein [Ralstonia solanacearum MolK2]
 gi|206591028|emb|CAQ56640.1| glutathione synthetase (glutathione synthase) (gshsynthetase)
           (gsh-s) (gshase) protein [Ralstonia solanacearum MolK2]
          Length = 324

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 124/310 (40%), Positives = 182/310 (58%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I   ++ +ST K+ +DSTFA+  EA  RGY I+     QL +  + +     P++L  
Sbjct: 1   MRILFIVDPLSTFKIYKDSTFAMMREATARGYAIYTCLQSQLTLSGNAVETVATPIALTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
            +  +Y  G+ +++ L+  D +L+R+DPPF+M Y+TST+LLE        + N P  IR+
Sbjct: 61  DEHDWYRAGDPRLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIAERQGARVFNKPQSIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F E   PT+++RD  ++  F+ E  D+I KPL G GG G+FRI     N  
Sbjct: 121 HSEKLAIAQFREFTAPTIVTRDAKRLREFHAEQGDVIFKPLDGMGGAGIFRIGADGMNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           S+IE L       +M Q Y+P IRDGDKRILL+ G PV   + R+P   + R N+ AGG 
Sbjct: 181 SVIETLTHNGTRTVMAQQYIPAIRDGDKRILLIGGSPVPHALARVPMAGEVRGNLAAGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                L++ D  I   +   L +RGL   G+DVIGDY+TE+NVTSPTC +EI +  G NV
Sbjct: 241 GRAQPLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFNV 300

Query: 303 ASLFWDGIEK 312
           A +F D +E+
Sbjct: 301 AGMFIDALER 310


>gi|188580144|ref|YP_001923589.1| glutathione synthetase [Methylobacterium populi BJ001]
 gi|179343642|gb|ACB79054.1| glutathione synthetase [Methylobacterium populi BJ001]
          Length = 320

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 145/309 (46%), Positives = 218/309 (70%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I ++++  D+TF + LEAQ RG+ ++ YTPD+L M+   + A  QP+++
Sbjct: 1   MALTVAVQMDPIQSIRIAGDTTFGLMLEAQARGHSLYTYTPDRLSMQGRLVTAYAQPVTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  + +LG  + IDL+Q+DV+L+RQDPPF+M Y+T+T++LEK+   TL+VN+P  +R
Sbjct: 61  QDVEGAHANLGGPERIDLAQVDVVLMRQDPPFDMAYVTATHMLEKVAGRTLVVNDPAEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F ELMPPTLISRD  +I  F  E   I +KPL+G+GG  VFR++  D NF
Sbjct: 121 NAPEKLFVLDFPELMPPTLISRDRAEIEAFRKEHGTIAMKPLHGHGGAAVFRVSEEDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            S+ ++    + E  ++Q +L +I +GDKRI+L++G+P+GA+NR+P++ D RSN+  GG 
Sbjct: 181 GSMFDLFSATFREQWVVQRFLEKITEGDKRIILVDGEPMGAINRVPAKGDIRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  ++LT+ + +IC  IG  LR RGL   GIDVI  ++TEINVTSPT IR I R GG ++
Sbjct: 241 AGASQLTEREREICATIGPELRRRGLILVGIDVIDGHLTEINVTSPTGIRTIKRLGGPDL 300

Query: 303 ASLFWDGIE 311
           A   WD IE
Sbjct: 301 AVSVWDAIE 309


>gi|121607915|ref|YP_995722.1| glutathione synthetase [Verminephrobacter eiseniae EF01-2]
 gi|121552555|gb|ABM56704.1| glutathione synthase [Verminephrobacter eiseniae EF01-2]
          Length = 318

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 180/315 (57%), Gaps = 3/315 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQL-YMRDSKIYANTQPLSLD 63
             +    + + + K+ +D+TFA+  EAQ RG+ +    P  + + R SK+ A  Q + L 
Sbjct: 1   MELLFIADPLHSFKIYKDTTFAMMREAQRRGHTLTVSEPQHIMWQRGSKVSARVQDIRLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
                +Y    +    L+  D +L+R+DPPF+  Y  +T+LLE+       + N P  +R
Sbjct: 61  GDPTHWYDAPAQHSAWLADFDAVLMRKDPPFDSEYFYATHLLEQAEREGARVFNKPRALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF + + PTL++RD   I RF+ + +DII+KPL G GG G+FR+     N 
Sbjct: 121 DHPEKLAIMEFPQFIGPTLVTRDAGDIQRFHAQHQDIILKPLDGMGGMGIFRVGPDGLNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+ E L       +M+Q +LP+I +GDKR+L++ GKPV     RIP   + R N+  GG
Sbjct: 181 GSITETLNRHGARSVMVQKFLPEIVEGDKRVLIIGGKPVPFCLARIPQGREVRGNLATGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L+  D +I   +G  L++RGL   G+DVIGD +TEINVTSPTC +EI    G +
Sbjct: 241 KGVARPLSARDREIAAALGPVLQQRGLLLAGVDVIGDCVTEINVTSPTCFQEIQEQTGCD 300

Query: 302 VASLFWDGIEKIKET 316
           VASLF D +E    T
Sbjct: 301 VASLFIDALEAAVAT 315


>gi|17545064|ref|NP_518466.1| glutathione synthetase [Ralstonia solanacearum GMI1000]
 gi|20138175|sp|P58579|GSHB_RALSO RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|17427354|emb|CAD13873.1| probable glutathione synthetase (glutathione synthase)
           (gshsynthetase) (gsh-s) (gshase) protein [Ralstonia
           solanacearum GMI1000]
          Length = 324

 Score =  290 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 124/310 (40%), Positives = 182/310 (58%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I   ++ +ST K+ +DSTFA+  EA  RGY I+     QL +  + +     PL+L  
Sbjct: 1   MRILFIVDPLSTFKIYKDSTFAMMREAAARGYAIYTCQQSQLTLSGNVVETVATPLALTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
            +  +Y  G+ +++ L+  D +L+R+DPPF+M Y+TST+LLE        + N P  IR+
Sbjct: 61  DEHDWYRSGDPRLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIAERQGARVFNKPQAIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F E   PT+++RD  ++  F+ E  D+I KPL G GG G+FR+     N  
Sbjct: 121 HSEKLAIAQFREFTAPTIVTRDAKRLREFHAEQGDVIFKPLDGMGGAGIFRVGADGMNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           S+IE L       +M Q Y+P IRDGDKRILL+ G PV   + R+P   + R N+ AGG 
Sbjct: 181 SVIETLTHNGTRTVMAQQYIPAIRDGDKRILLIGGSPVPHALARVPMAGEVRGNLAAGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                L++ D  I   +   L +RGL   G+DVIGDY+TE+NVTSPTC +EI +  G NV
Sbjct: 241 GRAQLLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFNV 300

Query: 303 ASLFWDGIEK 312
           A +F D +E+
Sbjct: 301 AGMFIDALER 310


>gi|85708627|ref|ZP_01039693.1| glutathione synthetase [Erythrobacter sp. NAP1]
 gi|85690161|gb|EAQ30164.1| glutathione synthetase [Erythrobacter sp. NAP1]
          Length = 320

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 136/312 (43%), Positives = 210/312 (67%), Gaps = 3/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMR-DSKIYANTQPLS 61
               IA+QM+ I  + +K DS+FA+ L AQ RGY++F Y  + L +  + ++ A   P+ 
Sbjct: 1   MSLKIAVQMDPIENINIKGDSSFALMLAAQERGYEVFEYHVESLTLDANDRLIAECFPVK 60

Query: 62  LDEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
           +   +  ++  GE + +DL   +DV+L+RQDPPF+M YIT+T++LE+I  ETL+VN+P  
Sbjct: 61  VQRVEGDHFEKGEAQRLDLGRDIDVVLMRQDPPFHMGYITATHMLERIQAETLVVNDPAN 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +RN+PEK+ V ++   MPPTL++R + ++ RF  E   +++KP++GNGG  +FR+     
Sbjct: 121 VRNAPEKVMVLDYRRFMPPTLVTRSVDEVKRFMKEHGAVVVKPIHGNGGKAIFRVPESGD 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           N ++L E+  + +PEP M+Q +LP++ +GDKRI+L++G+  GA+NRIP E + RSN+  G
Sbjct: 181 NLTALFEVFNQTWPEPHMVQPFLPEVAEGDKRIVLIDGEIAGAINRIPGEGEFRSNLAMG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGD-YITEINVTSPTCIREIHRNGG 299
           G AE T LT  +++IC+ +G  L+  GL F GIDVIG  Y+TEINVTSPT I  I    G
Sbjct: 241 GSAEATTLTDREVEICEAMGPELKRLGLTFVGIDVIGGKYLTEINVTSPTGIVAISNFDG 300

Query: 300 ENVASLFWDGIE 311
            ++A + WD IE
Sbjct: 301 TDLAGMIWDAIE 312


>gi|300309433|ref|YP_003773525.1| glutathione synthetase [Herbaspirillum seropedicae SmR1]
 gi|300072218|gb|ADJ61617.1| glutathione synthetase protein [Herbaspirillum seropedicae SmR1]
          Length = 316

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 121/309 (39%), Positives = 179/309 (57%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA   + + T K  +DSTFA+  EA  RG+ ++ +    L +    + AN   L+L  
Sbjct: 1   MKIAFLADPLDTFKTYKDSTFAMMREAARRGHVLYAFEQADLVLESGLVTANACKLTLTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRN 123
             + +Y   +     LS+ D +++R+DPPF+M YI +TYLLE        + N P  IR+
Sbjct: 61  DADDWYRTDKPVSSFLSEFDAVIVRKDPPFDMEYIYTTYLLELAEKQGARVFNKPAAIRS 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F +   PTL++RD  ++  F+ E +D+I+KPL G GG G+FR+     N  
Sbjct: 121 HNEKLAIAQFPQYTAPTLVTRDAKRLRAFHAEHQDVILKPLDGMGGMGIFRVKADGMNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S+IE L +     +M Q ++PQI  GDKRILL+ GK V  V  RIP   + R N+ AGG 
Sbjct: 181 SIIETLTDNGQRTIMAQRFIPQISAGDKRILLIGGKVVPNVLARIPQGNEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                 +  D++I + +G  L ERGL   G+D IGDY+TEINVTSPTC +EI +  G +V
Sbjct: 241 GRAQPASARDIEIGEALGPVLHERGLLLVGLDAIGDYLTEINVTSPTCFQEITQQTGFDV 300

Query: 303 ASLFWDGIE 311
           A++F D +E
Sbjct: 301 AAMFVDALE 309


>gi|300692681|ref|YP_003753676.1| glutathione synthetase (glutathione GSH synthase) [Ralstonia
           solanacearum PSI07]
 gi|299079741|emb|CBJ52417.1| glutathione synthetase (glutathione GSH synthase) [Ralstonia
           solanacearum PSI07]
          Length = 324

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 124/310 (40%), Positives = 181/310 (58%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I   ++ + T K+ +DSTFA+  EA  RGY I+     QL +  + +     PL+L  
Sbjct: 1   MRILFIVDPLPTFKIYKDSTFAMMREAAARGYAIYTCLQSQLTLSGNVVETVATPLALTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
            +  +Y  G+ +++ L+  D +L+R+DPPF+M Y+TST+LLE        + N P  IR+
Sbjct: 61  DEHDWYRSGDPRLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIAERQGARVFNKPQAIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F E   PT+++RD  ++  F+ E  D+I KPL G GG+G+FRI     N  
Sbjct: 121 HSEKLAIAQFREFTAPTIVTRDAKRLREFHAEQGDVIFKPLDGMGGSGIFRIGADGMNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           S IE L       +M Q Y+P IRDGDKRILL+ G PV   + R+P   + R N+ AGG 
Sbjct: 181 SAIETLTHNGTRTVMAQQYIPAIRDGDKRILLIGGSPVPHALARVPMAGEVRGNLAAGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                L++ D  I   +   L +RGL   G+DVIGDY+TE+NVTSPTC +EI +  G NV
Sbjct: 241 GRAQPLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFNV 300

Query: 303 ASLFWDGIEK 312
           A +F D +E+
Sbjct: 301 AGMFIDALER 310


>gi|217978932|ref|YP_002363079.1| glutathione synthetase [Methylocella silvestris BL2]
 gi|217504308|gb|ACK51717.1| glutathione synthetase [Methylocella silvestris BL2]
          Length = 340

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 144/312 (46%), Positives = 208/312 (66%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I  V +  D+TFA+ LEAQ RG+++ +YTPD+L   D ++ A    + +
Sbjct: 1   MPLTVAVQMDPIEKVNIAGDTTFALMLEAQARGHRLIYYTPDRLSFSDGRVLALACEIVV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            +    +++LG EK +DL+ +DV+L+RQDPPF++ YITST+LLE + P  L+VN+P  +R
Sbjct: 61  RDIAGDHFTLGAEKPVDLAGVDVVLLRQDPPFDLAYITSTHLLEMLPPHVLVVNDPASVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F ELMP TLISRD   I  F     ++++KPLYG+GG+ VF++   D NF
Sbjct: 121 NAPEKLFVMKFPELMPKTLISRDKKTIEEFREANGEVVMKPLYGHGGSAVFKVARKDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            SL ++    + EP ++Q +LP +  GDKRI+L++G  +GAVNR+P+E D RSN+  GG 
Sbjct: 181 GSLFDLFATTFREPWVVQQFLPAVSRGDKRIILIDGVALGAVNRVPAENDIRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  T+ T  + DIC  IG  L+  GL   GIDVI   +TEINVTSPT +R I R GG ++
Sbjct: 241 AAATEFTPRERDICAAIGPELKRLGLIIVGIDVIDGNLTEINVTSPTGVRAIRRVGGPDL 300

Query: 303 ASLFWDGIEKIK 314
           A   WD IE  +
Sbjct: 301 AIAAWDAIEARR 312


>gi|319764752|ref|YP_004128689.1| glutathione synthetase [Alicycliphilus denitrificans BC]
 gi|330826968|ref|YP_004390271.1| glutathione synthetase [Alicycliphilus denitrificans K601]
 gi|317119313|gb|ADV01802.1| glutathione synthetase [Alicycliphilus denitrificans BC]
 gi|329312340|gb|AEB86755.1| glutathione synthetase [Alicycliphilus denitrificans K601]
          Length = 339

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 121/310 (39%), Positives = 182/310 (58%), Gaps = 3/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYM-RDSKIYANTQPLSLD 63
            N+    + +   K+ +D+TFA+  EA  RG+++    P Q++  R  K+ A  + ++L 
Sbjct: 22  MNLLFVADPVEHFKIYKDTTFAMMREAHRRGHRLAVCEPQQMHWQRGGKVVARVRDITLT 81

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
                ++S GE +   L+    +L+R+DPPF+  Y  +T+LLE+       + N P  +R
Sbjct: 82  GHAVDWFSAGEPREAALADFCAVLMRKDPPFDSEYFYATHLLEQAEREGARVFNKPRALR 141

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF + + PTL++R+   I RF+ E  D+I+KPL G GG G+FR+     N 
Sbjct: 142 DHPEKLAIMEFPQFIGPTLVTREPQDIRRFHAEHGDVILKPLDGMGGMGIFRVGPDGMNL 201

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L +   + +M+Q +LP+I DGDKR+L++ GKPV     RIP   + R N+ AGG
Sbjct: 202 GSIIETLNQGGSQSVMVQKFLPEIADGDKRVLIIGGKPVPYCLARIPQGSEVRGNLAAGG 261

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 LT  D  I   +G  L ERGL   G+DVIGD +TEINVTSPTC +EI    G +
Sbjct: 262 LGVARALTARDQQIGDALGPILHERGLLLAGVDVIGDCVTEINVTSPTCFQEIFEQTGCD 321

Query: 302 VASLFWDGIE 311
           VA+LF D +E
Sbjct: 322 VAALFVDALE 331


>gi|52842073|ref|YP_095872.1| glutathione synthetase [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52629184|gb|AAU27925.1| glutathione synthetase [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 320

 Score =  288 bits (738), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 123/317 (38%), Positives = 186/317 (58%), Gaps = 4/317 (1%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  +A+ M+ +  +K  +DST A+   AQ  G+   ++T + LY  D   YA    + + 
Sbjct: 1   MMKLAVLMDPLDQIKPYKDSTVAMIKSAQGLGWSCAYFTLNDLYCCDGGAYARVHEIHIG 60

Query: 64  EKKE-QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
           + +   +    +     L   DVIL+R+DPPF+M YI +TY L+       L+ N P  +
Sbjct: 61  DIESLSWVKTIDLGNKPLRDFDVILMRKDPPFDMEYIYATYALDLAEQEGVLVANKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK F   F    PPT +SRD  Q+  F+   + +I KPL G GG  VF +    +N
Sbjct: 121 RDANEKFFTLNFPHCCPPTFVSRDARQLKEFWQIHQQVIFKPLEGMGGNSVFYVDKEGKN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIR-DGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHA 239
            S ++E+L +   + +M Q Y+P I   GDKRILL+NG+PV   + RIP++ D R N+ A
Sbjct: 181 LSVILEVLTKGQTKCIMAQRYIPDITVSGDKRILLINGEPVPFALARIPAKGDLRGNLAA 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           G + E+  +T+ D  IC++I  +LRE+GL+F GIDVIGDY+TEINVTSPTCIREI    G
Sbjct: 241 GARGEVVAITERDKWICEQIAPALREKGLYFVGIDVIGDYLTEINVTSPTCIREISTETG 300

Query: 300 ENVASLFWDGIEKIKET 316
            ++A  +   +EK+  +
Sbjct: 301 LDIAGEYMRCLEKLHTS 317


>gi|326387936|ref|ZP_08209542.1| glutathione synthetase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207982|gb|EGD58793.1| glutathione synthetase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 320

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 136/314 (43%), Positives = 209/314 (66%), Gaps = 4/314 (1%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ ++++ +  DS+F + L AQ RG+++F+Y    L  +  ++ A+  P+ +
Sbjct: 1   MAIRVAVQMDPLASINIAGDSSFHLMLAAQARGHELFYYDVKSLGWQAGRVTADAAPVKV 60

Query: 63  DEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
                 +Y LGE + IDL S  DV+L+RQDPPF++ YIT+T+LLE++  ETL+VN+P  +
Sbjct: 61  QRVAGDHYELGEMRKIDLGSDADVVLMRQDPPFDLGYITATHLLERLEGETLVVNDPRSV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEM--KDIIIKPLYGNGGTGVFRITLGD 179
           RNSPEK++V +++  MPPTLI+R    +  F  EM    +++KPL+GNGG  VFRI    
Sbjct: 121 RNSPEKVYVLDYARFMPPTLITRSAADVRAFQKEMGTVPVVVKPLHGNGGKAVFRIEADG 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHA 239
            N S+L E+  + +PEP M+Q +LP++ +GDKRI+L++G+ +GA+NR P E + RSN+  
Sbjct: 181 GNLSALAELFGQVWPEPFMVQPFLPEVAEGDKRIVLVDGEVLGAINRKPGEGEFRSNLAV 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGD-YITEINVTSPTCIREIHRNG 298
           GG AE T LT+ + +IC+ +G  L+  GL F GIDVIG  ++TEINVTSPT +  I +  
Sbjct: 241 GGYAEKTGLTEREAEICEALGPELKRLGLVFVGIDVIGGKWLTEINVTSPTGLVAIEKFD 300

Query: 299 GENVASLFWDGIEK 312
           G +     WD IE+
Sbjct: 301 GTDTGGAIWDAIER 314


>gi|89899575|ref|YP_522046.1| glutathione synthetase [Rhodoferax ferrireducens T118]
 gi|89344312|gb|ABD68515.1| glutathione synthase [Rhodoferax ferrireducens T118]
          Length = 315

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 186/315 (59%), Gaps = 3/315 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQ-LYMRDSKIYANTQPLSLD 63
            N+    + + + K+ +D+TFA+  EAQ RG+++    P   ++ R   + A+ + ++L 
Sbjct: 1   MNLLFITDPLESFKIYKDTTFAMMREAQKRGHRVAACEPQDVMWQRGGWVTAHVRDIALT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLL-EKINPETLIVNNPFWIR 122
            + + ++ L + + + L   D IL+R+DPPF+  +  +T+LL +       + N P  +R
Sbjct: 61  GQADAWFELKQTRAVALRDFDAILMRKDPPFDSEFFYATHLLAQAEREGARVFNKPGALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF + + PTL++RD   I RF+ E +DII+KPL G GG G+FR+     N 
Sbjct: 121 DHPEKLAIMEFPQFIGPTLVTRDEADIKRFHAEHRDIILKPLDGMGGMGIFRVGPDGLNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+ E L     + LM+Q +LP+I  GDKR+L++ GKPV     RIP   + R N+ AGG
Sbjct: 181 GSITETLNRHGAQSLMVQKFLPEIVAGDKRVLVIGGKPVPYCLARIPQGGEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L+  DL+I + IG  L  RGL   G+DVIGD +TEINVTSPTC +EI    G +
Sbjct: 241 KGVAQALSARDLEIAQAIGPVLAARGLLLIGLDVIGDSLTEINVTSPTCFQEIFDQTGFD 300

Query: 302 VASLFWDGIEKIKET 316
           VA+ F D +E+   +
Sbjct: 301 VAATFLDALEQAASS 315


>gi|329896499|ref|ZP_08271557.1| Glutathione synthetase [gamma proteobacterium IMCC3088]
 gi|328921716|gb|EGG29089.1| Glutathione synthetase [gamma proteobacterium IMCC3088]
          Length = 316

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 128/306 (41%), Positives = 187/306 (61%), Gaps = 2/306 (0%)

Query: 7   IAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK 66
           I I M+ I+ +  K+DS+ A+   A  RG+ +++  P  L++ +    A+ +PL + E  
Sbjct: 4   IGIVMDPIAEIAYKKDSSLAMLWAASARGWDLWYMEPSDLHVANGVAMASMRPLRVFEDP 63

Query: 67  EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIRNSP 125
             YY L E ++ +LS +DV+L+R+DPPFN  YI +TY+LE      TLIVN    +R+  
Sbjct: 64  NHYYELDETQVKELSSLDVVLMRKDPPFNNEYIYATYILEMAERLGTLIVNRCQSLRDCN 123

Query: 126 EKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSL 185
           EK+F T+F +  P  L+S D  ++  F+    D+I KPL G GG+ +FR+   D N + +
Sbjct: 124 EKMFATQFPQCCPELLVSADNARLKEFHKTHGDVIFKPLDGMGGSAIFRVKEDDPNVNVI 183

Query: 186 IEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGKAE 244
           +E L +   + +M Q YLPQI DGDKRIL++ G+PV     RIPS  + R N+ AGG   
Sbjct: 184 LETLTKFGTQTIMAQRYLPQIVDGDKRILMIKGQPVPYCLARIPSSGETRGNLAAGGSGR 243

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              L+  D  I +++G +L E+GL F G+DVIGDY+TEINVTSPTCIREI+     +VA 
Sbjct: 244 AQPLSDRDRWIAEQVGPTLVEKGLLFVGLDVIGDYLTEINVTSPTCIREINAAYDCDVAG 303

Query: 305 LFWDGI 310
              D I
Sbjct: 304 QLMDVI 309


>gi|226942006|ref|YP_002797080.1| glutathione synthetase [Laribacter hongkongensis HLHK9]
 gi|226716933|gb|ACO76071.1| GshB [Laribacter hongkongensis HLHK9]
          Length = 314

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 119/309 (38%), Positives = 180/309 (58%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A   + ++  K  +DSTFA+   A  RG+Q+F      L+ R+ ++Y    PL+L  
Sbjct: 1   MKVAFIADPLAGFKTYKDSTFAMMEAAAARGHQLFVAGLPDLFAREGRVYLRATPLTLTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIRN 123
           +++ +Y  G  +  DL+  D +++R+DPPF+  Y+ +T+L+           N    IR+
Sbjct: 61  QRDDWYRCGTPQDTDLTAFDAVVMRKDPPFDAEYLYATHLMSVAERLGARCFNRGQAIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ +  +  L  PTL+SRD+ ++  F  E  D I+KPL   GG G+FR++  D N  
Sbjct: 121 HNEKLAILGYPHLTAPTLVSRDMDRLRAFVSEQGDAILKPLDSMGGEGIFRLSARDPNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S++E++ +     LM+Q YLPQI DGDKRILL++GKPV     RIP   + R N+ AGG+
Sbjct: 181 SVLEVMSQHGQRSLMVQRYLPQIADGDKRILLIDGKPVDYCLARIPKAGETRGNLAAGGR 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   L+  D +I + +G  L  +GL   G+DVIGD +TEINVTSPTC REI    G +V
Sbjct: 241 GEARPLSARDREIAEELGPKLAAQGLLLVGLDVIGDCLTEINVTSPTCFREIMDQTGCDV 300

Query: 303 ASLFWDGIE 311
           A  F + +E
Sbjct: 301 AGRFVEALE 309


>gi|54297759|ref|YP_124128.1| glutathione synthetase [Legionella pneumophila str. Paris]
 gi|53751544|emb|CAH12962.1| glutathione synthetase [Legionella pneumophila str. Paris]
          Length = 319

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 122/316 (38%), Positives = 185/316 (58%), Gaps = 4/316 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A+ M+ +  +K  +DST A+   AQ  G+   ++T + LY  D   YA    + + +
Sbjct: 1   MKLAVLMDPLDQIKPYKDSTVAMIKSAQGLGWSCAYFTQNDLYCCDGSAYARVHEIHIGD 60

Query: 65  KKE-QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIR 122
            +   +    +     L   DVIL+R+DPPF+M YI +TY L+       L+ N P  +R
Sbjct: 61  IESLSWVKTIDLGNKPLRDFDVILMRKDPPFDMEYIYATYALDLAEQEGVLVANKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK F   F    PPT +SRD  Q+  F+   + +I KPL G GG  +F +    +N 
Sbjct: 121 DANEKFFTLNFPHCCPPTFVSRDARQLKEFWQIHQQVIFKPLEGMGGNSIFYVDKEGKNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIR-DGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
           S ++E+L +   + +M Q Y+P I   GDKRILL+NG+PV   + RIP++ D R N+ AG
Sbjct: 181 SVILEVLTKGQTKCIMAQRYIPDITVSGDKRILLINGEPVPFALARIPAKGDLRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
            + E+  +T+ D  IC++I  +LRE+GL+F GIDVIGDY+TEINVTSPTCIREI    G 
Sbjct: 241 ARGEVVAITERDKWICEQIAPALREKGLYFVGIDVIGDYLTEINVTSPTCIREISTETGL 300

Query: 301 NVASLFWDGIEKIKET 316
           ++A  +   +EK+  +
Sbjct: 301 DIAGEYMRCLEKLHTS 316


>gi|332187834|ref|ZP_08389568.1| glutathione synthase [Sphingomonas sp. S17]
 gi|332012184|gb|EGI54255.1| glutathione synthase [Sphingomonas sp. S17]
          Length = 320

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 137/313 (43%), Positives = 209/313 (66%), Gaps = 2/313 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M +   +A+QM+ +  + +  DSTFA+ L AQ RG+++FHY    L   D  ++    P+
Sbjct: 1   MTQSLTVAVQMDPMDQINIAGDSTFALMLSAQARGHRLFHYDAGDLNWSDGHLWTKAHPV 60

Query: 61  SLDEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPF 119
           ++      +YS G+   +DL  + DV+L+RQDPPF++ YIT+T+LLE++  +TL+VNNP 
Sbjct: 61  TVQRVAGHHYSFGDPVKLDLGDEADVVLMRQDPPFDLGYITATHLLERVAEKTLVVNNPR 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +RN+PEK+FV ++ + MPPTL++R + +   F  +  +I+IKPL+GNGG  +F++    
Sbjct: 121 SVRNAPEKVFVLDYPQFMPPTLVTRSLEEARAFLAQHGEIVIKPLHGNGGKAIFKVGRDG 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHA 239
            N S+LIE+    Y EP M+Q++LP +  GDKRI+L++G+  GA+NR+P E + RSN+  
Sbjct: 181 ANLSALIEVFNTAYREPHMVQAFLPAVAKGDKRIVLIDGEVAGAINRLPGEGEIRSNLAV 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGD-YITEINVTSPTCIREIHRNG 298
           GG AE T+LT  + +IC  +G  L+ RGL F GIDVIG  ++TEINVTSPT I  I +  
Sbjct: 241 GGSAEKTELTAREREICDVLGPELKRRGLLFVGIDVIGGEWLTEINVTSPTGIVAIEKFD 300

Query: 299 GENVASLFWDGIE 311
           G +VA++ W  IE
Sbjct: 301 GTDVAAMIWSAIE 313


>gi|54294734|ref|YP_127149.1| glutathione synthetase [Legionella pneumophila str. Lens]
 gi|53754566|emb|CAH16050.1| glutathione synthetase [Legionella pneumophila str. Lens]
          Length = 319

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 123/316 (38%), Positives = 183/316 (57%), Gaps = 4/316 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A+ M+ +  +K  +DST A+   AQ  G+   ++T + LY  D   YA    + + +
Sbjct: 1   MKLAVLMDPLDQIKPYKDSTVAMIKSAQGLGWSCAYFTQNDLYCCDGSAYARVHEIHIGD 60

Query: 65  KKE-QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIR 122
            +   +    +     L   DVIL+R+DPPF+M YI +TY L+       L+ N P  +R
Sbjct: 61  IESLSWVKTIDLGNKPLRDFDVILMRKDPPFDMEYIYATYALDLAEQEGVLVANKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK F   F    PPT +SRD  Q+  F+   + +I KPL G GG  VF +    +N 
Sbjct: 121 DANEKFFTLNFPHCCPPTFVSRDARQLKEFWQIHQQVIFKPLEGMGGNSVFYVDKEGKNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIR-DGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
           S ++E+L +   + +M Q Y+P I   GDKRILL+NG PV   + RIP++ D R N+ AG
Sbjct: 181 SVILEVLTKGQTKCIMAQRYIPDITVSGDKRILLINGDPVPFALARIPAKGDLRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
            + E+  +T+ D  IC++I   LRE+GL+F GIDVIGDY+TEINVTSPTCIREI    G 
Sbjct: 241 ARGEVVAITERDKWICEQIAPVLREKGLYFVGIDVIGDYLTEINVTSPTCIREISTETGL 300

Query: 301 NVASLFWDGIEKIKET 316
           ++A  +   +EK+  +
Sbjct: 301 DIAGEYMRCLEKLHAS 316


>gi|299068097|emb|CBJ39311.1| glutathione synthetase (glutathione GSH synthase) [Ralstonia
           solanacearum CMR15]
          Length = 324

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 124/310 (40%), Positives = 182/310 (58%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I   ++ +ST K+ +DSTFA+  EA  RGY I+     QL +  + +     PL+L  
Sbjct: 1   MRILFIVDPLSTFKIYKDSTFAMMREATARGYAIYTCLQSQLTLSGNVVETVATPLALTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
            +  +Y  G+ +++ L+  D +L+R+DPPF+M Y+TST+LLE        + N P  IR+
Sbjct: 61  DEHDWYRAGDPRLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIAERQGARVFNKPQSIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F E   PT+++RD  ++  F+ E  D+I KPL G GG G+FR+     N  
Sbjct: 121 HSEKLAIAQFREFTAPTIVTRDAKRLREFHAEQGDVIFKPLDGMGGAGIFRVGADGMNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           S+IE L       +M Q Y+P IRDGDKRILL+ G PV   + R+P   + R N+ AGG 
Sbjct: 181 SVIETLTHNGTRTVMAQQYIPAIRDGDKRILLIGGSPVPHALARVPMAGEVRGNLAAGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                L++ D  I   +   L +RGL   G+DVIGDY+TE+NVTSPTC +EI +  G NV
Sbjct: 241 GRAQLLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFNV 300

Query: 303 ASLFWDGIEK 312
           A +F D +E+
Sbjct: 301 AGMFIDALER 310


>gi|325914158|ref|ZP_08176511.1| glutathione synthase [Xanthomonas vesicatoria ATCC 35937]
 gi|325539661|gb|EGD11304.1| glutathione synthase [Xanthomonas vesicatoria ATCC 35937]
          Length = 316

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 118/311 (37%), Positives = 187/311 (60%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ LEAQ RG+++ +  P  L +R+ +  A   PLS+
Sbjct: 1   MSLDVVVVMDPIASIKIAKDTTFAMLLEAQRRGHRLHYVRPGGLSLREGRAVAQVAPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            + K+ +++LGE   +      V+L+R+DPP +  ++  T +L         IVN+P  +
Sbjct: 61  RDDKDGWFTLGEFAELAFGPGQVVLMRKDPPVDAEFVYDTQVLSVAQRAGAQIVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLEHGQAVLKPLDGMGGRSIFRSGTGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G+PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGNRKLTLAQRFIPDITAGDKRILLVDGEPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  +R RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|254295446|ref|YP_003061469.1| glutathione synthetase [Hirschia baltica ATCC 49814]
 gi|254043977|gb|ACT60772.1| glutathione synthetase [Hirschia baltica ATCC 49814]
          Length = 314

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 141/314 (44%), Positives = 209/314 (66%), Gaps = 2/314 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA+QM+ +  V    D+TFA+  EAQ RG+  + Y  D L+     + A  +P  +  
Sbjct: 1   MKIAVQMDPLENVNPAGDTTFAMIEEAQSRGFSTWVYGVDDLFYDAGDVKAWARPAKVFR 60

Query: 65  KKEQYYSLGEEKIIDLS-QMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRN 123
           + + +  +GE  ++DL   +DVIL+RQDPPF+M Y+T+ +LLE +  +TL+VN+P W+ +
Sbjct: 61  RDDGHCEIGERVLLDLRVDVDVILMRQDPPFHMGYLTAAHLLELVKEDTLVVNDPAWVAS 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
           SPEK+F   + EL PPTLISR +  I  F  + KDI++KPLYG+GG  V R+   D NF 
Sbjct: 121 SPEKVFPLIYPELQPPTLISRSLEAIQAFRKKHKDIVLKPLYGHGGASVVRVKPDDGNFE 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKA 243
           +L+EM  EK PEP + Q++LP +  GDKRI+L++G+P GA+NR+P E   RSN+  GG A
Sbjct: 181 ALVEMFQEKAPEPFIAQAFLPDVTAGDKRIILVDGEPCGAINRMPPEGAIRSNLVVGGTA 240

Query: 244 ELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVA 303
           + ++LT+ +L+IC +IG  L+ RGL F GIDVIG+Y+TE+NVTSPT  + I +  G +  
Sbjct: 241 QGSELTERELEICAKIGPELKRRGLIFVGIDVIGNYMTEVNVTSPTGAQAIKKMTGIDPV 300

Query: 304 SLFWDGIE-KIKET 316
           +  WD I+ K K++
Sbjct: 301 AKMWDVIQAKFKKS 314


>gi|221133774|ref|ZP_03560079.1| glutathione synthetase [Glaciecola sp. HTCC2999]
          Length = 319

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 119/316 (37%), Positives = 180/316 (56%), Gaps = 2/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IAI M+ I+ +   +D++FA+ LEAQ RGY I +     LY+ +   YA TQ L +
Sbjct: 1   MSLRIAIVMDPIANITPYKDTSFALCLEAQRRGYHIDYIEMQDLYIDNGVPYAKTQSLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            ++ E +Y+LG+ K+  L+  D +L+R+DPP +  +I +T++         L+VN    +
Sbjct: 61  TDQNEDFYTLGDSKVQPLANFDALLMRKDPPVDDQFIYATHIFSLAEKLGVLVVNKSQAL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F   F EL+P TL++RD      F+ +  DII KPL G GG  +FRI     N
Sbjct: 121 RDFNEKLFTAYFPELIPDTLVTRDKALAKAFHAKHHDIICKPLDGMGGASIFRIKEDANN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              +IE L     +  M Q YLP I+DGDKRIL++NG+ +     R+P   + R N+ AG
Sbjct: 181 LGVVIETLTHNGEKLAMFQRYLPAIKDGDKRILIVNGEVMEYCLARLPQGTETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G      ++  D  + + I  +L   G+ F G+DVIGD +TEIN+TSPTC+REI +  G 
Sbjct: 241 GVGRPQPISDSDRALAENIAPTLLAHGILFVGLDVIGDRVTEINITSPTCVREIEKASGV 300

Query: 301 NVASLFWDGIEKIKET 316
           N+    +D IE+   +
Sbjct: 301 NICGKLFDAIEQRVLS 316


>gi|254282123|ref|ZP_04957091.1| glutathione synthase [gamma proteobacterium NOR51-B]
 gi|219678326|gb|EED34675.1| glutathione synthase [gamma proteobacterium NOR51-B]
          Length = 311

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 127/303 (41%), Positives = 188/303 (62%), Gaps = 2/303 (0%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+ I+ +  K+D+T  +   A+ RG+ +F+     L++      A  +PL + +    +Y
Sbjct: 1   MDPIAGINFKKDTTLGLLWAARDRGWSLFYMEQRDLFIDAGVSRAMMRPLQVFDDPNNFY 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRNSPEKIF 129
           +L E    +L+++DVIL+R+DPPF+M +  +T+LLE+  +  TLIVN    +RN  EK+F
Sbjct: 61  ALDEPANRELAELDVILMRKDPPFDMEFFYTTHLLEEAESKGTLIVNRCESLRNCNEKLF 120

Query: 130 VTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEML 189
            T F    PP L+SRD  ++  F+    D+I KPL G GG+ +FR+   D N S ++E L
Sbjct: 121 ATHFPHCCPPLLVSRDPERLRGFHGLHGDVIFKPLDGMGGSNIFRVKPDDPNLSVILESL 180

Query: 190 FEKYPEPLMIQSYLPQIRDGDKRILLLNGKPV-GAVNRIPSEVDNRSNIHAGGKAELTKL 248
            +   E +M Q YLP+I DGDKRIL++NG PV   + RIP   + R N+ AGG   +  L
Sbjct: 181 TQHGSETIMAQKYLPEISDGDKRILMINGTPVPWCLARIPLAGETRGNLAAGGNGRVQPL 240

Query: 249 TKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWD 308
           ++ D  I +++G +LRERGLFF G+DVIGDY+TEINVTSPTC+REI R    ++A     
Sbjct: 241 SERDQWIAEQVGPALRERGLFFVGLDVIGDYLTEINVTSPTCLREIEREASPDIAGSLMS 300

Query: 309 GIE 311
            IE
Sbjct: 301 CIE 303


>gi|332535116|ref|ZP_08410926.1| glutathione synthetase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035434|gb|EGI71932.1| glutathione synthetase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 316

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 192/314 (61%), Gaps = 2/314 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I  + IS   +K+D+ FA+ ++AQ RGY+I++   D L +R  K YA      +
Sbjct: 1   MAIKLGIISDPISGFNIKKDTGFAMMMQAQERGYEIYYMEMDDLSLRKGKSYATASKAQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
               E++Y L E+  I L+ +DVIL+R+DPPF+  YI +TY+LE+     TLI+N P  +
Sbjct: 61  FNNAEKWYELEEKTTIALADLDVILMRKDPPFDTEYIYATYILERAEQEGTLIINKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   FSE  P TL++R   QI  F  + KDII+KPL G GG  +FRI   D N
Sbjct: 121 RDANEKLFTAWFSEHTPDTLVTRSQKQIREFLAQHKDIILKPLDGMGGASIFRIREDDAN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              + E L E      M+Q+Y+P+I+ GDKR+L+++G+ +     RIP   + R N+ AG
Sbjct: 181 IGVICETLTEHGSRFAMVQNYIPEIKQGDKRVLVVDGEVIPYCLARIPQNGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ DL I + +  +L+E+GL F G+D+IGD +TEINVT+PTC+REI      
Sbjct: 241 GRGEARPLSESDLKIAQAVAPTLKEKGLIFVGLDIIGDKLTEINVTAPTCVREIEAAYDI 300

Query: 301 NVASLFWDGIEKIK 314
           ++  + +D IE+  
Sbjct: 301 SITGILFDAIERKL 314


>gi|148359393|ref|YP_001250600.1| glutathione synthetase [Legionella pneumophila str. Corby]
 gi|296107439|ref|YP_003619139.1| glutathione synthase [Legionella pneumophila 2300/99 Alcoy]
 gi|148281166|gb|ABQ55254.1| glutathione synthetase [Legionella pneumophila str. Corby]
 gi|295649340|gb|ADG25187.1| glutathione synthase [Legionella pneumophila 2300/99 Alcoy]
          Length = 319

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 123/316 (38%), Positives = 185/316 (58%), Gaps = 4/316 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A+ M+ +  +K  +DST A+   AQ  G+   ++T + LY  D   YA    + + +
Sbjct: 1   MKLAVLMDPLDQIKPYKDSTVAMIKSAQGLGWSCAYFTLNDLYCCDGGAYARVHEIHIGD 60

Query: 65  KKE-QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIR 122
            +   +    +     L   DVIL+R+DPPF+M YI +TY L+       L+ N P  +R
Sbjct: 61  IESLSWVKTIDLGNKPLRDFDVILMRKDPPFDMEYIYATYALDLAEQEGVLVANKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK F   F    PPT +SRD  Q+  F+   + +I KPL G GG  VF +    +N 
Sbjct: 121 DANEKFFTLNFPHCCPPTFVSRDARQLKEFWQIHQQVIFKPLEGMGGNSVFYVDKEGKNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIR-DGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
           S ++E+L +   + +M Q Y+P I   GDKRILL+NG+PV   + RIP++ D R N+ AG
Sbjct: 181 SVILEVLTKGQTKCIMAQRYIPDITVSGDKRILLINGEPVPFALARIPAKGDLRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
            + E+  +T+ D  IC++I  +LRE+GL+F GIDVIGDY+TEINVTSPTCIREI    G 
Sbjct: 241 ARGEVVAITERDKWICEQIAPALREKGLYFVGIDVIGDYLTEINVTSPTCIREISTETGL 300

Query: 301 NVASLFWDGIEKIKET 316
           ++A  +   +EK+  +
Sbjct: 301 DIAGEYMRCLEKLHTS 316


>gi|78048790|ref|YP_364965.1| glutathione synthetase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|325927546|ref|ZP_08188782.1| glutathione synthase [Xanthomonas perforans 91-118]
 gi|78037220|emb|CAJ24965.1| glutathione synthetase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|325542085|gb|EGD13591.1| glutathione synthase [Xanthomonas perforans 91-118]
          Length = 316

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 185/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ LEAQ RG+++ +  P  L +R+ +  A   PLS+
Sbjct: 1   MSLDVVVVMDPIASIKIAKDTTFAMLLEAQRRGHRLHYVRPGGLSLREGRAVAQVAPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            E K  +++LGE          V+L+R+DPP +  ++  T +L         IVN+P  +
Sbjct: 61  REDKTGWFTLGEFAERAFGPGQVVLMRKDPPVDAEFVYDTQVLSVAQRAGAQIVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLEHGQAVLKPLDGMGGRSIFRSGSGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G+PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGNRKLTLAQRFIPDITAGDKRILLVDGEPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  +R RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|315127639|ref|YP_004069642.1| glutathione synthetase [Pseudoalteromonas sp. SM9913]
 gi|315016153|gb|ADT69491.1| glutathione synthetase [Pseudoalteromonas sp. SM9913]
          Length = 316

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 191/314 (60%), Gaps = 2/314 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I  + IS   +K+D+ FA+ ++AQ RGY+I++   D L +R    YA      +
Sbjct: 1   MAIKLGIISDPISGFNIKKDTGFAMMMQAQTRGYEIYYMEMDDLSLRQGNAYATAAKAQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            +  +++Y L E++ I L+ +DVIL+R+DPPF+  YI +TY+LE+     TL++N P  +
Sbjct: 61  FDNAQKWYQLEEKETIALADLDVILMRKDPPFDTEYIYATYILERAEQAGTLVINKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   FSE  P TL++R   QI  F  + KDII+KPL G GG  +FR+   D N
Sbjct: 121 RDANEKLFTAWFSEHTPDTLVTRSQKQIREFLAQHKDIILKPLDGMGGASIFRVKADDAN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              + E L E      M Q+Y+P+I  GDKR+L+++G+ +     RIP   + R N+ AG
Sbjct: 181 IGVICETLTEHGSRFAMAQNYIPEITQGDKRVLVVDGEVIPYCLARIPQNGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   +++ DL I K +  +L+E+GL F G+D+IGD +TEINVT+PTC++EI      
Sbjct: 241 GRGEARPISESDLKIAKAVAPTLKEKGLIFVGLDIIGDKLTEINVTAPTCVKEIEAAYDI 300

Query: 301 NVASLFWDGIEKIK 314
           ++  + +D IEK  
Sbjct: 301 SITGILFDAIEKKL 314


>gi|217420040|ref|ZP_03451546.1| glutathione synthase [Burkholderia pseudomallei 576]
 gi|217397344|gb|EEC37360.1| glutathione synthase [Burkholderia pseudomallei 576]
          Length = 318

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 187/315 (59%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P+QL    + + A+ + +++  
Sbjct: 1   MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWTGAGVEADVRRVTIAG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++++Y     +   L     IL+R+DPPF+M Y+TST+LLE        + N P
Sbjct: 61  DTADLHRDRWYEAAARESRALPSFGAILMRKDPPFDMEYVTSTWLLELAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + P+L++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QTIRDHSEKLAIGEFAQFVAPSLVTRDAARLCAFHAEHGDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M+Q ++P+I+ GDKRILL++G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D +I   +G  L  RGL   G+DVIGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGVGVAQPLTERDREIAAALGPVLAARGLLLVGLDVIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA +F D +E+
Sbjct: 301 TGFDVAGMFVDALER 315


>gi|241661840|ref|YP_002980200.1| glutathione synthetase [Ralstonia pickettii 12D]
 gi|240863867|gb|ACS61528.1| glutathione synthetase [Ralstonia pickettii 12D]
          Length = 323

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 122/310 (39%), Positives = 184/310 (59%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I   ++ +ST K  +DSTFA+  EA  RGY I+     QL + ++ +     P++L  
Sbjct: 1   MRILFIVDPLSTFKTYKDSTFAMMREAAARGYAIYTCLQSQLTLANNVVETVATPIALTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
            ++ +Y  G+ +++ L+  D +L+R+DPPF+M Y+TST+LLE        + N P  IR+
Sbjct: 61  DEDDWYRAGDARLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIAERQGARVFNKPQAIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F E   PT++SRD  ++  F+ E  D+I KPL G GG G+FR+     N  
Sbjct: 121 HSEKLAIAQFREFTVPTIVSRDAKRLREFHAEQGDVIFKPLDGMGGAGIFRVGPDGLNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           ++IE L +     +M Q Y+P IR+GDKRILL+ G PV   + R+P   + R N+ AGG 
Sbjct: 181 AVIESLTDNGARTIMAQQYIPAIREGDKRILLIGGSPVPHSLARVPMAGEVRGNLAAGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                L++ D  I   +   L +RGL   G+DVIGDY+TE+NVTSPTC +EI +  G NV
Sbjct: 241 GRAQPLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFNV 300

Query: 303 ASLFWDGIEK 312
           A +F D +E+
Sbjct: 301 AGMFIDALER 310


>gi|187927309|ref|YP_001897796.1| glutathione synthetase [Ralstonia pickettii 12J]
 gi|309779990|ref|ZP_07674744.1| glutathione synthase [Ralstonia sp. 5_7_47FAA]
 gi|187724199|gb|ACD25364.1| glutathione synthetase [Ralstonia pickettii 12J]
 gi|308921349|gb|EFP66992.1| glutathione synthase [Ralstonia sp. 5_7_47FAA]
          Length = 323

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 122/310 (39%), Positives = 184/310 (59%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I   ++ +ST K  +DSTFA+  EA  RGY I+     QL + ++ +     P++L  
Sbjct: 1   MRILFIVDPLSTFKTYKDSTFAMMREAAARGYAIYTCLQSQLTLANNVVETVATPIALTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
            ++ +Y  G+ +++ L+  D +L+R+DPPF+M Y+TST+LLE        + N P  IR+
Sbjct: 61  DEDDWYRAGDARLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIAERQGARVFNKPQAIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F E   PT++SRD  ++  F+ E  D+I KPL G GG G+FR+     N  
Sbjct: 121 HSEKLAIAQFREFTVPTIVSRDAKRLREFHAEQGDVIFKPLDGMGGAGIFRVGPDGLNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           ++IE L +     +M Q Y+P IR+GDKRILL+ G PV   + R+P   + R N+ AGG 
Sbjct: 181 AVIESLTDNGARTIMAQQYIPAIREGDKRILLIGGSPVPHSLARVPMAGEVRGNLAAGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                L++ D  I   +   L +RGL   G+DVIGDY+TE+NVTSPTC +EI +  G NV
Sbjct: 241 GRAQPLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFNV 300

Query: 303 ASLFWDGIEK 312
           A +F D +E+
Sbjct: 301 AGMFIDALER 310


>gi|21243830|ref|NP_643412.1| glutathione synthetase [Xanthomonas axonopodis pv. citri str. 306]
 gi|25008522|sp|Q8PHZ5|GSHB_XANAC RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|21109427|gb|AAM37948.1| glutathione synthetase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 316

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 185/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ LEAQ RG+++ +  P  L +R+ +  A   PLS+
Sbjct: 1   MSLDVVVVMDPIASIKIAKDTTFAMLLEAQRRGHRLHYVRPGGLSLREGRAVAQVAPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            E K  +++LGE   +      V+L+R+DPP +  ++  T +L         IVN+P  +
Sbjct: 61  REDKTSWFTLGEFAELAFGPGQVVLMRKDPPVDAEFVYDTQVLSVAQRAGAQIVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLEHGQAVLKPLDGMGGRSIFRSGSGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGNRKLTLAQRFIPDITAGDKRILLVDGLPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  +R RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|289662012|ref|ZP_06483593.1| glutathione synthetase [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289667041|ref|ZP_06488116.1| glutathione synthetase [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 316

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 185/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ LEAQ RG+++ +  P  L +R+ +  A   PLS+
Sbjct: 1   MSLDVVVVMDPIASIKIAKDTTFAMLLEAQRRGHRLHYVRPGGLSLREGRAVAQVAPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            E K  +++LGE   +      V+L+R+DPP +  ++  T +L         IVN+P  +
Sbjct: 61  REDKTSWFTLGEFAELAFGPGQVVLMRKDPPVDAEFVYDTQVLSVAQRAGAQIVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLEHGQAVLKPLDGMGGRSIFRSGTGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGNRKLTLAQRFIPDITAGDKRILLVDGVPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  +R RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|254472369|ref|ZP_05085769.1| glutathione synthase [Pseudovibrio sp. JE062]
 gi|211958652|gb|EEA93852.1| glutathione synthase [Pseudovibrio sp. JE062]
          Length = 306

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 146/306 (47%), Positives = 220/306 (71%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+HIST+ +  DS FA+ LEAQ RGY+++HYTP++L +   K+    +P+++ ++   ++
Sbjct: 1   MDHISTINIAGDSAFALMLEAQDRGYELYHYTPERLALWGEKVMCRVEPVTVRDEAGNHF 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFV 130
           S GE + +D+S MDV+L+RQDPPF++ YI +T++LEK++  TL+VN+P  +RN+PEK+FV
Sbjct: 61  SFGEPQRVDMSDMDVVLMRQDPPFDLAYIAATHILEKLSKTTLVVNDPISVRNAPEKLFV 120

Query: 131 TEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLF 190
           T+F++LMPPTLI+ D  +I  F  E  DI++KPL+G+GG  VFR+T  D N+ SL +   
Sbjct: 121 TQFADLMPPTLITHDREEIDAFREEHGDIVMKPLFGHGGAAVFRVTQDDLNYGSLYDFFS 180

Query: 191 EKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTK 250
             + EP +IQ +LP ++ GDKRILL++G+  GAVNR+P+E D RSN+  GG  + + LT+
Sbjct: 181 VTFREPWVIQKFLPNVKHGDKRILLVDGEFAGAVNRVPAEGDLRSNMVRGGSPKDSDLTE 240

Query: 251 IDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGI 310
            + +IC R+G +L+E+GL   GIDVI   +TEINVT+PT IR I + GG +VA   WD +
Sbjct: 241 REREICARLGPTLKEQGLILVGIDVIDGNLTEINVTAPTGIRAIQKLGGPDVAGRVWDVL 300

Query: 311 EKIKET 316
           E   E+
Sbjct: 301 ESKLES 306


>gi|238021899|ref|ZP_04602325.1| hypothetical protein GCWU000324_01803 [Kingella oralis ATCC 51147]
 gi|237866513|gb|EEP67555.1| hypothetical protein GCWU000324_01803 [Kingella oralis ATCC 51147]
          Length = 368

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 105/320 (32%), Positives = 176/320 (55%), Gaps = 6/320 (1%)

Query: 2   KKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
           K   NI    + +++ K  +D+T+A+  EA  RG+ +FH    QL +++  + A    + 
Sbjct: 47  KAPMNILFIADPLASFKTYKDTTYAMMREAAARGHTLFHTLAAQLSVQNGSVVAQASQIQ 106

Query: 62  L----DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVN 116
                D+    ++     + + L++ + I++R DPPFNM Y  ST LL         + N
Sbjct: 107 FLGAKDDHDHAWFQAAPAQSLALTEFNAIIMRTDPPFNMQYFYSTQLLTLAEQQGARVFN 166

Query: 117 NPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRIT 176
           +   +R+  EK+ +  + +   PT+++     + +F  E  DII+KPL G GG G+FR+ 
Sbjct: 167 SGQAMRDYNEKLAILNYPQFTAPTIVTTRAANVRQFLAEHGDIIVKPLDGMGGMGIFRLR 226

Query: 177 LGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRS 235
             D N  S++E L +     +M Q YLP I  GDKRIL+++G+ +   + RIP   + R 
Sbjct: 227 ESDPNIGSILETLMQLDSRTIMAQRYLPAIVHGDKRILIIDGEVIPYALARIPQNGETRG 286

Query: 236 NIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIH 295
           N+ AGG+    +L++ D +I + +   L+  G+   G+DVIGD +TEINVTSPT  +EI 
Sbjct: 287 NLAAGGRGVAQELSERDREIAQTLAPQLKAHGILLAGLDVIGDCLTEINVTSPTGFQEIM 346

Query: 296 RNGGENVASLFWDGIEKIKE 315
           +  G +VA+ F D +E+  +
Sbjct: 347 KQTGFDVAAQFVDAVERNAQ 366


>gi|78067661|ref|YP_370430.1| glutathione synthetase [Burkholderia sp. 383]
 gi|77968406|gb|ABB09786.1| glutathione synthase [Burkholderia sp. 383]
          Length = 318

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 117/315 (37%), Positives = 178/315 (56%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
            +I    + +   K+ +DST+A+  EA  RG+ ++   P+ L    S + A+ + ++   
Sbjct: 1   MDILFIADPLERFKIYKDSTYAMMAEAARRGHAVYACEPNHLAWTGSAVEADVRRITFVG 60

Query: 65  KKEQ-----YYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
             +      +Y  G      L     +L+R+DPPF+M Y+TST+LLE        + N  
Sbjct: 61  DPDDLHRETWYEAGPVDARRLESFGAVLMRKDPPFDMEYVTSTWLLELAERAGARVFNKA 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAKRLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M Q ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGTRSVMAQKFIPEIKAGDKRILLIGGEPVPFSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I + +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTARDREIAETLGPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|171060579|ref|YP_001792928.1| glutathione synthetase [Leptothrix cholodnii SP-6]
 gi|170778024|gb|ACB36163.1| glutathione synthetase [Leptothrix cholodnii SP-6]
          Length = 315

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 181/311 (58%), Gaps = 4/311 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDS-KIYANT-QPLSL 62
            ++    + I + K+ +DSTFA+  EA  RG+++    P  L  +   ++ A   + L L
Sbjct: 1   MDLLFVADPIESFKIHKDSTFAMMREAARRGHRLHVCEPRDLVWKQGARVVARAARTLVL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
               E++Y +   + + L+    +L+R+DPPF+  +I +T+LL++       + N+P  +
Sbjct: 61  TGDAERWYEVVATQELALADASAVLMRKDPPFDAEFIYATHLLQQAEREGARVFNSPQAL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+ PEK+ +  F++ + PTL++RD   I  F+ E +DII+KPL G GG G+FR+     N
Sbjct: 121 RDHPEKLAILAFAQFIGPTLVTRDAAAIRAFHAEQRDIILKPLDGMGGMGIFRVGPDGLN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
             S+IE L +     +M+Q YLP+I  GDKRILL+ G PV     RIP   + R N+ AG
Sbjct: 181 LGSIIETLNQHGATTVMVQRYLPEIVKGDKRILLIGGVPVPFCLARIPQGSEIRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           GK     L+  D +I + IG  L  RGL   G+DVIGD +TEINVTSPTC +EI    G 
Sbjct: 241 GKGVAQPLSARDREIAEAIGPVLAARGLLLVGLDVIGDCVTEINVTSPTCFQEITDQTGF 300

Query: 301 NVASLFWDGIE 311
           +VA+ F D +E
Sbjct: 301 DVAARFIDALE 311


>gi|254295993|ref|ZP_04963450.1| glutathione synthase [Burkholderia pseudomallei 406e]
 gi|157805948|gb|EDO83118.1| glutathione synthase [Burkholderia pseudomallei 406e]
          Length = 318

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 187/315 (59%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P+QL    + + A+ + +++  
Sbjct: 1   MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWTGAGVEADVRRVTIAG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++++Y     +   L     IL+R+DPPF+M Y+TST+LLE        + N P
Sbjct: 61  DTADLHRDRWYEAAARESHALPSFGAILMRKDPPFDMEYVTSTWLLELAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + P+L++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QTIRDHSEKLAIGEFAQFVAPSLVTRDAARLRAFHAEHGDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M+Q ++P+I+ GDKRILL++G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D +I   +G  L  RGL   G+DVIGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGVGVAQPLTERDREIAAALGPVLAARGLLLVGLDVIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA +F D +E+
Sbjct: 301 TGFDVAGMFVDALER 315


>gi|262380539|ref|ZP_06073693.1| glutathione synthase [Acinetobacter radioresistens SH164]
 gi|262297985|gb|EEY85900.1| glutathione synthase [Acinetobacter radioresistens SH164]
          Length = 314

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 129/309 (41%), Positives = 191/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I  V +K+DST A+   A  RG+++ +     LY+   K +    PL + E
Sbjct: 1   MRVLVVMDPIENVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAWGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE++   ++  DV+L+R+DPPF+M+++ +TY+LE+       IVN P  +R+
Sbjct: 61  DYNHYYELGEKQKESIAAYDVVLMRKDPPFDMNFVYTTYILEQAEQEGARIVNKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++     I  F  E +D+I+KPL G GG G+FR++    N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQQLIREFIAEHQDVIVKPLDGMGGAGIFRLSATGANIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML +   +P+M Q Y+P+I DGDKRIL++NG+PV     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTQLGQQPIMAQRYIPEIVDGDKRILMINGEPVPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GEARPLTENDKVIAAKVGPYLREKGLIFVGLDVIGNYVTEINVTSPTCIREIDNQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   ++ +E
Sbjct: 301 ADDLFEVLE 309


>gi|327482649|gb|AEA85959.1| glutathione synthetase [Pseudomonas stutzeri DSM 4166]
          Length = 316

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 183/310 (59%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+ +  K+DS+ A+ L AQ R + +F+     LY   ++  A  + L +
Sbjct: 1   MTVRVGIIMDPIAQIAFKKDSSLAMLLAAQARSWTLFYMEQRDLYQLGNQARARMRSLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
               + ++  GEE  + L+ +DVIL+R+DPPFN  Y+ +TYLLE      TL+VN P  +
Sbjct: 61  FNDPQHWFETGEEVDMALADLDVILMRKDPPFNSEYVYATYLLELAEKAGTLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK F T+F +  PPTL+SR    +  F  E +DII+KPL   GG  +FR   GD N
Sbjct: 121 RDCNEKFFATQFPQCTPPTLVSRRSDILREFANEHRDIILKPLDEMGGASIFRHREGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E+L E     +M Q Y+P I+DGDKRIL+++G+P+     RIP+  + R N+ AG
Sbjct: 181 LSVILEVLTEHGSRQIMAQRYIPAIKDGDKRILMIDGEPIPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L+  D +I   +G  LRERGL F G+DVIGDY+TEIN+TSPTCIREI      
Sbjct: 241 GRGVAQPLSDRDREIAAIVGPQLRERGLLFVGLDVIGDYLTEINITSPTCIREIDNAFDT 300

Query: 301 NVASLFWDGI 310
            +     D I
Sbjct: 301 RIGERLMDAI 310


>gi|262370855|ref|ZP_06064179.1| glutathione synthetase [Acinetobacter johnsonii SH046]
 gi|262314217|gb|EEY95260.1| glutathione synthetase [Acinetobacter johnsonii SH046]
          Length = 314

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 193/314 (61%), Gaps = 2/314 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K +    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQHDLYIDQGKAFGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
             + Y+ LGE++   L+  DVIL+R+DPPF+M+++ +TY+LE+       I+N P  +R+
Sbjct: 61  DYDHYFELGEQQKESLADYDVILMRKDPPFDMNFVYTTYILEQAEREGAWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFIKEHGDVIVKPLDGMGGMGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRILL+NG+P+     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTEMGTRPIMAQRYIPEIVEGDKRILLVNGEPIPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKAIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIEKIKET 316
           A   +D +E  K +
Sbjct: 301 ADTLFDILEAGKAS 314


>gi|114797474|ref|YP_759031.1| glutathione synthetase [Hyphomonas neptunium ATCC 15444]
 gi|114737648|gb|ABI75773.1| glutathione synthase [Hyphomonas neptunium ATCC 15444]
          Length = 316

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 146/309 (47%), Positives = 207/309 (66%), Gaps = 1/309 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               IAIQM+ +  V +  D++FA+A  AQ RG  IF Y P  L  R+ ++ A  +P  +
Sbjct: 1   MTLRIAIQMDPLERVNIDGDTSFALAEVAQARGADIFVYGPGDLSFREGRVTAWARPAKV 60

Query: 63  DEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
              +E     G  + +D+   +DV+L+RQDPPF+M YIT+ +LLE +  +TL+VN+P  +
Sbjct: 61  QRVRETPGIFGPHQRLDIARDVDVVLMRQDPPFDMAYITACHLLESVTNQTLVVNDPAGV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+SPEKIF   F E+MPPTL++RD   I  F  E +DII+KPL+G+GG GVFR+   D N
Sbjct: 121 RSSPEKIFPLMFPEIMPPTLVTRDRQVIDAFREEYRDIIVKPLHGHGGAGVFRLKHDDSN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
             SL+E+ F + PEPLM+Q++LP + +GDKRI+L++G+PVGA+NR P     RSN+  GG
Sbjct: 181 LDSLLELFFARSPEPLMVQAFLPAVSEGDKRIILIDGEPVGAINRRPKAGQVRSNLVVGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
            AE T+L+  D +IC+ IG  LR RGL  TGIDVIG  +TE+NVTSPT ++ + R  G +
Sbjct: 241 TAEATELSGADKNICEAIGPELRRRGLTLTGIDVIGGRLTEVNVTSPTGVQALKRLSGID 300

Query: 302 VASLFWDGI 310
            A+ FWD +
Sbjct: 301 AAAKFWDVV 309


>gi|209519796|ref|ZP_03268581.1| glutathione synthetase [Burkholderia sp. H160]
 gi|209499739|gb|EDZ99809.1| glutathione synthetase [Burkholderia sp. H160]
          Length = 318

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 113/315 (35%), Positives = 180/315 (57%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL---- 60
            +I    + +S  K+ +D+T+A+  EA  RG+ ++   P  L      + AN Q +    
Sbjct: 1   MDILFIADPLSHFKIYKDTTYAMMAEAARRGHTVYVCEPRHLAWTGGDVEANVQRIAIVG 60

Query: 61  -SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPET-LIVNNP 118
            ++D  ++ +++        L+    +++R+DPPF+M Y+TST+LL         I N P
Sbjct: 61  DTVDLHRDVWFAADPAAPRGLASFGAVVMRKDPPFDMEYVTSTWLLGLAERGGARIFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + PTL++RD  ++  F+ +  D+I+KPL G GG GVFR+   
Sbjct: 121 QAIRDHSEKLAIGEFAQFVAPTLVTRDPARLRAFHEQHGDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M Q ++P+I++GDKRILL+ G+ V   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARSVMAQKFIPEIKEGDKRILLIGGEAVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      L++ D  I   +   L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVARPLSEQDRKIADTLAPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMDQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFVDALER 315


>gi|149184520|ref|ZP_01862838.1| glutathione synthetase [Erythrobacter sp. SD-21]
 gi|148831840|gb|EDL50273.1| glutathione synthetase [Erythrobacter sp. SD-21]
          Length = 322

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 134/319 (42%), Positives = 208/319 (65%), Gaps = 7/319 (2%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRD-----SKIYANT 57
               +A+QM+ + ++K+  DS+FA+ L AQ RG++++HY    L  +       KI A+ 
Sbjct: 1   MTLRVAVQMDPLESIKIAGDSSFALMLSAQERGHEVWHYDVSSLAWQSDGTPAGKITAHA 60

Query: 58  QPLSLDEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVN 116
            P+++   +  ++S GE + IDL   +DVIL+RQDPPF++ YI++ +LL+++   TL++N
Sbjct: 61  APVTVQRVEGDHFSAGERRRIDLAQDIDVILMRQDPPFHLGYISAAFLLDRLKGTTLVIN 120

Query: 117 NPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRIT 176
           +P  + N+PEK+FV +++  MPPT+I+R +  +  F  E   ++IKPL+GNGG  +FR+ 
Sbjct: 121 DPREVVNAPEKMFVLDYARFMPPTMIARHLDDLKAFQQEHGSVVIKPLHGNGGKAIFRLD 180

Query: 177 LGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSN 236
               N S+L E+    +PEP MIQ +LP++ +GDKRI+L++G+  GA+NR P E + RSN
Sbjct: 181 ADGTNLSALSEVFDMTWPEPHMIQPFLPEVSEGDKRIVLVDGEFAGAINRFPGEGEFRSN 240

Query: 237 IHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGD-YITEINVTSPTCIREIH 295
           +  GG AE   LT  + +IC  +G  L++RGL F GIDVIG  ++TEINVTSPT I  I 
Sbjct: 241 LAQGGHAESATLTPREEEICTAMGPELKKRGLVFVGIDVIGGKWLTEINVTSPTGIVAID 300

Query: 296 RNGGENVASLFWDGIEKIK 314
           +  G + A L WD IE+  
Sbjct: 301 KFNGTDTAGLIWDAIERRH 319


>gi|90415254|ref|ZP_01223188.1| glutathione synthetase [marine gamma proteobacterium HTCC2207]
 gi|90332577|gb|EAS47747.1| glutathione synthetase [marine gamma proteobacterium HTCC2207]
          Length = 317

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 121/306 (39%), Positives = 193/306 (63%), Gaps = 2/306 (0%)

Query: 7   IAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK 66
           + + M+ I ++   +DST AI L AQ +G+++F+     LY+ ++   A  +PL +    
Sbjct: 5   LGVIMDPIQSISFYKDSTLAILLAAQAQGFELFYMEQSDLYIDNTGPKAQLRPLKVFNDA 64

Query: 67  EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRNSP 125
            +++ LG+ +   L +MDV+++R+DPPF+  +I STY+LE      +L+VN P  +R+  
Sbjct: 65  NKWFELGDSRDAALEEMDVLVMRKDPPFDSEFIYSTYILEAAERRGSLVVNKPQSLRDCN 124

Query: 126 EKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSL 185
           EK+F TEF +  PP L+SRD  ++  F  E +D++ KPL G GGT +FR+  GD+N + +
Sbjct: 125 EKVFATEFPQCTPPLLVSRDQERLKGFLTEHQDVVYKPLDGMGGTSIFRVKEGDQNLNVI 184

Query: 186 IEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGKAE 244
           +E + ++  E +M Q ++PQI  GDKRIL++ G+ +     RIP+  D R N+ AGG+  
Sbjct: 185 LETVTKQGTETIMAQKFMPQITQGDKRILVVGGEIIPFCLARIPTGSDFRGNLAAGGRGV 244

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
           +  L++ DL I +++  +L+ERGL F G+DVIGDY+TEINVTSPTCIREI       +  
Sbjct: 245 VQPLSERDLWIAQQVAPTLKERGLIFVGLDVIGDYLTEINVTSPTCIREIDNAENTQIGK 304

Query: 305 LFWDGI 310
              D +
Sbjct: 305 RLIDAV 310


>gi|255320033|ref|ZP_05361229.1| glutathione synthase [Acinetobacter radioresistens SK82]
 gi|255302901|gb|EET82122.1| glutathione synthase [Acinetobacter radioresistens SK82]
          Length = 314

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 129/309 (41%), Positives = 191/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I  V +K+DST A+   A  RG+++ +     LY+   K +    PL + E
Sbjct: 1   MRVLVVMDPIENVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAWGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE++   ++  DV+L+R+DPPF+M+++ +TY+LE+       IVN P  +R+
Sbjct: 61  DYNHYYELGEKQKESIAAYDVVLMRKDPPFDMNFVYTTYILEQAEREGARIVNKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++     I  F  E +D+I+KPL G GG G+FR++    N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQQLIREFIAEHQDVIVKPLDGMGGAGIFRLSATGANIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML +   +P+M Q Y+P+I DGDKRIL++NG+PV     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTQLGQQPIMAQRYIPEIVDGDKRILMINGEPVPYCLARIPQNGEIRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GEARLLTENDKAIAAKVGPYLREKGLIFVGLDVIGNYVTEINVTSPTCIREIDNQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   ++ +E
Sbjct: 301 ADDLFEALE 309


>gi|114571555|ref|YP_758235.1| glutathione synthetase [Maricaulis maris MCS10]
 gi|114342017|gb|ABI67297.1| glutathione synthase [Maricaulis maris MCS10]
          Length = 316

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 153/316 (48%), Positives = 219/316 (69%), Gaps = 3/316 (0%)

Query: 4   IR--NIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
           +    +A+QM+ I TV V  D+TFA+  EAQ RG ++F Y PDQL  ++ +I A  +P+ 
Sbjct: 1   MMAWRVAVQMDPIETVNVDADTTFALMEEAQARGAELFVYHPDQLAWQEGRIMARARPVR 60

Query: 62  LDEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
           +   + ++  LGE + +DL S +DVIL+RQDPPF+M Y T+ +LLE +  +TL++N+PFW
Sbjct: 61  VKHIQGEHADLGEVRTLDLASDVDVILMRQDPPFDMAYQTAAHLLEMLKGQTLVLNDPFW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +R+SPEKI    + E++PPTLI+RD+T +T F    +DIIIKPLYGNGG GVFR+  GD 
Sbjct: 121 VRSSPEKILPLLYPEIIPPTLITRDLTALTGFRDRHEDIIIKPLYGNGGAGVFRLKPGDG 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           NFS+L+E  F +  EP++ Q++LP +  GDKRIL+++G PVGA+NR+P     RSN+H G
Sbjct: 181 NFSALLETFFAQSREPVIAQAFLPAVSAGDKRILIIDGVPVGAINRVPQSGQTRSNMHVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G AE + L+  D+ IC  IG  L+ER L   GIDVIGD +TEINVTSPT ++E+ R  G 
Sbjct: 241 GVAEPSDLSDSDMRICDAIGPILKERDLVLVGIDVIGDRLTEINVTSPTGVQELKRFSGV 300

Query: 301 NVASLFWDGIEKIKET 316
           +  + FWD + +   +
Sbjct: 301 DACAAFWDAVARRIGS 316


>gi|170747305|ref|YP_001753565.1| glutathione synthetase [Methylobacterium radiotolerans JCM 2831]
 gi|170653827|gb|ACB22882.1| glutathione synthetase [Methylobacterium radiotolerans JCM 2831]
          Length = 318

 Score =  285 bits (728), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 144/309 (46%), Positives = 216/309 (69%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ I  +++  D+TFA+ LEAQ RG+ + +YTPD+L M+  ++ A  + L +
Sbjct: 1   MSLTVAVQMDPIQNIRIAGDTTFALLLEAQRRGHALVYYTPDRLSMQGRRVTARVERLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIR 122
            + +  +++L   + +DL++ DV+L+RQDPPF+M YIT+T++LE+I+PETL+VN+PF +R
Sbjct: 61  QDVEGAHFTLAPPERLDLAEADVVLMRQDPPFDMAYITATHMLERIHPETLVVNDPFEVR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           N+PEK+FV +F ELMPPTLISRD  +I  F LE   + +KPL+G+GG  VF++T  D NF
Sbjct: 121 NAPEKLFVLDFPELMPPTLISRDKAEIEAFRLEHGTVAMKPLHGHGGAAVFKVTEKDPNF 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGK 242
            S+ ++    + E  ++Q YL ++ +GDKRI+L++G  +GAVNR+P+  D RSN+  GG 
Sbjct: 181 GSMFDLFATTFREAWVVQRYLDRVTEGDKRIILVDGVAMGAVNRVPAANDIRSNMVRGGA 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
           A  ++LT  + +IC  IG  L  RGL   GIDVI  ++TEINVTSPT IR I R GG ++
Sbjct: 241 ASASELTDREREICATIGPELARRGLILVGIDVIDGHLTEINVTSPTGIRAIQRLGGPDL 300

Query: 303 ASLFWDGIE 311
           +   WD IE
Sbjct: 301 SVAVWDAIE 309


>gi|53718076|ref|YP_107062.1| glutathione synthetase [Burkholderia pseudomallei K96243]
 gi|53724531|ref|YP_104690.1| glutathione synthetase [Burkholderia mallei ATCC 23344]
 gi|67640742|ref|ZP_00439538.1| glutathione synthase [Burkholderia mallei GB8 horse 4]
 gi|76811390|ref|YP_332069.1| glutathione synthetase [Burkholderia pseudomallei 1710b]
 gi|121601530|ref|YP_991539.1| glutathione synthetase [Burkholderia mallei SAVP1]
 gi|124384322|ref|YP_001027387.1| glutathione synthetase [Burkholderia mallei NCTC 10229]
 gi|126441625|ref|YP_001057524.1| glutathione synthetase [Burkholderia pseudomallei 668]
 gi|126448929|ref|YP_001082352.1| glutathione synthetase [Burkholderia mallei NCTC 10247]
 gi|126451986|ref|YP_001064773.1| glutathione synthetase [Burkholderia pseudomallei 1106a]
 gi|167001978|ref|ZP_02267768.1| glutathione synthase [Burkholderia mallei PRL-20]
 gi|167717902|ref|ZP_02401138.1| glutathione synthetase [Burkholderia pseudomallei DM98]
 gi|167736919|ref|ZP_02409693.1| glutathione synthetase [Burkholderia pseudomallei 14]
 gi|167814025|ref|ZP_02445705.1| glutathione synthetase [Burkholderia pseudomallei 91]
 gi|167844128|ref|ZP_02469636.1| glutathione synthetase [Burkholderia pseudomallei B7210]
 gi|167901128|ref|ZP_02488333.1| glutathione synthetase [Burkholderia pseudomallei NCTC 13177]
 gi|167909348|ref|ZP_02496439.1| glutathione synthetase [Burkholderia pseudomallei 112]
 gi|167917377|ref|ZP_02504468.1| glutathione synthetase [Burkholderia pseudomallei BCC215]
 gi|226193689|ref|ZP_03789292.1| glutathione synthase [Burkholderia pseudomallei Pakistan 9]
 gi|237810676|ref|YP_002895127.1| glutathione synthase [Burkholderia pseudomallei MSHR346]
 gi|242316224|ref|ZP_04815240.1| glutathione synthase [Burkholderia pseudomallei 1106b]
 gi|254174941|ref|ZP_04881602.1| glutathione synthetase [Burkholderia mallei ATCC 10399]
 gi|254181957|ref|ZP_04888554.1| glutathione synthase [Burkholderia pseudomallei 1655]
 gi|254187888|ref|ZP_04894400.1| glutathione synthase [Burkholderia pseudomallei Pasteur 52237]
 gi|254196390|ref|ZP_04902814.1| glutathione synthase [Burkholderia pseudomallei S13]
 gi|254201785|ref|ZP_04908149.1| glutathione synthetase [Burkholderia mallei FMH]
 gi|254207116|ref|ZP_04913467.1| glutathione synthetase [Burkholderia mallei JHU]
 gi|254258100|ref|ZP_04949154.1| glutathione synthase [Burkholderia pseudomallei 1710a]
 gi|254357601|ref|ZP_04973875.1| glutathione synthetase [Burkholderia mallei 2002721280]
 gi|52208490|emb|CAH34425.1| glutathione synthetase [Burkholderia pseudomallei K96243]
 gi|52427954|gb|AAU48547.1| glutathione synthetase [Burkholderia mallei ATCC 23344]
 gi|76580843|gb|ABA50318.1| glutathione synthase [Burkholderia pseudomallei 1710b]
 gi|121230340|gb|ABM52858.1| glutathione synthetase [Burkholderia mallei SAVP1]
 gi|124292342|gb|ABN01611.1| glutathione synthase [Burkholderia mallei NCTC 10229]
 gi|126221118|gb|ABN84624.1| glutathione synthase [Burkholderia pseudomallei 668]
 gi|126225628|gb|ABN89168.1| glutathione synthase [Burkholderia pseudomallei 1106a]
 gi|126241799|gb|ABO04892.1| glutathione synthase [Burkholderia mallei NCTC 10247]
 gi|147747679|gb|EDK54755.1| glutathione synthetase [Burkholderia mallei FMH]
 gi|147752658|gb|EDK59724.1| glutathione synthetase [Burkholderia mallei JHU]
 gi|148026665|gb|EDK84750.1| glutathione synthetase [Burkholderia mallei 2002721280]
 gi|157935568|gb|EDO91238.1| glutathione synthase [Burkholderia pseudomallei Pasteur 52237]
 gi|160695986|gb|EDP85956.1| glutathione synthetase [Burkholderia mallei ATCC 10399]
 gi|169653133|gb|EDS85826.1| glutathione synthase [Burkholderia pseudomallei S13]
 gi|184212495|gb|EDU09538.1| glutathione synthase [Burkholderia pseudomallei 1655]
 gi|225934267|gb|EEH30251.1| glutathione synthase [Burkholderia pseudomallei Pakistan 9]
 gi|237505271|gb|ACQ97589.1| glutathione synthase [Burkholderia pseudomallei MSHR346]
 gi|238521515|gb|EEP84966.1| glutathione synthase [Burkholderia mallei GB8 horse 4]
 gi|242139463|gb|EES25865.1| glutathione synthase [Burkholderia pseudomallei 1106b]
 gi|243062304|gb|EES44490.1| glutathione synthase [Burkholderia mallei PRL-20]
 gi|254216789|gb|EET06173.1| glutathione synthase [Burkholderia pseudomallei 1710a]
          Length = 318

 Score =  284 bits (727), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 187/315 (59%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P+QL    + + A+ + +++  
Sbjct: 1   MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWTGAGVEADVRRVTIAG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++++Y     +   L     IL+R+DPPF+M Y+TST+LLE        + N P
Sbjct: 61  DTADLHRDRWYEAAARESRALPSFGAILMRKDPPFDMEYVTSTWLLELAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + P+L++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QTIRDHSEKLAIGEFAQFVAPSLVTRDAARLRAFHAEHGDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M+Q ++P+I+ GDKRILL++G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D +I   +G  L  RGL   G+DVIGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGVGVAQPLTERDREIAAALGPVLAARGLLLVGLDVIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA +F D +E+
Sbjct: 301 TGFDVAGMFVDALER 315


>gi|146284266|ref|YP_001174419.1| glutathione synthetase [Pseudomonas stutzeri A1501]
 gi|145572471|gb|ABP81577.1| glutathione synthetase [Pseudomonas stutzeri A1501]
          Length = 316

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 183/310 (59%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I+ +  K+DS+ A+ L AQ R + +F+     LY   ++  A  + L +
Sbjct: 1   MTVRVGIIMDPIAQIAFKKDSSLAMLLAAQARSWTLFYMEQRDLYQLGNQARARMRSLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
               + ++  GEE  + L+ +DVIL+R+DPPFN  Y+ +TYLLE      TL+VN P  +
Sbjct: 61  FNDPKHWFETGEEVDMALADLDVILMRKDPPFNSEYVYATYLLELAEKAGTLVVNRPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK F T+F +  PPTL+SR    +  F  E +DII+KPL   GG  +FR   GD N
Sbjct: 121 RDCNEKFFATQFPQCTPPTLVSRRSDILREFANEHRDIILKPLDEMGGASIFRHREGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            S ++E+L E     +M Q Y+P I+DGDKRIL+++G+P+     RIP+  + R N+ AG
Sbjct: 181 LSVILEVLTEHGSRQIMAQRYIPAIKDGDKRILMIDGEPIPYCLARIPAAGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L+  D +I   +G  LRERGL F G+DVIGDY+TEIN+TSPTCIREI      
Sbjct: 241 GRGVAQPLSDRDREIAAIVGPQLRERGLLFVGLDVIGDYLTEINITSPTCIREIDNAFDT 300

Query: 301 NVASLFWDGI 310
            +     D I
Sbjct: 301 RIGERLMDAI 310


>gi|285019006|ref|YP_003376717.1| glutathione synthetase [Xanthomonas albilineans GPE PC73]
 gi|283474224|emb|CBA16725.1| putative glutathione synthetase protein [Xanthomonas albilineans]
          Length = 316

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 114/311 (36%), Positives = 181/311 (58%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ LEAQ RG+++ +  P  L +RD +  A   PL +
Sbjct: 1   MPFDVIVVMDPIASIKIAKDTTFAMLLEAQRRGHRLHYVRPGGLSLRDGRALAQAAPLRV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            + K  ++ L     +      V+L+R+DPPF+  ++  T++L         +VN+P  +
Sbjct: 61  RDDKTGWFELDAFADLAFGPGQVVLMRKDPPFDAQFLYDTHVLSVAQRAGAQVVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDFNEKLAALLFPQCCPPTLVSRDAAALKAFVLEHGQAVLKPLDGMGGRSIFRSGNGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +      + Q ++P I  GDKRILL++G  V     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGGRTLALAQRFIPAISAGDKRILLVDGVAVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  ++ RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRSLSERDRWIAAQVGPEMKRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQYGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|134279708|ref|ZP_01766420.1| glutathione synthase [Burkholderia pseudomallei 305]
 gi|134248908|gb|EBA48990.1| glutathione synthase [Burkholderia pseudomallei 305]
          Length = 318

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 187/315 (59%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P+QL    + + A+ + +++  
Sbjct: 1   MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWTGAGVEADVRRVTIAG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++++Y     +   L     IL+R+DPPF+M Y+TST+LLE        + N P
Sbjct: 61  DTADLHRDRWYEAAARESRALPSFGAILMRKDPPFDMEYVTSTWLLELAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + P+L++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QTIRDHSEKLAIGEFAQFVAPSLVTRDAARLRAFHAEHGDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M+Q ++P+I+ GDKRILL++G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARSVMVQKFIPEIKTGDKRILLIDGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D +I   +G  L  RGL   G+DVIGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGVGVAQPLTERDREIAAALGPVLAARGLLLVGLDVIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA +F D +E+
Sbjct: 301 TGFDVAGMFVDALER 315


>gi|325123867|gb|ADY83390.1| glutathione synthetase [Acinetobacter calcoaceticus PHEA-2]
          Length = 314

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 133/309 (43%), Positives = 192/309 (62%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+
Sbjct: 61  DYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GGTG+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFIKEHGDVIVKPLDGMGGTGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+PV     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTELGNRPIMAQRYIPEIVEGDKRILMVNGEPVPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  +IG  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKLIAAKIGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   +D +E
Sbjct: 301 ADDLFDVLE 309


>gi|83720937|ref|YP_440968.1| glutathione synthetase [Burkholderia thailandensis E264]
 gi|167579684|ref|ZP_02372558.1| glutathione synthetase [Burkholderia thailandensis TXDOH]
 gi|167617761|ref|ZP_02386392.1| glutathione synthetase [Burkholderia thailandensis Bt4]
 gi|257140378|ref|ZP_05588640.1| glutathione synthetase [Burkholderia thailandensis E264]
 gi|83654762|gb|ABC38825.1| glutathione synthase [Burkholderia thailandensis E264]
          Length = 318

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 187/315 (59%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P+QL    + + A+ + +++  
Sbjct: 1   MDILFIADPLERFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWTGAGVEADVRRVAIAG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++++Y  G  +   L     IL+R+DPPF+M Y+TST+LLE        + N P
Sbjct: 61  DTADLHRDRWYEAGPRESRALPSFGAILMRKDPPFDMEYVTSTWLLELAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + P+L++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QTIRDHSEKLAIGEFAQFVAPSLVTRDAARLRAFHAEHGDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M+Q ++P+I+ GDKRILL++G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEPVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I   +G  L  RGL   G+DVIGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGVGVAQPLTARDREIAATLGPVLAARGLLLVGLDVIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA +F D +E+
Sbjct: 301 TGFDVAGMFVDALER 315


>gi|194366862|ref|YP_002029472.1| glutathione synthetase [Stenotrophomonas maltophilia R551-3]
 gi|194349666|gb|ACF52789.1| glutathione synthetase [Stenotrophomonas maltophilia R551-3]
          Length = 315

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 115/311 (36%), Positives = 176/311 (56%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+ + M+ I+ +K+ +D+TFA+ LEAQ RG+ + +  P  L +      A T PL +
Sbjct: 1   MPLNVIVVMDPIAHIKIAKDTTFAMLLEAQRRGHALHYVRPGGLALEGGVAVAQTAPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIV-NNPFWI 121
            +    +Y LG     +     ++L+R+DPP +  YI  T +L+        V NNP  +
Sbjct: 61  RDDPAGWYELGAFSRTEFGPGQIVLMRKDPPVDAEYIYDTQVLDVAAAAGACVVNNPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAKALKAFALEHGQAVLKPLDGMGGRSIFRSGQGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +      + Q ++P I  GDKRILL++G+PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGGHRMALAQKFIPDITAGDKRILLVDGEPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  ++ RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMKRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQYGL 300

Query: 301 NVASLFWDGIE 311
           N+A   +D +E
Sbjct: 301 NIAGTLFDALE 311


>gi|30249274|ref|NP_841344.1| glutathione synthetase [Nitrosomonas europaea ATCC 19718]
 gi|39931494|sp|Q82V16|GSHB_NITEU RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|30180593|emb|CAD85206.1| gshB; glutathione synthetase protein [Nitrosomonas europaea ATCC
           19718]
          Length = 320

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 125/315 (39%), Positives = 186/315 (59%), Gaps = 5/315 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A  ++ + ++K+ +DS++A+  EA VR +Q++    + L  +D ++    +PL+L +
Sbjct: 1   MKLAFILDPLDSIKIGKDSSYAMMREAAVRHHQLYTLQQNDLAWKDHQVIGFARPLTLLD 60

Query: 65  KK---EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFW 120
                 ++Y  G  + I LS  D +L+R+DPPF+  YI STYLLE        +VN+P  
Sbjct: 61  PPEGDHRWYEEGAIEEIPLSGFDAVLMRKDPPFDTEYIYSTYLLELAERQGAYVVNSPRG 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IR+  EK+ +TEF    PP+L++     I  F  E +DII+KPL G GG G+FRI   D 
Sbjct: 121 IRDHNEKLAITEFPRFTPPSLVTSQEQLILEFLAEHEDIILKPLDGMGGAGIFRIQNTDH 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHA 239
           N   +IE L       +M Q +LP+IR+GDKRILL+ G+PV   + RIP   + R N+ A
Sbjct: 181 NIGVIIETLTRYGTRTIMAQRFLPEIREGDKRILLIAGRPVDYALARIPKPGETRGNLAA 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG      L+  D +I + +G+ L  RGL   G+DVIG+++TEINVTSPT +REI    G
Sbjct: 241 GGTGVARPLSARDREIAEELGQILYARGLMLVGLDVIGNHLTEINVTSPTGMREISDQTG 300

Query: 300 ENVASLFWDGIEKIK 314
            NVA L  D +E+  
Sbjct: 301 TNVAGLMIDALEQNI 315


>gi|85374025|ref|YP_458087.1| glutathione synthetase [Erythrobacter litoralis HTCC2594]
 gi|84787108|gb|ABC63290.1| glutathione synthase [Erythrobacter litoralis HTCC2594]
          Length = 317

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 205/311 (65%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               +A+QM+ + ++ +  DS+FA+ L AQ RG+ ++HY    L   D +I A+  P+++
Sbjct: 1   MALKVAVQMDPMESINIGGDSSFALMLAAQARGHTVYHYDVGSLAYEDGRITAHCAPVTV 60

Query: 63  DEKKEQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWI 121
              +  ++++GE + +DL   +DV+L+RQDPPF++ YI++  LL+++   TL+VN+P  +
Sbjct: 61  QPVEGDHFTMGERRKLDLAQDIDVVLMRQDPPFHLGYISAALLLDRLKGTTLVVNDPREV 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
            N+PEK+FV +++  MPPTLI+R ++ I  F  +   I++KPL+GNGG  +F++     N
Sbjct: 121 INAPEKMFVLDYARFMPPTLIARQLSDIREFQAKHGAIVVKPLHGNGGKAIFKVEADGGN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGG 241
            S+L E+  + +PE  M+Q +LP++ +GDKRI+L++G+  GA+NR P E + RSN+  GG
Sbjct: 181 LSALSEVFNQTWPEAHMVQPFLPEVAEGDKRIVLVDGEFTGAINRKPGEGEFRSNLAQGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGD-YITEINVTSPTCIREIHRNGGE 300
            AE   LT+ + +IC  +G  L+ RGL F GIDVIG  Y+TEINVTSPT I  I +  G 
Sbjct: 241 YAEAAGLTEREEEICATMGPELKRRGLVFVGIDVIGGKYLTEINVTSPTGIVAIDKFNGT 300

Query: 301 NVASLFWDGIE 311
           +  +  WD IE
Sbjct: 301 DTPAKIWDAIE 311


>gi|325921611|ref|ZP_08183451.1| glutathione synthase [Xanthomonas gardneri ATCC 19865]
 gi|325547900|gb|EGD18914.1| glutathione synthase [Xanthomonas gardneri ATCC 19865]
          Length = 316

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 120/311 (38%), Positives = 184/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ LEAQ RG+++ +  P  L +RD +  A   PLS+
Sbjct: 1   MSLDVVVVMDPIASIKIAKDTTFAMLLEAQRRGHRLQYVRPGGLSLRDGRAVAQVAPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            E K  +++LGE   +      V+L+R+DPP +  +I  T +L         +VN+P  +
Sbjct: 61  REDKASWFTLGEFAELAFGPGQVVLMRKDPPVDAEFIYDTQVLSVAQRAGAQVVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLEHGQAVLKPLDGMGGRSIFRSGTGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +      + Q ++P I  GDKRILL++G PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGNRNLTLAQRFIPDITAGDKRILLVDGVPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  +R RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|307728333|ref|YP_003905557.1| glutathione synthetase [Burkholderia sp. CCGE1003]
 gi|307582868|gb|ADN56266.1| glutathione synthetase [Burkholderia sp. CCGE1003]
          Length = 318

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 115/315 (36%), Positives = 179/315 (56%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
            +I    + ++  K+ +DST+A+  EA  RG+ ++   P  L      + AN +  ++  
Sbjct: 1   MDILFIADPLTQFKIYKDSTYAMMAEAARRGHTLYACEPKHLAWTGGDVEANVRRFAITG 60

Query: 65  -----KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
                 ++++Y+        L     +++R+DPPF+M Y+TST+LLE        I N P
Sbjct: 61  DVTDLHRDEWYAAESAAPRALKSFSAVVMRKDPPFDMEYVTSTWLLELAERAGARIFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + PTL++RD  ++  F+ +  D+I+KPL G GG GVFR+   
Sbjct: 121 QAIRDHSEKLAIGEFAQFVAPTLVTRDPARLRAFHEQHGDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M Q ++P+I+DGDKRILL+ G+ V   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARTVMAQKFIPEIKDGDKRILLIGGEAVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D  I   +   L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVARPLTEHDRKIADTLAPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMDQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|293610567|ref|ZP_06692867.1| glutathione synthetase [Acinetobacter sp. SH024]
 gi|292826911|gb|EFF85276.1| glutathione synthetase [Acinetobacter sp. SH024]
          Length = 316

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 131/311 (42%), Positives = 191/311 (61%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL +
Sbjct: 1   MSMRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            E    YY LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +
Sbjct: 61  FEDYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N
Sbjct: 121 RDCNEKLFATQFPELQVPTLVTSQQSLIREFIKEHGDVIVKPLDGMGGMGIFRLYQDGVN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
             S +EML E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AG
Sbjct: 181 IGSTLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G  +   LT+ D  I  +IG  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G 
Sbjct: 241 GLGQARPLTENDKLIAAKIGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGT 300

Query: 301 NVASLFWDGIE 311
           ++A   +D +E
Sbjct: 301 SIADDLFDVLE 311


>gi|262373762|ref|ZP_06067040.1| glutathione synthase [Acinetobacter junii SH205]
 gi|262311515|gb|EEY92601.1| glutathione synthase [Acinetobacter junii SH205]
          Length = 314

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 129/309 (41%), Positives = 192/309 (62%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K +    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQHDLYIDQGKAFGLIAPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
             + YY LG+++   L+  DV+L+R+DPPF+M+++ +TY+LE+     T I+N P  +R+
Sbjct: 61  NYDHYYDLGDKRKESLADYDVVLMRKDPPFDMNFVYTTYILEQAEREGTWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFIKEHGDVIVKPLDGMGGMGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+PV     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTEMGTRPIMAQRYIPEIVEGDKRILMVNGEPVPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKMIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   ++ +E
Sbjct: 301 ADDLFNVLE 309


>gi|170691553|ref|ZP_02882718.1| glutathione synthetase [Burkholderia graminis C4D1M]
 gi|170143758|gb|EDT11921.1| glutathione synthetase [Burkholderia graminis C4D1M]
          Length = 318

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 116/315 (36%), Positives = 178/315 (56%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
            +I    + ++  K+ +DST+A+  EA  RG+ ++   P  L      + AN Q  ++  
Sbjct: 1   MDILFIADPLTQFKIYKDSTYAMMAEAARRGHTLYFCEPKHLAWTGGDVEANVQRFAITG 60

Query: 65  -----KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
                 ++++Y+        L     +++R+DPPF+M Y+TST+LLE        I N P
Sbjct: 61  DVTDLHRDEWYAADAAAPRSLKDFSAVVMRKDPPFDMEYVTSTWLLELAERAGARIFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF+E + PTL++RD  ++  F+ +  D+I+KPL G GG GVFR+   
Sbjct: 121 QAIRDHSEKLAIGEFAEFVAPTLVTRDPARLRAFHEQHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S++EML       +M Q ++P+I+DGDKRILL+ G+ V   + RIP   + R N+
Sbjct: 181 GMNLGSIVEMLSHDGARSVMAQKFIPEIKDGDKRILLIGGEAVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D  I   +   L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVARPLTDHDRKIADTLAPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMDQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFVDALER 315


>gi|186475028|ref|YP_001856498.1| glutathione synthetase [Burkholderia phymatum STM815]
 gi|184191487|gb|ACC69452.1| glutathione synthetase [Burkholderia phymatum STM815]
          Length = 318

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 118/315 (37%), Positives = 182/315 (57%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +S  K+ +DST+A+  EA  RG+ ++   P  L    S + A+     +  
Sbjct: 1   MDILFIADPLSRFKIYKDSTYAMMAEAAKRGHTLYACEPQHLAWTGSGVEADVYRFEIVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++ ++     +   L+    +L+R+DPPF+M Y+TST+LLE        I N P
Sbjct: 61  DQADGHRDVWHEAQPVEARTLASFGAVLMRKDPPFDMEYVTSTWLLELAERAGARIFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QAIRDHSEKMAIGEFAQFVAPTLVTRDPARLRAFHAEHSDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S++EML       +M Q ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIVEMLSHDGARSVMAQKFIPEIKAGDKRILLIGGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I + +G  L+ RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTARDREIAEALGPVLKARGLLLVGLDAIGDWLTEVNVTSPTCFREIMDQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|294651911|ref|ZP_06729201.1| glutathione synthetase [Acinetobacter haemolyticus ATCC 19194]
 gi|292822234|gb|EFF81147.1| glutathione synthetase [Acinetobacter haemolyticus ATCC 19194]
          Length = 314

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 130/309 (42%), Positives = 190/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K +    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQHDLYIDQGKAFGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE++   L+  DVIL+R+DPPF+M+++ +TY+LE+       I+N P  +R+
Sbjct: 61  DYNHYYELGEQRKESLADYDVILMRKDPPFDMNFVYTTYILEQAEREGVWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GGTG+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFITEHGDVIVKPLDGMGGTGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+PV     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPVPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   L++ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLSENDKMIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQYGTSI 300

Query: 303 ASLFWDGIE 311
           A   +  +E
Sbjct: 301 ADDLFAVLE 309


>gi|319791147|ref|YP_004152787.1| glutathione synthetase [Variovorax paradoxus EPS]
 gi|315593610|gb|ADU34676.1| glutathione synthetase [Variovorax paradoxus EPS]
          Length = 317

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 117/315 (37%), Positives = 184/315 (58%), Gaps = 3/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMR-DSKIYANTQPLSL 62
           ++NI    + +   K+ +D+TF++  EAQ RG++I    P  +  +    + A  Q ++L
Sbjct: 1   MKNILFVADPLDHFKIYKDTTFSMMREAQRRGHRIAACLPQDIQWKSGGLVTATVQQITL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
               + +Y++   +   L   D +L+R+DPPF+  YI ST+LL++       +VN+P  +
Sbjct: 61  TGDAKDWYTVDITESKALKDFDAVLMRKDPPFDAEYIYSTHLLQQAEREGAQVVNSPRAL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+ PEK+ + EF + + PTL++R    +  F+ E  DII+KPL G GG G+FR+     N
Sbjct: 121 RDHPEKLAIMEFPQFVTPTLVTRSAQAVRDFHAEHGDIILKPLDGMGGMGIFRVKQDALN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
             S++E L +   E +M+Q ++P++  GDKRIL++ G+P   V  RIP   + R N+ AG
Sbjct: 181 LGSIVETLNKDGAETIMVQRFVPEVSQGDKRILIIAGEPAPFVLARIPQGTEVRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           GK     LT  + +I + IG+ L  RGL   G+DVIGD +TEINVTSPTC +EI    G 
Sbjct: 241 GKGVAQPLTPRNREIAEAIGKVLAPRGLLLIGLDVIGDSVTEINVTSPTCFQEITEQTGF 300

Query: 301 NVASLFWDGIEKIKE 315
           +V  +F D +EK   
Sbjct: 301 DVPKMFIDALEKTLR 315


>gi|323524623|ref|YP_004226776.1| glutathione synthetase [Burkholderia sp. CCGE1001]
 gi|323381625|gb|ADX53716.1| glutathione synthetase [Burkholderia sp. CCGE1001]
          Length = 318

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 116/315 (36%), Positives = 177/315 (56%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
            +I    + ++  K+ +DST+A+  EA  RG+ ++   P  L      + AN Q  ++  
Sbjct: 1   MDILFIADPLTQFKIYKDSTYAMMAEAARRGHTLYTCEPKHLAWTGGDVEANVQRFAITG 60

Query: 65  KKEQ-----YYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
                    +Y+        L     +++R+DPPF+M Y+TST+LLE        I N P
Sbjct: 61  DVTDLHRDAWYAAESAAPRALRSFGAVVMRKDPPFDMEYVTSTWLLELAERAGARIFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + PTL++RD  ++  F+ +  D+I+KPL G GG GVFR+   
Sbjct: 121 QAIRDHSEKLAIGEFAQFVAPTLVTRDPARLRAFHEQHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML +     +M Q ++P+I+DGDKRILL+ G+ V   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSDDGARSVMAQKFIPEIKDGDKRILLIGGEAVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D  I   +   L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVARPLTERDRKIADTLAPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMDQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFVDALER 315


>gi|260550187|ref|ZP_05824400.1| glutathione synthetase [Acinetobacter sp. RUH2624]
 gi|260406715|gb|EEX00195.1| glutathione synthetase [Acinetobacter sp. RUH2624]
          Length = 315

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 132/309 (42%), Positives = 190/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+
Sbjct: 61  DYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFIKEHGDVIVKPLDGMGGMGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG PV     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGDPVPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  +IG  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKLIAAKIGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   +D +E
Sbjct: 301 ADDLFDVLE 309


>gi|119470541|ref|ZP_01613244.1| glutathione synthetase [Alteromonadales bacterium TW-7]
 gi|119446242|gb|EAW27519.1| glutathione synthetase [Alteromonadales bacterium TW-7]
          Length = 316

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 191/314 (60%), Gaps = 2/314 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I  + IS   +K+D+ FA+ ++AQ RGY+I++     L +R  K YA      +
Sbjct: 1   MAIKLGIISDPISGFNIKKDTGFAMMMQAQERGYEIYYMEMGDLSLRKGKSYATAAKARV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
              +E++Y L E+  I L+ +DVIL+R+DPPF+  YI +TYLLE+  +  TLI+N P  +
Sbjct: 61  FNNEEKWYELEEKTTIALADLDVILMRKDPPFDTEYIYATYLLERAEDEGTLIINKPQSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   FSE  P TL++R   QI  F  E KDII+KPL G GG  +FR+   D N
Sbjct: 121 RDANEKLFTAWFSEHTPDTLVTRSQKQIREFLAEHKDIILKPLDGMGGASIFRVKEDDAN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              + E L E      M+Q+Y+P I  GDKR+L+++G+ +     RIP   + R N+ AG
Sbjct: 181 IGVICETLTEHGSRYAMVQNYVPAITQGDKRVLVVDGEVIPYCLARIPQNGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D+ I + +  +L+E+GL F G+D+IGD +TEINVT+PTC+REI      
Sbjct: 241 GRGEARPLSESDMRIAQAVAPTLKEKGLVFVGLDIIGDKLTEINVTAPTCVREIEAAYDI 300

Query: 301 NVASLFWDGIEKIK 314
           ++  + +D IE+  
Sbjct: 301 SITGILFDAIERKL 314


>gi|167585351|ref|ZP_02377739.1| glutathione synthetase [Burkholderia ubonensis Bu]
          Length = 318

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 183/315 (58%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ I+   P QL    S + A+ + +++  
Sbjct: 1   MDILFIADPLERFKIYKDSTYAMMAEAARRGHAIYACEPHQLAWTGSGVEADVRRVTIVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  +  ++         L+  D +L+R+DPPF+M Y+T+T++LE        + N P
Sbjct: 61  DAADLHRHPWHEAAAHASRLLTSFDAVLMRKDPPFDMEYVTATWMLEVAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QAIRDHSEKLAIGEFPQFVAPTLVTRDAARLRAFHAEHGDVIVKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       LMIQ ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLGHDGTRSLMIQKFIPEIKAGDKRILLIAGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I + +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGVGVAQPLTARDREIAETLGPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFVDALER 315


>gi|295675348|ref|YP_003603872.1| glutathione synthetase [Burkholderia sp. CCGE1002]
 gi|295435191|gb|ADG14361.1| glutathione synthetase [Burkholderia sp. CCGE1002]
          Length = 318

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 111/315 (35%), Positives = 178/315 (56%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
            +I    + ++  K+ +DST+A+  EA  RG+ ++   P  L      + AN Q +++  
Sbjct: 1   MDILFIADPLAHFKIYKDSTYAMMAEAARRGHTVYTCEPKHLAWTGGDVEANVQRIAITG 60

Query: 65  KKEQ-----YYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPET-LIVNNP 118
                    +++        L+    +++R+DPPF+M Y+TST+LLE        + N P
Sbjct: 61  DTTDLHRDVWFAADAAAPRALASFGAVVMRKDPPFDMEYVTSTWLLELAERGGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + PTL++RD  ++  F+ +  D+I+KPL G GG GVFR+   
Sbjct: 121 QAIRDHSEKLAIGEFAQFVAPTLVTRDPARLRAFHEQHGDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S++EML       +M Q ++P+I++GDKRILL+ G+ V   + RIP   + R N+
Sbjct: 181 GMNLGSIVEMLSHDGARSVMAQKFIPEIKEGDKRILLIGGEAVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      L++ D  I   +   L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVARPLSEQDRKIADTLAPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMDQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFVDALER 315


>gi|262280497|ref|ZP_06058281.1| glutathione synthetase [Acinetobacter calcoaceticus RUH2202]
 gi|262258275|gb|EEY77009.1| glutathione synthetase [Acinetobacter calcoaceticus RUH2202]
          Length = 314

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 132/309 (42%), Positives = 192/309 (62%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+
Sbjct: 61  DYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GGTG+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFLKEHGDVIVKPLDGMGGTGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  +IG  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKLIAAKIGPFLREKGLIFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   +D +E
Sbjct: 301 ADDLFDVLE 309


>gi|237747063|ref|ZP_04577543.1| glutathione synthase [Oxalobacter formigenes HOxBLS]
 gi|229378414|gb|EEO28505.1| glutathione synthase [Oxalobacter formigenes HOxBLS]
          Length = 313

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 124/311 (39%), Positives = 184/311 (59%), Gaps = 3/311 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A   + + T KV++DSTFAI  EA  RG++IF +    + +  +K+ A  + + L  
Sbjct: 1   MELAFYADPLETFKVQKDSTFAIMAEAVKRGHRIFSFCQHDMALDGNKVVATVKRIELTG 60

Query: 65  K-KEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIR 122
           +    ++ + + +  +L     +++R+DPPF+  YI STYLLE        I N P  IR
Sbjct: 61  RENPDWFEIEQTEERELETFGAVIVRKDPPFDTEYINSTYLLELSERKGARIFNRPAAIR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+ + +F E   PTL++ D  ++  F+ E  DII+KPL   GGTGVFR+     N 
Sbjct: 121 SHNEKLTIAQFPEFTVPTLVTADGERLRSFHAEYGDIILKPLDAMGGTGVFRVEKKGLNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
            ++IEML +     +M Q Y+P+I DGDKR+LL+NG+ V   + RIP   + R N+ AGG
Sbjct: 181 GAIIEMLTDNGSRTVMAQKYIPEIADGDKRVLLVNGQVVPFALARIPQNGEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+K D +I + +   L  RGLF  G+D+IG+++TE+NVTSPTC REI R  G N
Sbjct: 241 IGRAQPLSKRDREIAETLAPVLSGRGLFLVGLDIIGNWLTEVNVTSPTCFREIERQTGFN 300

Query: 302 VASLFWDGIEK 312
           VA LF D +EK
Sbjct: 301 VAGLFMDELEK 311


>gi|28198749|ref|NP_779063.1| glutathione synthetase [Xylella fastidiosa Temecula1]
 gi|182681441|ref|YP_001829601.1| glutathione synthetase [Xylella fastidiosa M23]
 gi|32129570|sp|Q87D42|GSHB_XYLFT RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|28056840|gb|AAO28712.1| glutathione synthetase [Xylella fastidiosa Temecula1]
 gi|182631551|gb|ACB92327.1| glutathione synthetase [Xylella fastidiosa M23]
 gi|307579891|gb|ADN63860.1| glutathione synthetase [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 314

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 123/311 (39%), Positives = 184/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+ +K+ +D+TFA+ LEAQ R +++ +  P  L + + + +A T PL +
Sbjct: 1   MPLDVVVVMDPITGIKIAKDTTFALLLEAQRRSHRLHYVHPGSLSLNEGRTFAQTAPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            + K  +Y+LGE     L Q  +IL+R+DPP N  +I  T LL         ++N+P  +
Sbjct: 61  RDNKTDWYTLGEFSETQLGQGQIILMRKDPPVNAEFIYDTQLLSIAQAAGAQVINHPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EKI    F +  PPTLISRD+  +  F  + +  I+KPL G GG  +FR + GD N
Sbjct: 121 RDLNEKIAAQLFPQCCPPTLISRDMRALKMFVQKQEQAILKPLDGMGGHSIFRSSNGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +      + Q YL QI +GDKRILL++G P+     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGGRTLAIAQRYLQQIIEGDKRILLIDGVPIDHCLARIPQGDEFRGNMAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L + D  I  ++G  +R RG+ F GIDVIGDY+TEINVTSPTC+RE+    G 
Sbjct: 241 GRGESRPLNERDRWIAAQVGPEMRRRGMRFVGIDVIGDYLTEINVTSPTCLRELDAQCGL 300

Query: 301 NVASLFWDGIE 311
           N+A   +D IE
Sbjct: 301 NIAGQLFDAIE 311


>gi|254251325|ref|ZP_04944643.1| Glutathione synthase [Burkholderia dolosa AUO158]
 gi|124893934|gb|EAY67814.1| Glutathione synthase [Burkholderia dolosa AUO158]
          Length = 318

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 182/315 (57%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P  L    S + A+ + ++   
Sbjct: 1   MDILFIADPLERFKIYKDSTYAMMAEAARRGHAVYACEPRHLAWTGSAVEADVRRIAFVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++ ++  G      L     +L+R+DPPF+M Y+TST+LLE        + NN 
Sbjct: 61  DLDDLHRDTWFDAGPVDARRLESFGAVLMRKDPPFDMEYVTSTWLLELAERAGARVFNNA 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFAQFVAPTLVTRDAARLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M Q ++P+I+DGDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGTRTVMAQKFIPEIKDGDKRILLIGGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I + +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTPRDREIAETLGPVLASRGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|226953382|ref|ZP_03823846.1| glutathione synthetase [Acinetobacter sp. ATCC 27244]
 gi|226835859|gb|EEH68242.1| glutathione synthetase [Acinetobacter sp. ATCC 27244]
          Length = 314

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 130/309 (42%), Positives = 190/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K +    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQHDLYIDQGKAFGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE++   L+  DVIL+R+DPPF+M+++ +TY+LE+       I+N P  +R+
Sbjct: 61  DYNHYYELGEQRKESLADYDVILMRKDPPFDMNFVYTTYILEQAEREGVWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GGTG+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFITEHGDVIVKPLDGMGGTGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQYGTSI 300

Query: 303 ASLFWDGIE 311
           A   +  +E
Sbjct: 301 ADDLFSVLE 309


>gi|294626823|ref|ZP_06705415.1| glutathione synthetase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294667028|ref|ZP_06732255.1| glutathione synthetase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292598837|gb|EFF42982.1| glutathione synthetase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292603185|gb|EFF46609.1| glutathione synthetase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 316

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 118/311 (37%), Positives = 184/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ LEAQ RG+++ +  P  L +R+    A   PLS+
Sbjct: 1   MSLDVVVVMDPIASIKIAKDTTFAMLLEAQRRGHRLHYVRPGGLSLREGHAVAQVAPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            E K  +++LGE   +      V+L+R+DPP +  ++  T +L         IVN+P  +
Sbjct: 61  REDKISWFTLGEFAELAFGPGQVVLMRKDPPVDAEFVYDTQVLSVAQRAGAQIVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F L+    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLDHGQAVLKPLDGMGGRSIFRSGSGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGNRKLTLAQRFIPDITAGDKRILLVDGVPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  +R RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|188990624|ref|YP_001902634.1| glutathione synthetase [Xanthomonas campestris pv. campestris str.
           B100]
 gi|167732384|emb|CAP50576.1| glutathione synthetase [Xanthomonas campestris pv. campestris]
          Length = 316

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 115/311 (36%), Positives = 183/311 (58%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ LEAQ RG+++ +  P  L + + +  A   PLS+
Sbjct: 1   MSLDVVVVMDPIASIKIAKDTTFAMLLEAQRRGHRLHYVRPGGLSLHEGRAVAQVAPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            E K  +++LG    +      V+L+R+DPP +  +I  T +L         +VN+P  +
Sbjct: 61  REDKASWFTLGAFTELVFGPGQVVLMRKDPPVDAEFIYDTQVLSVAQRAGAQVVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F L     ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLAHGQAVLKPLDGMGGRSIFRSGTGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G+PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGGRKLTLAQRFIPDITAGDKRILLVDGEPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  ++ RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIATQVGPEMKRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|21232357|ref|NP_638274.1| glutathione synthetase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66767510|ref|YP_242272.1| glutathione synthetase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|25008521|sp|Q8P6P1|GSHB_XANCP RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|21114131|gb|AAM42198.1| glutathione synthetase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66572842|gb|AAY48252.1| glutathione synthetase [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 316

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 115/311 (36%), Positives = 182/311 (58%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ LEAQ RG+++ +  P  L + + +  A   PLS+
Sbjct: 1   MSLDVVVVMDPIASIKIAKDTTFAMLLEAQRRGHRLHYVRPGGLSLHEGRAVAQVAPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTY-LLEKINPETLIVNNPFWI 121
            E K  +++LG    +      V+L+R+DPP +  +I  T  L         +VN+P  +
Sbjct: 61  REDKASWFTLGAFTELVFGPGQVVLMRKDPPVDAEFIYDTQVLAVAQRAGAQVVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F L     ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLAHGQAVLKPLDGMGGRSIFRSGTGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G+PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGGRKLTLAQRFIPDITAGDKRILLVDGEPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  ++ RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMKRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|134297054|ref|YP_001120789.1| glutathione synthetase [Burkholderia vietnamiensis G4]
 gi|134140211|gb|ABO55954.1| glutathione synthase [Burkholderia vietnamiensis G4]
          Length = 318

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 183/315 (58%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ I+   P QL    S + A+ Q +++  
Sbjct: 1   MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAIYTCQPHQLAWTGSGVEADVQRVTIVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  +  +Y     +   L+    +L+R+DPPF+M Y+T+T++LE        + N P
Sbjct: 61  DTADLHRHPWYEAAAHESRQLTSFGAVLMRKDPPFDMEYVTATWMLELAERAGAHVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAARLRAFHAEHGDVIVKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  ++IEML       LMIQ ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGAIIEMLGHDGTRSLMIQKFIPEIKAGDKRILLIAGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I + +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTPRDREIAETLGPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|326564124|gb|EGE14362.1| glutathione synthetase [Moraxella catarrhalis 46P47B1]
          Length = 323

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 124/318 (38%), Positives = 192/318 (60%), Gaps = 3/318 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           MKK     I M+ I+TV  K+D+T A+   A  RG+++++     L++    +  + QPL
Sbjct: 1   MKK-LRFLIVMDDITTVSYKKDTTLAMMWAADERGHELYYCQIHDLWLSQGTLNVDAQPL 59

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPF 119
            + +  E +Y LGE      +  DVIL+R+DPPF+M ++ + +LL+        ++N+P 
Sbjct: 60  QVFKNPENFYELGEMATYCATDFDVILMRKDPPFDMKFLYALHLLDYAKQAGVWVINDPL 119

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +++  EK+F T+FSELM PT+++     I  F  E +D+I+KPL G GG G+FR+T   
Sbjct: 120 AVKDCNEKLFATQFSELMSPTIVTNKQAHIQAFITEHQDVIVKPLDGMGGMGIFRLTADS 179

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIH 238
            N  + +EML +    P+M Q Y+P I +GDKR+L++ GKPV     RIPS+ + R N+ 
Sbjct: 180 PNIGATLEMLTQMGELPIMAQKYIPAIVEGDKRVLIVGGKPVDYCLARIPSQGETRGNLA 239

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+     LT+ +  +   +  +L E+GL+F G+DVIG YITEINVTSPTC+REI    
Sbjct: 240 AGGRGVAMPLTERERQLANAVAPTLLEKGLYFVGLDVIGGYITEINVTSPTCVREIDDQC 299

Query: 299 GENVASLFWDGIEKIKET 316
           G ++A  F   IE   ++
Sbjct: 300 GTSIAVDFIKFIENNIDS 317


>gi|187922535|ref|YP_001894177.1| glutathione synthetase [Burkholderia phytofirmans PsJN]
 gi|187713729|gb|ACD14953.1| glutathione synthetase [Burkholderia phytofirmans PsJN]
          Length = 318

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 116/315 (36%), Positives = 176/315 (55%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
            +I    + ++  K+ +DST+A+  EA  RG+ ++   P  L      + AN Q  ++  
Sbjct: 1   MDILFIADPLTQFKIYKDSTYAMMAEAARRGHVVYTCEPKHLAWTGGDVEANVQRFTIVG 60

Query: 65  KKEQ-----YYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPET-LIVNNP 118
                    +Y         L     +++R+DPPF+M Y+TST+LLE        I N P
Sbjct: 61  DVTDLHREVWYDAEAAAPRSLKSFSAVVMRKDPPFDMEYVTSTWLLEMAERGGARIFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + PTL++RD +++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QAIRDHSEKLAIGEFAQFVTPTLVTRDASRLRAFHEEHGDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M Q ++P+I++GDKRILL+ G+ V   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARSVMAQKFIPEIKEGDKRILLIGGEAVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D  I   +   L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVARPLTEHDRKIADTLAPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMDQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|299768390|ref|YP_003730416.1| glutathione synthetase [Acinetobacter sp. DR1]
 gi|298698478|gb|ADI89043.1| glutathione synthetase [Acinetobacter sp. DR1]
          Length = 314

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 131/309 (42%), Positives = 191/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+
Sbjct: 61  DYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINRPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFIKEHGDVIVKPLDGMGGMGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTELGNRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  +IG  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKLIAAKIGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   +D +E
Sbjct: 301 ADDLFDVLE 309


>gi|50086475|ref|YP_047985.1| glutathione synthetase [Acinetobacter sp. ADP1]
 gi|49532451|emb|CAG70163.1| glutathione synthetase [Acinetobacter sp. ADP1]
          Length = 314

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 127/309 (41%), Positives = 189/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I  V +K+DST A+   A  RG+++ +     LY+   + +    PL + E
Sbjct: 1   MRVLVVMDPIENVNLKKDSTMAMLWAASRRGHELGYALQHDLYIDQGRAFGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
             + YY LG ++   L+  DVIL+R+DPPF+M+++ +TY+LE+       I+N P  +R+
Sbjct: 61  DYQHYYELGNKQKESLADYDVILMRKDPPFDMNFVYTTYILEQAEREGAWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFIQEHGDVIVKPLDGMGGMGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTEMGTCPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT+ D  I  ++G  LR++GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GEARPLTENDKMIAAKVGPYLRDKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   +D +E
Sbjct: 301 ADTLFDVLE 309


>gi|94495390|ref|ZP_01301970.1| glutathione synthetase [Sphingomonas sp. SKA58]
 gi|94424778|gb|EAT09799.1| glutathione synthetase [Sphingomonas sp. SKA58]
          Length = 324

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 133/304 (43%), Positives = 208/304 (68%), Gaps = 2/304 (0%)

Query: 7   IAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK 66
           +A+QM+ +  + +  DSTF I L  Q RG++++HY    L  RD ++ A  +P+ + +  
Sbjct: 9   VAVQMDPMEGINITGDSTFHIMLSGQARGHKLYHYLAPDLTYRDGRVLAKARPVKVQKVA 68

Query: 67  EQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSP 125
             +++LG+ + +D+   +DV+L+RQDPPF++ YIT+T+LLE++  ETL+VN+P  +R++P
Sbjct: 69  GDHFALGDWETLDMGRDVDVVLMRQDPPFDLSYITATHLLERVQAETLVVNDPASVRDAP 128

Query: 126 EKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSL 185
           EK+FV +++  MPPT+I+RD+ ++  F  E  +I++KPLYGNGG  VF +     N SSL
Sbjct: 129 EKLFVLDYARFMPPTMITRDLAEVKSFLAEHGEIVVKPLYGNGGVAVFHVGANGANLSSL 188

Query: 186 IEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAEL 245
           +E+  EK+ EP M+Q+++P +  GDKRI+L++G+ +GAVNRIP + + RSN+  GG A  
Sbjct: 189 VELFKEKWVEPFMVQAFIPGVAQGDKRIVLVDGEVMGAVNRIPGKGEIRSNLAVGGSAAK 248

Query: 246 TKLTKIDLDICKRIGESLRERGLFFTGIDVIGD-YITEINVTSPTCIREIHRNGGENVAS 304
           T+LT  + +IC  +G  L+ RGL F GIDVIG  ++TEINVTSPT I  I    G +   
Sbjct: 249 TELTNKEREICAALGPELKARGLLFVGIDVIGGEWLTEINVTSPTGIVSIEAFDGTDTGG 308

Query: 305 LFWD 308
           + WD
Sbjct: 309 MIWD 312


>gi|221211129|ref|ZP_03584108.1| glutathione synthase [Burkholderia multivorans CGD1]
 gi|221168490|gb|EEE00958.1| glutathione synthase [Burkholderia multivorans CGD1]
          Length = 318

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 180/315 (57%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ I+   P +L    S + A+ + ++   
Sbjct: 1   MDILFIADPLERFKIYKDSTYAMMAEAARRGHAIYACEPRELAWTGSAVEADVRRITFVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  +E +Y  G      L     +L+R+DPPF+M Y+TST+LLE        + N  
Sbjct: 61  ELDDLHRETWYEAGPVDARRLESFGAVLMRKDPPFDMEYVTSTWLLELAERAGARVFNRA 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAKRLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S++EML       +M Q ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIVEMLSHDGTRSVMAQKFIPEIKAGDKRILLIGGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I + +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTPRDREIAETLGPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|254497566|ref|ZP_05110354.1| glutathione synthetase [Legionella drancourtii LLAP12]
 gi|254353182|gb|EET11929.1| glutathione synthetase [Legionella drancourtii LLAP12]
          Length = 316

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 118/313 (37%), Positives = 187/313 (59%), Gaps = 4/313 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-D 63
             +A+ ++ +  +K  +D++ A+   AQ  G+   ++T + L+  + + YA    + + D
Sbjct: 1   MKLALLLDPLHYLKPYKDTSVAMVKRAQELGWSCVYFTQNDLFCSEGRAYARVYDIEIGD 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIR 122
           E    +    +     L   D+IL+R+DPPFN  YI +TYLLE       L+ N P  +R
Sbjct: 61  EYSSNWARTKDLGEKPLGDFDIILMRKDPPFNTEYIYTTYLLELAEREGVLVANRPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK F  +F +  P TL+SRD+ ++  F+ E + +I KP  G GG+ VF +    RN 
Sbjct: 121 DANEKFFTLKFPQCCPTTLVSRDMKKLRAFWQEHQHVIFKPAEGMGGSSVFHVDEQGRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQI-RDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
           S ++E+L E     ++ Q Y+P+I   GDKRIL++NG+PV   + RIP++ + R N+ AG
Sbjct: 181 SVILEVLTEHQTRTIIAQRYIPEIVTGGDKRILVINGEPVPYALARIPAKGELRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
            + E+  +T  D  IC++I  +L+ +GL+F GIDVIGDY+TEINVTSPTC+REI    G 
Sbjct: 241 ARGEVVPITARDRWICEQIAPTLKAKGLYFVGIDVIGDYLTEINVTSPTCLREITAETGL 300

Query: 301 NVASLFWDGIEKI 313
           ++A  F   +EKI
Sbjct: 301 DIAGDFLRSLEKI 313


>gi|326797244|ref|YP_004315064.1| glutathione synthetase [Marinomonas mediterranea MMB-1]
 gi|326548008|gb|ADZ93228.1| Glutathione synthetase [Marinomonas mediterranea MMB-1]
          Length = 315

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 191/314 (60%), Gaps = 2/314 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + I M+ I ++  K+D++ A+   A  +G+ + +     L+++  K YA   PL++
Sbjct: 1   MTIKLGIVMDPIQSITYKKDTSLAMLWAAADKGWDLIYMEQSDLFLQQGKAYAIAHPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            + +E +Y LGEE+ + L  +DVIL+R+DPPF+  ++ ST +LE+      ++VNNP  +
Sbjct: 61  FKDEESFYELGEEQSLALGDLDVILMRKDPPFDGEFMYSTMILEQAQRDGAMVVNNPASL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F +  P  L++R    +  F+    D+I KPL G GGT +FR+   D N
Sbjct: 121 RDCNEKLFATQFPQCCPEVLVTRRPDLLREFHKTHNDVIFKPLDGMGGTSIFRLKQDDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            S +IE L E     +M Q ++P+I++GDKRIL++NG+P+   + RIP+  + R N+ AG
Sbjct: 181 VSVIIESLTEMGSRQIMAQKFIPEIKEGDKRILIVNGEPIPYALARIPASGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L+  D  IC ++  +L E+ L F G+DVIGDY+TEINVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSDRDRWICDQVIPTLLEKDLMFVGLDVIGDYLTEINVTSPTCVRELDNQFGL 300

Query: 301 NVASLFWDGIEKIK 314
           N+A    D IE   
Sbjct: 301 NIAKQLMDAIEDKL 314


>gi|94676935|ref|YP_588919.1| glutathione synthetase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|94220085|gb|ABF14244.1| glutathione synthetase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 317

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 124/315 (39%), Positives = 192/315 (60%), Gaps = 2/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+++ +K+D++FA+ LEAQ RGY+IF+   + LY+R  +  A++  L + 
Sbjct: 1   MIKLGIVMDSIASINIKKDTSFALLLEAQKRGYKIFYMEINSLYLRGGEARASSCLLEVT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              + +Y+    + I +S +DV+L+R++PP +  YI STY+LE+     TL++N P  +R
Sbjct: 61  NHDDDWYNFYNYQDIAISSLDVVLMRKNPPIDTEYIYSTYILERAEKQGTLVINKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EKIF ++  +  P TL+S+    I +F  + KDII+KPL G GG  +FR+   D N 
Sbjct: 121 DCNEKIFASDCKKYTPDTLVSQQYNHIRQFLRQHKDIILKPLNGMGGQSIFRLQEQDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
           S +IE L        M Q+YLP I++GDKR+ +++G+PV     RIP   + R N+ AGG
Sbjct: 181 SVIIETLTSYGKNFCMAQTYLPSIKEGDKRVFIIDGQPVPYCLARIPQNSEIRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
             E   L+  D  I   +G  LR+RGL F G+D+IGD +TEIN+TSPTCI EI      +
Sbjct: 241 YGEARSLSSTDWSIAYDLGLILRKRGLMFVGLDIIGDKLTEINITSPTCICEIEAAFPIS 300

Query: 302 VASLFWDGIEKIKET 316
           +  +  D IEK  +T
Sbjct: 301 ITGMLMDAIEKNLQT 315


>gi|113866353|ref|YP_724842.1| glutathione synthetase [Ralstonia eutropha H16]
 gi|113525129|emb|CAJ91474.1| glutathione synthase [Ralstonia eutropha H16]
          Length = 317

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 120/309 (38%), Positives = 181/309 (58%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I    + + T K  +DST+A+  EA  RG++++     QL +    +      L L  
Sbjct: 1   MRILFITDPLETFKTYKDSTYAMMTEAAARGHELYWCLQPQLTLSGRVVETMATRLHLTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRN 123
               +Y  G   +  LS  D +L+R+DPPF+M Y+TST+LLE        + N P  IR+
Sbjct: 61  DDHAWYREGNSALEPLSAFDAVLMRKDPPFDMEYVTSTWLLELAEAQGARVFNKPRAIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + ++ E + PTL++RD+ +I  F+ E +DII+KPL G GG GVFR+     N +
Sbjct: 121 HSEKLAIAQYPEFITPTLVTRDLARIRDFHAEHRDIIVKPLDGMGGMGVFRVGADGMNLA 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           +++E L       LM+Q Y+P I+DGDKRILL+ G PV   + R+P   + R N+ AGG 
Sbjct: 181 AIVETLGHDGARTLMVQRYIPAIKDGDKRILLIGGVPVPYSLARVPMAGEVRGNLAAGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
               +L+  D +I + +   L E+GL   G+DVIGDY+TE+NVTSPTC +EI +  G +V
Sbjct: 241 GRAQELSPRDREIAEALAPGLWEQGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFHV 300

Query: 303 ASLFWDGIE 311
           A++F D +E
Sbjct: 301 AAMFIDALE 309


>gi|167561391|ref|ZP_02354307.1| glutathione synthetase [Burkholderia oklahomensis EO147]
          Length = 318

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 187/315 (59%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P+QL    + + A+ + +++  
Sbjct: 1   MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWTVAGVEADVRRVTIVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++++Y     +   L     IL+R+DPPF+M Y+TST+LLE        + N P
Sbjct: 61  DTADLHRDRWYEARAHESRALPSFGAILMRKDPPFDMEYVTSTWLLELAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + P+L++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QTIRDHSEKLAIGEFAQFVSPSLVTRDAARLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M+Q ++P+I+ GDKRILL++G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEPVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D +I   +G  L  RGL   G+DVIGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGVGVAQPLTERDREIAATLGPVLAARGLLLVGLDVIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA +F D +E+
Sbjct: 301 TGYDVAGMFVDALER 315


>gi|254521218|ref|ZP_05133273.1| glutathione synthase [Stenotrophomonas sp. SKA14]
 gi|219718809|gb|EED37334.1| glutathione synthase [Stenotrophomonas sp. SKA14]
          Length = 315

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 115/311 (36%), Positives = 177/311 (56%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+ + M+ I+ +K+ +D+TFA+ LEAQ RG+ + +  P  L +      A T PL +
Sbjct: 1   MPLNVIVVMDPIAHIKIAKDTTFAMLLEAQRRGHALHYVRPGGLALEGGVAVAQTAPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIV-NNPFWI 121
            +    +Y LG     +     ++L+R+DPP +  YI  T +L+        V NNP  +
Sbjct: 61  RDDPSGWYELGAFSRTEFGPGQIVLMRKDPPVDAEYIYDTQVLDVAAAAGACVVNNPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAKALKAFALEHGQAVLKPLDGMGGRSIFRSGQGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G+PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGGRKLALAQKFIPDITAGDKRILLVDGEPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  ++ RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMKRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQYGL 300

Query: 301 NVASLFWDGIE 311
           N+A   +D +E
Sbjct: 301 NIAGTLFDALE 311


>gi|120613172|ref|YP_972850.1| glutathione synthetase [Acidovorax citrulli AAC00-1]
 gi|120591636|gb|ABM35076.1| glutathione synthase [Acidovorax citrulli AAC00-1]
          Length = 316

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 119/314 (37%), Positives = 184/314 (58%), Gaps = 3/314 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDS-KIYANTQPLSLD 63
            NI    + +   K+ +D+TF++  EAQ RG+ +       +      K+ A  + L L 
Sbjct: 1   MNILFVADPVEHFKIYKDTTFSMMREAQRRGHVVSVCEAGHIRWEQGSKVTARVRDLHLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              + ++++  E+  +LS    +L+R+DPPF+  Y  +T+LLE+       + N P  +R
Sbjct: 61  GDAQAWFTVAGEREAELSGFGAVLMRKDPPFDSEYFYATHLLEQAEREGARVFNKPRALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF +L+ PTL++RD   I RF+ E  DII+KPL G GG G+FR+     N 
Sbjct: 121 DHPEKLAIMEFPDLIGPTLVTRDAGDIRRFHAEHGDIILKPLDGMGGMGIFRVKADGLNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L     + +M+Q +LP+I +GDKR+L++ G+PV     RIP   + R N+ AGG
Sbjct: 181 GSIIETLNHHGAQTVMVQKFLPEISEGDKRVLIIGGEPVPYCLARIPQGSEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L+  D++I +R+G  L ERG+   G+DVIG+ +TEINVTSPTC +EI      +
Sbjct: 241 KGVARPLSARDVEIGRRLGPVLLERGMLLAGVDVIGNCVTEINVTSPTCFQEIFDQTACD 300

Query: 302 VASLFWDGIEKIKE 315
           V SLF D +EK  +
Sbjct: 301 VPSLFVDALEKQLK 314


>gi|190575534|ref|YP_001973379.1| glutathione synthetase [Stenotrophomonas maltophilia K279a]
 gi|190013456|emb|CAQ47091.1| putative Glutathione synthetase [Stenotrophomonas maltophilia
           K279a]
          Length = 315

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 115/311 (36%), Positives = 177/311 (56%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+ + M+ I+ +K+ +D+TFA+ LEAQ RG+ + +  P  L +      A T PL +
Sbjct: 1   MPLNVIVVMDPIAHIKIAKDTTFAMLLEAQRRGHALHYVRPGGLALEGGVAVAQTAPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIV-NNPFWI 121
            +    +Y LG     +     ++L+R+DPP +  YI  T +L+        V NNP  +
Sbjct: 61  RDDPAGWYELGAFSRTEFGPGQIVLMRKDPPVDAEYIYDTQVLDVAAAAGACVVNNPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAKALKAFALEHGQAVLKPLDGMGGRSIFRSGQGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G+PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGGRKLALAQKFIPDITAGDKRILLVDGEPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  ++ RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMKRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQYGL 300

Query: 301 NVASLFWDGIE 311
           N+A   +D +E
Sbjct: 301 NIAGTLFDALE 311


>gi|193078674|gb|ABO13726.2| glutathione synthetase [Acinetobacter baumannii ATCC 17978]
          Length = 314

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 130/309 (42%), Positives = 191/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+
Sbjct: 61  DYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFITEYGDVIVKPLDGMGGMGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   +D +E
Sbjct: 301 ADDLFDVLE 309


>gi|169794347|ref|YP_001712140.1| glutathione synthetase [Acinetobacter baumannii AYE]
 gi|213159078|ref|YP_002321076.1| glutathione synthase [Acinetobacter baumannii AB0057]
 gi|215481903|ref|YP_002324085.1| glutathione synthase [Acinetobacter baumannii AB307-0294]
 gi|239503823|ref|ZP_04663133.1| glutathione synthetase [Acinetobacter baumannii AB900]
 gi|260557899|ref|ZP_05830112.1| glutathione synthase [Acinetobacter baumannii ATCC 19606]
 gi|301344636|ref|ZP_07225377.1| glutathione synthetase [Acinetobacter baumannii AB056]
 gi|301513418|ref|ZP_07238655.1| glutathione synthetase [Acinetobacter baumannii AB058]
 gi|301596385|ref|ZP_07241393.1| glutathione synthetase [Acinetobacter baumannii AB059]
 gi|332850152|ref|ZP_08432539.1| glutathione synthase [Acinetobacter baumannii 6013150]
 gi|332868972|ref|ZP_08438531.1| glutathione synthase [Acinetobacter baumannii 6013113]
 gi|332872848|ref|ZP_08440813.1| glutathione synthase [Acinetobacter baumannii 6014059]
 gi|169147274|emb|CAM85133.1| glutathione synthetase [Acinetobacter baumannii AYE]
 gi|213058238|gb|ACJ43140.1| glutathione synthase [Acinetobacter baumannii AB0057]
 gi|213986462|gb|ACJ56761.1| glutathione synthase [Acinetobacter baumannii AB307-0294]
 gi|260408690|gb|EEX01995.1| glutathione synthase [Acinetobacter baumannii ATCC 19606]
 gi|332731001|gb|EGJ62307.1| glutathione synthase [Acinetobacter baumannii 6013150]
 gi|332733015|gb|EGJ64217.1| glutathione synthase [Acinetobacter baumannii 6013113]
 gi|332739009|gb|EGJ69871.1| glutathione synthase [Acinetobacter baumannii 6014059]
          Length = 314

 Score =  282 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 130/309 (42%), Positives = 191/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+
Sbjct: 61  DYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFITEHGDVIVKPLDGMGGMGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   +D +E
Sbjct: 301 ADDLFDVLE 309


>gi|221199919|ref|ZP_03572962.1| glutathione synthase [Burkholderia multivorans CGD2M]
 gi|221207412|ref|ZP_03580421.1| glutathione synthase [Burkholderia multivorans CGD2]
 gi|221172615|gb|EEE05053.1| glutathione synthase [Burkholderia multivorans CGD2]
 gi|221180158|gb|EEE12562.1| glutathione synthase [Burkholderia multivorans CGD2M]
          Length = 318

 Score =  282 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 180/315 (57%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ I+   P +L    S + A+ + ++   
Sbjct: 1   MDILFIADPLERFKIYKDSTYAMMAEAARRGHAIYACEPRELAWTGSAVEADVRRITFVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  +E +Y  G      L     +L+R+DPPF+M Y+TST+LLE        + N  
Sbjct: 61  ELDDLHRETWYEAGPVDARRLESFGAVLMRKDPPFDMEYVTSTWLLELAERAGARVFNRA 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAKRLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M Q ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGTRSVMAQKFIPEIKAGDKRILLIGGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I + +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTPRDREIAETLGPVLASRGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|114319516|ref|YP_741199.1| glutathione synthase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225910|gb|ABI55709.1| glutathione synthase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 314

 Score =  282 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 116/311 (37%), Positives = 181/311 (58%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I  +K  +D+T A+ LEA+ RG+ + +     L +RD +     +PL++
Sbjct: 1   MSVRLGVVMDPIHAIKPWKDTTLALLLEAERRGWVLHYLETGDLALRDGRPLGRNRPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWI 121
            +    ++ LGE     L  +DVIL+R DPP +  Y  +T++LE        ++N P  +
Sbjct: 61  RDDNRDWFELGEPAWGPLEALDVILMRSDPPVDTAYAYATHVLELAELAGVQVINRPEAL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F  +F +   PTL+S D  Q+  F  E + +++KPL   GG  +F +  GD N
Sbjct: 121 RDCNEKLFTAQFPQCCAPTLVSADAGQLRAFMAEQEHVVLKPLDAMGGASIFVVRDGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPV-GAVNRIPSEVDNRSNIHAG 240
            S ++E L  +    +M Q YLP+I  GDKRIL++ G+P+  A+ RIP E + R N+ AG
Sbjct: 181 TSVILETLTREGTLQIMAQRYLPEIEAGDKRILMIGGEPLPWALARIPREGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+    +LT  D  IC+++   LR RGL F G+DVIGDY+TEINVTSPTC+RE+      
Sbjct: 241 GRGVGVELTDRDRWICEQVAPELRRRGLDFVGLDVIGDYLTEINVTSPTCVRELDAIYET 300

Query: 301 NVASLFWDGIE 311
           N+++   D +E
Sbjct: 301 NISARLMDLVE 311


>gi|260222029|emb|CBA31185.1| Glutathione synthetase [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 320

 Score =  281 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 114/311 (36%), Positives = 180/311 (57%), Gaps = 7/311 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQL-YMRDSKIYANTQPLSLD 63
            +I    + + + K+ +D+TF++  EAQ RG++I    P  + + R   + A  + ++L 
Sbjct: 1   MHILFVADPLESFKIYKDTTFSMMREAQKRGHRISACEPKDIMWQRGGVVTAYVRDITLT 60

Query: 64  EKKEQYYS----LGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNP 118
              + +++      +E+   L   D +++R+DPPF+  +  +T+LLE+       + N P
Sbjct: 61  GAPDVWFTSAQSKPDERPQALKDFDCVVMRKDPPFDSEFFYATHLLEQAEREGAKVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             +R+ PEK+ + EF + + PTL++RD   + RF+ E +DII+KPL G GG G+FR+   
Sbjct: 121 RALRDHPEKLAILEFPQFIGPTLVTRDADDVRRFHAEHRDIILKPLDGMGGMGIFRVKED 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNI 237
             N   +IE L E   + LM+Q +LP I +GDKR+L++ GKPV     RIP   + R N+
Sbjct: 181 GLNLGGIIETLNEDGAQTLMVQKFLPAISEGDKRVLVIGGKPVPFCLARIPQGGEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGGK     +T  D  I + +G  L  RGL   G+D+IGD +TEINVTSPTC +EI   
Sbjct: 241 AAGGKGVAQPITDSDRAIAEALGPILAARGLLLVGLDIIGDSLTEINVTSPTCFQEITDQ 300

Query: 298 GGENVASLFWD 308
            G +V S+F D
Sbjct: 301 TGFDVPSMFLD 311


>gi|169634772|ref|YP_001708508.1| glutathione synthetase [Acinetobacter baumannii SDF]
 gi|169153564|emb|CAP02736.1| glutathione synthetase [Acinetobacter baumannii]
          Length = 314

 Score =  281 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 130/309 (42%), Positives = 191/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E
Sbjct: 1   MRVLVIMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+
Sbjct: 61  DYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFITEHGDVIVKPLDGMGGMGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   +D +E
Sbjct: 301 ADDLFDVLE 309


>gi|166712944|ref|ZP_02244151.1| glutathione synthetase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 316

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 118/311 (37%), Positives = 186/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ L+AQ RG+++ +  P  L +R+ +  A   PLS+
Sbjct: 1   MSLDVVVVMDPIASIKIAKDTTFAMLLDAQRRGHRLHYVRPGGLSLREGRAVAQVAPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            E K  +++LGE   ++     V+L+R+DPP +  ++  T +L         IVN+P  +
Sbjct: 61  REDKTNWFTLGEFAELEFGPGQVVLMRKDPPVDAEFVYDTQVLSVAQRAGAQIVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLEHGQAVLKPLDGMGGRSIFRSGTGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGNRKLTLAQRFIPDISTGDKRILLVDGVPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  +R RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRPLSERDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|326319234|ref|YP_004236906.1| glutathione synthetase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323376070|gb|ADX48339.1| glutathione synthetase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 316

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 123/311 (39%), Positives = 184/311 (59%), Gaps = 3/311 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDS-KIYANTQPLSLD 63
            NI    + +   K+ +D+TF++  EAQ RG+ +    P  +      K+ A  + L L 
Sbjct: 1   MNILFVADPVEHFKIYKDTTFSMMREAQRRGHVVSVCEPGHIRWEQGRKVTARVRDLHLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              + ++++  E+  +LS    +L+R+DPPF+  Y  +T+LLE+       + N P  +R
Sbjct: 61  GDAQAWFTVAGEREAELSGFGAVLMRKDPPFDSEYFYATHLLEQAERERARVFNRPRALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF +L+ PTL++RD   I RF+ E  DII+KPL G GG G+FR+     N 
Sbjct: 121 DHPEKLAIMEFPDLIGPTLVTRDAGDIRRFHSEHGDIILKPLDGMGGMGIFRVKADGLNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L     + +M+Q +LP+I +GDKR+L++ G+PV     RIP   + R N+ AGG
Sbjct: 181 GSIIETLNHDGAQTVMVQKFLPEISEGDKRVLIIGGEPVPYCLARIPQGSEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     LT  D++I +R+G  L ERG+   G+DVIGD +TEINVTSPTC  EI    G +
Sbjct: 241 KGVARALTARDVEIGRRLGPVLLERGMLLAGVDVIGDCVTEINVTSPTCFLEIFDQTGCD 300

Query: 302 VASLFWDGIEK 312
           V SLF D +EK
Sbjct: 301 VPSLFVDALEK 311


>gi|296115085|ref|ZP_06833727.1| glutathione synthetase [Gluconacetobacter hansenii ATCC 23769]
 gi|295978422|gb|EFG85158.1| glutathione synthetase [Gluconacetobacter hansenii ATCC 23769]
          Length = 322

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 149/314 (47%), Positives = 212/314 (67%), Gaps = 14/314 (4%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIY----------ANTQPL 60
           M+ +  + +K DSTFA+ LEA+ RGY+++ Y  + + + + +I           A  + +
Sbjct: 1   MDPLGAIDIKGDSTFALMLEAEARGYELYVYQVETMTLSEGRISPQGARLERLAARARRV 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP----ETLIVN 116
            +      + + GEE ++DL  MDVIL+RQDPPF+M YIT+T++LE I+       L+VN
Sbjct: 61  HVQRVAGAHATYGEEHVLDLGGMDVILMRQDPPFDMAYITATHMLEHIHGVGPGRALVVN 120

Query: 117 NPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRIT 176
           +P  +RN+PEK+ VT + +LMPPTL++ D+  I  F    +DII+KPL+GNGG GVFRI 
Sbjct: 121 DPASVRNAPEKLLVTHYPDLMPPTLVTWDVRAIRDFRARWRDIIVKPLFGNGGAGVFRIR 180

Query: 177 LGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSN 236
             D N +SL+EM F +  EPLMIQ Y P +R GDKRI+L +G+P+GA++R+P+E + RSN
Sbjct: 181 EDDPNLNSLLEMHFARSREPLMIQRYEPAVRQGDKRIILADGQPIGAIDRVPAEGEARSN 240

Query: 237 IHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHR 296
           +H GG+A    LT  D +IC  IG  LRE+GL F GIDVIG+++TEINVTSPT ++EI R
Sbjct: 241 MHVGGRAVKATLTPRDYEICAAIGPLLREQGLIFVGIDVIGEWLTEINVTSPTGLQEIDR 300

Query: 297 NGGENVASLFWDGI 310
             G N AS+ WD I
Sbjct: 301 FDGVNTASMLWDCI 314


>gi|161523620|ref|YP_001578632.1| glutathione synthetase [Burkholderia multivorans ATCC 17616]
 gi|189351611|ref|YP_001947239.1| glutathione synthetase [Burkholderia multivorans ATCC 17616]
 gi|160341049|gb|ABX14135.1| glutathione synthetase [Burkholderia multivorans ATCC 17616]
 gi|189335633|dbj|BAG44703.1| glutathione synthase [Burkholderia multivorans ATCC 17616]
          Length = 318

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 180/315 (57%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ I+   P +L    S + A+ + ++   
Sbjct: 1   MDILFIADPLERFKIYKDSTYAMMAEAARRGHAIYACEPRELAWTGSAVEADVRRITFVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  +E +Y  G      L     +L+R+DPPF+M Y+TST+LLE        + N  
Sbjct: 61  ELDDLHRETWYEAGPVDARRLESFGAVLMRKDPPFDMEYVTSTWLLELAERAGARVFNRA 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAKRLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M Q ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGTRSVMAQKFIPEIKAGDKRILLIGGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I + +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTARDREIAETLGPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|262377180|ref|ZP_06070405.1| glutathione synthase [Acinetobacter lwoffii SH145]
 gi|262307918|gb|EEY89056.1| glutathione synthase [Acinetobacter lwoffii SH145]
          Length = 316

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 128/309 (41%), Positives = 189/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I  V +K+DST A+   A  RG+++ +     LY+   K +    PL + E
Sbjct: 1   MRVLVVMDPIENVNLKKDSTMAMLWAAARRGHELGYALQQDLYIDQGKAFGLIAPLQVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
             + YY LGE++   ++  DV+L+R+DPPF+M+++ +TY+LE+       I+N P  +R+
Sbjct: 61  DYDHYYELGEKQKESIAAYDVVLMRKDPPFDMNFVYTTYILEQAEREGAWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F  L  PTL++   + I  F  E  D+I+KPL G GGTG+FR+     N  
Sbjct: 121 CNEKLFATQFPHLQVPTLVTSQQSLIREFLKEQVDVIVKPLDGMGGTGIFRLYQDGINIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S IEML     +P+M Q Y+P+I +GDKRIL++NG+PV     RIP   + R N+ AGG 
Sbjct: 181 STIEMLTNNGTQPIMAQRYIPEIVEGDKRILMINGEPVPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            E   LT+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GEARPLTETDKAIAAKVGPYLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   +  +E
Sbjct: 301 ADDLFAVLE 309


>gi|254247112|ref|ZP_04940433.1| Glutathione synthase [Burkholderia cenocepacia PC184]
 gi|124871888|gb|EAY63604.1| Glutathione synthase [Burkholderia cenocepacia PC184]
          Length = 318

 Score =  281 bits (720), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 116/315 (36%), Positives = 178/315 (56%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P  L    S + A+ + ++   
Sbjct: 1   MDILFIADPLEHFKIYKDSTYAMMAEAARRGHAVYACEPRHLAWTGSAVEADVRRITFVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++ ++  G      L     +L+R+DPPF+M Y+TST+LLE        + N  
Sbjct: 61  ELDDLHRDTWFEAGPVDARRLESFGAVLMRKDPPFDMEYVTSTWLLELAERAGARVFNKA 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAKRLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S++EML       +M Q ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIVEMLSHDGTRSVMAQKFIPEIKAGDKRILLIGGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I   +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTARDREIADTLGPVLASRGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|170734208|ref|YP_001766155.1| glutathione synthetase [Burkholderia cenocepacia MC0-3]
 gi|169817450|gb|ACA92033.1| glutathione synthetase [Burkholderia cenocepacia MC0-3]
          Length = 318

 Score =  281 bits (720), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 116/315 (36%), Positives = 178/315 (56%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P  L    S + A+ + ++   
Sbjct: 1   MDILFIADPLEHFKIYKDSTYAMMAEAARRGHAVYACEPRHLAWTGSAVEADVRRITFVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++ ++  G      L     +L+R+DPPF+M Y+TST+LLE        + N  
Sbjct: 61  ELDDLHRDTWFDAGPVDARRLESFGAVLMRKDPPFDMEYVTSTWLLELAERAGARVFNKA 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAKRLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S++EML       +M Q ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIVEMLSHDGTRSVMAQKFIPEIKAGDKRILLIGGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I   +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTARDREIADTLGPVLASRGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|29655160|ref|NP_820852.1| glutathione synthetase [Coxiella burnetii RSA 493]
 gi|153206130|ref|ZP_01945393.1| glutathione synthase [Coxiella burnetii 'MSU Goat Q177']
 gi|154707771|ref|YP_001423538.1| glutathione synthetase [Coxiella burnetii Dugway 5J108-111]
 gi|165919304|ref|ZP_02219390.1| glutathione synthase [Coxiella burnetii RSA 334]
 gi|212211900|ref|YP_002302836.1| glutathione synthetase [Coxiella burnetii CbuG_Q212]
 gi|212217850|ref|YP_002304637.1| glutathione synthetase [Coxiella burnetii CbuK_Q154]
 gi|39931504|sp|Q83AL0|GSHB_COXBU RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|29542429|gb|AAO91366.1| glutathione synthetase [Coxiella burnetii RSA 493]
 gi|120577260|gb|EAX33884.1| glutathione synthase [Coxiella burnetii 'MSU Goat Q177']
 gi|154357057|gb|ABS78519.1| glutathione synthetase [Coxiella burnetii Dugway 5J108-111]
 gi|165917027|gb|EDR35631.1| glutathione synthase [Coxiella burnetii RSA 334]
 gi|212010310|gb|ACJ17691.1| glutathione synthetase [Coxiella burnetii CbuG_Q212]
 gi|212012112|gb|ACJ19492.1| glutathione synthetase [Coxiella burnetii CbuK_Q154]
          Length = 321

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 111/311 (35%), Positives = 188/311 (60%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I+ + + +D+TFA+ L  Q R +++++  P  +++R+ KI  + + L +
Sbjct: 1   MNLKVGVLMDPIANIAIHKDTTFAMLLALQARQHEVYYLEPADIFLRNEKILGSMRRLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
            +   Q+++L E +I  L  +DV+L+R+DPPFNM Y+  TYLLE        +VN P  +
Sbjct: 61  ADDPSQWFNLSESEIKPLHALDVLLMRKDPPFNMSYVYLTYLLELAEKQGLFVVNKPASL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   F    P TL++     +  F  E K+++IKPL    G  +F +T+ D N
Sbjct: 121 RDANEKLFTGWFPHCTPKTLVTSRKAILQEFIREQKEVVIKPLGAMAGESIFYLTVNDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              +IE +     + +M Q ++P+++ GDKRI+L++G+P+     RIP + D R N+  G
Sbjct: 181 IPVVIETMTANGHQLVMAQRFIPEVKSGDKRIILIDGEPIPYTLARIPPKGDFRGNLARG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
            K E  +LT  D  IC+++G +LR++GL+F G+D+IGDY+TEINVTSPT +RE+      
Sbjct: 241 AKGEGRELTDRDRWICEQVGPTLRKKGLWFVGLDIIGDYLTEINVTSPTGVRELQAQFDV 300

Query: 301 NVASLFWDGIE 311
           ++A  F   +E
Sbjct: 301 DIAGQFIAFLE 311


>gi|330818408|ref|YP_004362113.1| Glutathione synthetase [Burkholderia gladioli BSR3]
 gi|327370801|gb|AEA62157.1| Glutathione synthetase [Burkholderia gladioli BSR3]
          Length = 318

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 123/315 (39%), Positives = 187/315 (59%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   ++ +DST+A+  EA  RG+ I    P QL    S + A+ + +++  
Sbjct: 1   MDILFIADPLDRFRIYKDSTYAMMAEAARRGHTIHACEPQQLAWTGSSVEADVRRVTIVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++ ++  G  +   L+    +L+R+DPPF+M Y+TST+LLE        IVN P
Sbjct: 61  DTADLHRDTWFEAGAAESRALTSFGAVLMRKDPPFDMEYVTSTWLLEMAERAGARIVNRP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD+ ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QAIRDHSEKLAIGEFPQFVAPTLVTRDVARLRAFHAEHGDVIVKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S++EML E     LMIQ ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIVEMLGEDGRRSLMIQKFIPEIKAGDKRILLIGGEPVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D +I   +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGVGVAQPLTERDREIAAALGPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFVDALER 315


>gi|239813451|ref|YP_002942361.1| glutathione synthetase [Variovorax paradoxus S110]
 gi|239800028|gb|ACS17095.1| glutathione synthetase [Variovorax paradoxus S110]
          Length = 317

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 184/315 (58%), Gaps = 3/315 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQL-YMRDSKIYANTQPLSL 62
           ++NI    + +   K+ +D+TF++  EAQ RGY+I    P++L ++    + AN Q ++L
Sbjct: 1   MKNILFVADPLDHFKIYKDTTFSMMREAQRRGYRIAACLPEELQWVSGGLVTANVQQITL 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
               + +Y     +   L   D +L+R+DPPF+  YI +T+LLE+       +VN P  +
Sbjct: 61  TGDSKAWYREDIRESKALKDFDAVLMRKDPPFDAEYIYATHLLEQAEREGAHVVNKPRAL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+ PEK+ + EF +   PTL++R    +  F+ E  DII+KPL G GG G+FR+     N
Sbjct: 121 RDHPEKLAIMEFPQFTTPTLVTRSAQAVRDFHAEHGDIILKPLDGMGGMGIFRVRQDALN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
             S++E L +   E +M+Q ++P I  GDKRIL++ G+P   V  RIP   + R N+ AG
Sbjct: 181 LGSIVETLNKNGAETIMVQRFVPDIVQGDKRILIIAGEPAPFVLARIPQGTEVRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           GK     LT  + +I + +G +L  RGL   G+DVIGD +TEINVTSPTC +EI    G 
Sbjct: 241 GKGVAQPLTPRNREIAETVGRALAPRGLLLIGLDVIGDCVTEINVTSPTCFQEITEQTGF 300

Query: 301 NVASLFWDGIEKIKE 315
           +V ++F D +EK   
Sbjct: 301 DVPAMFIDALEKTLR 315


>gi|206559130|ref|YP_002229890.1| glutathione synthetase [Burkholderia cenocepacia J2315]
 gi|198035167|emb|CAR51041.1| glutathione synthetase [Burkholderia cenocepacia J2315]
          Length = 318

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 116/315 (36%), Positives = 179/315 (56%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+ +EA  RG+ ++   P  L    S + A+ + ++   
Sbjct: 1   MDILFIADPLEHFKIYKDSTYAMMVEAARRGHAVYACEPRHLAWTGSAVEADVRRITFVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++ ++  G      L     +L+R+DPPF+M Y+TST+LLE        + N  
Sbjct: 61  ELDDLHRDTWFDAGPVDARRLESFGAVLMRKDPPFDMEYVTSTWLLELAERAGARVFNKA 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAKRLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S++EML       +M Q ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIVEMLSHDGTRSVMAQKFIPEIKAGDKRILLIGGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I   +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTARDREIADTLGPVLASRGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|161829923|ref|YP_001597693.1| glutathione synthetase [Coxiella burnetii RSA 331]
 gi|161761790|gb|ABX77432.1| glutathione synthase [Coxiella burnetii RSA 331]
          Length = 321

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 111/311 (35%), Positives = 188/311 (60%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I+ + + +D+TFA+ L  Q R +++++  P  +++R+ KI  + + L +
Sbjct: 1   MNLKVGVLMDPIANIAIHKDTTFAMLLALQARQHEVYYLEPADIFLRNEKILGSMRRLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
            +   Q+++L E +I  L  +DV+L+R+DPPFNM Y+  TYLLE        +VN P  +
Sbjct: 61  ADDPSQWFNLSESEIKPLHALDVLLMRKDPPFNMSYVYLTYLLELAEKQGLFVVNKPASL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   F    P TL++     +  F  E K+++IKPL    G  +F +T+ D N
Sbjct: 121 RDANEKLFTGWFPHCTPKTLVTSRKAILQEFIREQKEVVIKPLGAMAGKSIFYLTVNDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              +IE +     + +M Q ++P+++ GDKRI+L++G+P+     RIP + D R N+  G
Sbjct: 181 IPVVIETMTANGHQLVMAQRFIPEVKSGDKRIILIDGEPIPYTLARIPPKGDFRGNLARG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
            K E  +LT  D  IC+++G +LR++GL+F G+D+IGDY+TEINVTSPT +RE+      
Sbjct: 241 AKGEGRELTDRDRWICEQVGPTLRKKGLWFVGLDIIGDYLTEINVTSPTGVRELQAQFDV 300

Query: 301 NVASLFWDGIE 311
           ++A  F   +E
Sbjct: 301 DIAGQFIAFLE 311


>gi|184159852|ref|YP_001848191.1| glutathione synthetase [Acinetobacter baumannii ACICU]
 gi|183211446|gb|ACC58844.1| Glutathione synthase/Ribosomal protein S6 modification enzyme
           (glutaminyl transferase) [Acinetobacter baumannii ACICU]
          Length = 314

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 130/309 (42%), Positives = 191/309 (61%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             + + M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E
Sbjct: 1   MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLIAPLKVFE 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
               YY LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+
Sbjct: 61  DYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+F T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  
Sbjct: 121 CNEKLFATQFPELQVPTLVTSQQSLIREFITEHGDVIVKPLDGMGGMGIFRLYQDGVNIG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S +EML E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG 
Sbjct: 181 STLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGL 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   LT+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++
Sbjct: 241 GQARPLTENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI 300

Query: 303 ASLFWDGIE 311
           A   +D +E
Sbjct: 301 ADDLFDVLE 309


>gi|46203674|ref|ZP_00051179.2| COG0189: Glutathione synthase/Ribosomal protein S6 modification
           enzyme (glutaminyl transferase) [Magnetospirillum
           magnetotacticum MS-1]
          Length = 314

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 140/301 (46%), Positives = 214/301 (71%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+ I ++++  D+TFA+ LEAQ RG++++ YTPD+L ++   + A   P+++ + +  + 
Sbjct: 1   MDPIQSIRIAGDTTFALMLEAQARGHRLYTYTPDRLSLQGRSVTAYAAPVTVQDVEGAHA 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFV 130
           +L   + IDLS++DV+L+RQDPPF+M Y+T+T++LEK+   TL+VN+P  +RN+PEK+FV
Sbjct: 61  ALQPPQRIDLSEVDVVLMRQDPPFDMAYVTATHMLEKVAARTLVVNDPAEVRNAPEKLFV 120

Query: 131 TEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLF 190
            +F ELMPPTLISRD  +I  F  E   I +KPL+G+GG  VFR++  D NF S+ ++  
Sbjct: 121 LDFPELMPPTLISRDRAEIDAFRAEHGTIAMKPLHGHGGAAVFRVSREDPNFGSMFDLFS 180

Query: 191 EKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTK 250
             + E  ++Q +L ++ +GDKRI+L++G+P+GA+NR+P++ D RSN+  GG A  ++LT+
Sbjct: 181 ATFREQWVVQRFLERVTEGDKRIILVDGEPMGAINRVPAKGDIRSNMVRGGAAGASELTE 240

Query: 251 IDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGI 310
            + +IC  IG  LR RGL   GIDVI  ++TEINVTSPT IR I R GG ++A   WD I
Sbjct: 241 REREICATIGPELRRRGLVLVGIDVIDGHLTEINVTSPTGIRAIKRLGGPDLAVSVWDAI 300

Query: 311 E 311
           E
Sbjct: 301 E 301


>gi|16330125|ref|NP_440853.1| glutathione synthetase [Synechocystis sp. PCC 6803]
 gi|8134484|sp|P73493|GSHB_SYNY3 RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|1652612|dbj|BAA17533.1| glutathione synthetase [Synechocystis sp. PCC 6803]
          Length = 320

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 114/318 (35%), Positives = 189/318 (59%), Gaps = 10/318 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYA-----NTQP 59
             +A  ++ +  +    DST AI   AQ  G+++F  +   L + + + +A       QP
Sbjct: 1   MKLAFIIDPLEKLDPGHDSTVAIMEAAQKLGHEVFVTSVGDLAVINGQAWAKLAAVRLQP 60

Query: 60  LSLDEKKEQ----YYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLI 114
           + L +   Q    +  L + + + L++   + +R+DPP  + Y+ +T++LE     +T++
Sbjct: 61  VILVDGHWQVSQPWSELSKSQWMALTECQAVFMRKDPPVTVQYLYATFILELLAPTKTMV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+P  +R + EK++  +F+ +MPPT++S D   I +F  E    ++KPL G  G G+  
Sbjct: 121 INSPQGLREANEKMYTLQFAAVMPPTVVSLDKGLIRQFLEEHGAAVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+SL+E+  +   EP+M+Q +LP+ ++GDKRI+LL+G P+GAVNRIPS  + R
Sbjct: 181 LDPGDRNFNSLVEISTQHGKEPVMVQRFLPEAKEGDKRIILLDGDPIGAVNRIPSGAEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+   T +T  +++IC  +   L+  GL+F GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 GNMAVGGQVAPTTITSREIEICALLKPKLQADGLYFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIEK 312
            R  G  +       +EK
Sbjct: 301 DRLEGVRLGEKVICWLEK 318


>gi|238028721|ref|YP_002912952.1| glutathione synthetase [Burkholderia glumae BGR1]
 gi|237877915|gb|ACR30248.1| Glutathione synthetase [Burkholderia glumae BGR1]
          Length = 318

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 118/315 (37%), Positives = 183/315 (58%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
            +I    + +   ++ +DST+A+  EA  RG+ ++   P QL    + + A+ + +++  
Sbjct: 1   MDILFIADPLDCFRIYKDSTYAMMAEAARRGHAVYACEPRQLAWSGTSVEADVRRVTIVG 60

Query: 65  KKEQ-----YYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
             +      ++     +   L+    +L+R+DPPF+M Y+TST+LLE        IVN P
Sbjct: 61  DPDDLHRDTWFEAAAPEARALAAFGAVLMRKDPPFDMEYVTSTWLLEMAERAGAKIVNRP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIAEFPQFVAPTLVTRDAARLRAFHAEHGDVIVKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S++EML E     LM+Q ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIVEMLGEDGRRTLMVQKFIPEIKAGDKRILLIGGEPVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I   +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGIGVAQPLTARDREIAAALGPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFVDALER 315


>gi|71275840|ref|ZP_00652124.1| Glutathione synthetase, prokaryotic [Xylella fastidiosa Dixon]
 gi|71899336|ref|ZP_00681496.1| Glutathione synthetase, prokaryotic [Xylella fastidiosa Ann-1]
 gi|170730178|ref|YP_001775611.1| glutathione synthetase [Xylella fastidiosa M12]
 gi|71163418|gb|EAO13136.1| Glutathione synthetase, prokaryotic [Xylella fastidiosa Dixon]
 gi|71730850|gb|EAO32921.1| Glutathione synthetase, prokaryotic [Xylella fastidiosa Ann-1]
 gi|167964971|gb|ACA11981.1| Glutathione synthase [Xylella fastidiosa M12]
          Length = 314

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 121/311 (38%), Positives = 183/311 (58%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+ +K+ +D+TFA+ LE Q R +++ +  P  L + + + +A T PL +
Sbjct: 1   MPLDVVVVMDPITGIKIAKDTTFALLLEGQRRSHRLHYVHPGSLSLNEGRTFAQTAPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            + K  +Y+LGE     L Q  +IL+R+DPP N  +I  T LL         ++N+P  +
Sbjct: 61  RDNKTDWYTLGEFSETQLGQGQIILMRKDPPVNAEFIYDTQLLSIAQAAGAQVINHPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTLISRD+  +  F  + +  I+KPL G GG  +FR + GD N
Sbjct: 121 RDLNEKLAAQLFPQCCPPTLISRDMRALKMFVQKQEQAILKPLDGMGGHSIFRSSNGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +      + Q YL QI +GDKRILL++G P+     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGGRTLAIAQRYLQQIIEGDKRILLIDGVPIDHCLARIPQGDEFRGNMAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L + D  I  ++G  +R RG+ F GIDVIGDY+TEINVTSPTC+RE+    G 
Sbjct: 241 GRGESRPLNERDRWIAAQVGPEMRRRGMRFVGIDVIGDYLTEINVTSPTCLRELDAQCGL 300

Query: 301 NVASLFWDGIE 311
           N+A   +D IE
Sbjct: 301 NIAGQLFDAIE 311


>gi|299529423|ref|ZP_07042861.1| glutathione synthetase [Comamonas testosteroni S44]
 gi|298722672|gb|EFI63591.1| glutathione synthetase [Comamonas testosteroni S44]
          Length = 315

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 181/311 (58%), Gaps = 3/311 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMR-DSKIYANTQPLSLD 63
             I    + + +  + +DSTFA+  EAQ RG+QI    P  +  +   K+ A  + +SL 
Sbjct: 1   MQILFVADPLESFVIYKDSTFAMMREAQRRGHQIVACEPRHVSWQSGGKVMAQVRHISLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLL-EKINPETLIVNNPFWIR 122
            ++++++      +  L+  D I++R+DPPF+  +  +T++L +       + N P  +R
Sbjct: 61  GEQDRWFEETRSALTALADFDAIVMRKDPPFDSEFFYATHMLGQAEREGAKVFNKPSALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
             PEK+ + EF++ + PTL++R    I  F+ E KDII+KPL G GG G+FR+    RN 
Sbjct: 121 EHPEKLAIMEFAQFISPTLVTRSAQDIRAFHAEHKDIILKPLDGMGGMGIFRVGEDGRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L +     +M+Q +LP I  GDKR+L++ GKPV     RIP   + R N+ AGG
Sbjct: 181 GSIIETLNQGGSTSVMVQKFLPDIVHGDKRVLIIGGKPVPFCLARIPQGNEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L + D  I + IGE L +RGL   G+DVIG  +TEINVTSPTC +EI    G +
Sbjct: 241 KGVAQPLAEQDKAIAEFIGERLVQRGLLLIGLDVIGHNVTEINVTSPTCFQEIFDQTGCD 300

Query: 302 VASLFWDGIEK 312
           VA+LF D +E+
Sbjct: 301 VAALFVDALEQ 311


>gi|126657636|ref|ZP_01728791.1| glutathione synthetase [Cyanothece sp. CCY0110]
 gi|126621092|gb|EAZ91806.1| glutathione synthetase [Cyanothece sp. CCY0110]
          Length = 322

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 122/316 (38%), Positives = 192/316 (60%), Gaps = 10/316 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYA-----NTQP 59
             +A  ++ I+ +    DST AI   AQ  G++++     QL + D K +A         
Sbjct: 1   MKLAFIIDPIANLNPAHDSTVAIMEAAQNLGHEVWITEIHQLSVIDGKAWAVLSQVQLTS 60

Query: 60  LSLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLI 114
           ++L + K     Q+Y +   ++  L  MD + +R+DPP  + Y+ +TY+LE I+P  TL+
Sbjct: 61  VTLQDGKWVSVSQWYQVSPGELRCLEDMDAVWMRKDPPVTIRYLYATYILELIDPTNTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+P  +R + EK++  +F  +MP T++S D   I +F  E    ++KPL G  G G+  
Sbjct: 121 INSPQGLREANEKMYTLQFYSVMPETVVSLDKKVIRQFVEEKTQAVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+S+IE+      EP+M+Q +LP+ ++GDKRI+LL+GKP+GAVNR+P+  + R
Sbjct: 181 LEPGDRNFNSIIEVSTYHGQEPVMVQRFLPEAKNGDKRIILLDGKPIGAVNRVPTGQEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+ E T+LT  +  IC+ +G  LR+ GL+F GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 GNMAVGGRVEKTELTPREEHICEVVGSRLRKNGLYFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGI 310
               G N+     + +
Sbjct: 301 DLLDGTNLGLEVVEWL 316


>gi|221069992|ref|ZP_03546097.1| glutathione synthetase [Comamonas testosteroni KF-1]
 gi|220715015|gb|EED70383.1| glutathione synthetase [Comamonas testosteroni KF-1]
          Length = 315

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 118/311 (37%), Positives = 179/311 (57%), Gaps = 3/311 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMR-DSKIYANTQPLSLD 63
             I    + + +  + +DSTFA+  EAQ RG+QI    P  +  +   K+ A  + ++L 
Sbjct: 1   MQILFVADPLESFVIYKDSTFAMMREAQRRGHQIVACEPCHISWQSGGKVKARVRHITLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLL-EKINPETLIVNNPFWIR 122
             K++++   +     L+    I++R+DPPF+  +  +T++L +       + N P  +R
Sbjct: 61  GDKDRWFEETQSTRAVLADFGAIVMRKDPPFDSEFFYATHMLGQAEREGAKVFNKPGALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
             PEK+ + EF++ + PTL++R    I  F+ E +DII+KPL G GG G+FR+    RN 
Sbjct: 121 EHPEKLAIMEFAQFISPTLVTRSAEDIRAFHAEHQDIILKPLDGMGGMGIFRVGEDGRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L +     +M+Q +LP I  GDKR+L++ GKPV     RIP   + R N+ AGG
Sbjct: 181 GSIIETLNQGGSTSVMVQKFLPDIVHGDKRVLIIGGKPVPFCLARIPQGNEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L + D  I + IGE L +RGL   G+DVIG  +TEINVTSPTC +EI    G +
Sbjct: 241 KGVAQPLAEQDKAIAEFIGERLVQRGLLLIGLDVIGHNVTEINVTSPTCFQEIFDQTGCD 300

Query: 302 VASLFWDGIEK 312
           VASLF D +E+
Sbjct: 301 VASLFVDALEQ 311


>gi|167568619|ref|ZP_02361493.1| glutathione synthetase [Burkholderia oklahomensis C6786]
          Length = 318

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 119/314 (37%), Positives = 186/314 (59%), Gaps = 7/314 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P+QL    + + A+ + +++  
Sbjct: 1   MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWTVAGVEADVRRVTIVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++++Y     +   L     IL+R+DPPF+M Y+TST+LLE        + N P
Sbjct: 61  DTADLHRDRWYEARAHESRALPSFGAILMRKDPPFDMEYVTSTWLLELAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + P+L++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QTIRDHSEKLAIGEFAQFVSPSLVTRDAARLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M+Q ++P+I+ GDKRILL++G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEPVPYSLARIPQGNEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D +I   +G  L  RGL   G+DVIGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGVGVAQPLTERDREIAATLGPVLAARGLLLVGLDVIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIE 311
            G +VA +F D +E
Sbjct: 301 TGYDVAGMFVDALE 314


>gi|56751787|ref|YP_172488.1| glutathione synthetase [Synechococcus elongatus PCC 6301]
 gi|81301133|ref|YP_401341.1| glutathione synthetase [Synechococcus elongatus PCC 7942]
 gi|8134483|sp|O32463|GSHB_SYNE7 RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|2547074|dbj|BAA22859.1| glutathione synthetase [Synechococcus elongatus PCC 7942]
 gi|56686746|dbj|BAD79968.1| glutathione synthetase [Synechococcus elongatus PCC 6301]
 gi|81170014|gb|ABB58354.1| glutathione synthase [Synechococcus elongatus PCC 7942]
          Length = 323

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 116/320 (36%), Positives = 191/320 (59%), Gaps = 10/320 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A  ++ I+ +    DST A+   AQ+RG++I+      L +   +     +PL ++ 
Sbjct: 1   MKLAFLIDPIAALDPTHDSTVALMEAAQLRGHEIWIGEISDLSVHVGEPLGLLRPLKIEP 60

Query: 65  KKE---------QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPE-TLI 114
            +           +++ GE K   L     + +R+DPP    Y+ +TYLL+ ++P+ T +
Sbjct: 61  VQWLGDRWQVANPWFTAGEAKRRSLHDFAAVFMRKDPPVTTAYLYATYLLDLVDPKKTRV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           VN+P  +R++ EK++  +F  ++P TL+S +  +I  F  E++  ++KPL G  G G+  
Sbjct: 121 VNSPEGLRHANEKMYALQFQSVVPRTLVSSNKAEIRAFLDELRAAVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+SL+E+  ++   P+M+Q YLP+ +DGDKRI+L+NG+P+GAVNR+P+  + R
Sbjct: 181 LDPGDRNFNSLVEISTQQGQLPVMVQQYLPEAKDGDKRIILVNGEPLGAVNRVPTGREFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+ E   +T  D +IC  +   LR+ GLFF GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 GNMAVGGRVEAVPITDRDREICAAVAPRLRQDGLFFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIEKIK 314
            R  G ++       +E + 
Sbjct: 301 DRLNGVSIGDQTIAALEALV 320


>gi|58581368|ref|YP_200384.1| glutathione synthetase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58425962|gb|AAW74999.1| glutathione synthetase [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 323

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 118/311 (37%), Positives = 186/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ L+AQ RG+++ +  P  L +R+ +  A   PLS+
Sbjct: 8   MSLDVVVVMDPIASIKIAKDTTFAMLLDAQRRGHRLHYVRPGGLSLREGRAVAQVAPLSV 67

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            E K  +++LGE   ++     V+L+R+DPP +  ++  T +L         IVN+P  +
Sbjct: 68  REDKTNWFTLGEFAELEFGPGQVVLMRKDPPVDAEFVYDTQVLSVAQRAGAQIVNDPQGL 127

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 128 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLEHGQAVLKPLDGMGGRSIFRSGTGDPN 187

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G PV     RIP   + R N+ AG
Sbjct: 188 LNVILETLTDGNRKLTLAQRFIPDISAGDKRILLVDGVPVDYCLARIPQGDEFRGNLAAG 247

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  +R RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 248 GRGEGRLLSERDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 307

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 308 NIAGLLFDAIE 318


>gi|84623303|ref|YP_450675.1| glutathione synthetase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188577392|ref|YP_001914321.1| glutathione synthetase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84367243|dbj|BAE68401.1| glutathione synthetase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521844|gb|ACD59789.1| glutathione synthase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 316

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 118/311 (37%), Positives = 186/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K+ +D+TFA+ L+AQ RG+++ +  P  L +R+ +  A   PLS+
Sbjct: 1   MSLDVVVVMDPIASIKIAKDTTFAMLLDAQRRGHRLHYVRPGGLSLREGRAVAQVAPLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWI 121
            E K  +++LGE   ++     V+L+R+DPP +  ++  T +L         IVN+P  +
Sbjct: 61  REDKTNWFTLGEFAELEFGPGQVVLMRKDPPVDAEFVYDTQVLSVAQRAGAQIVNDPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTL+SRD   +  F LE    ++KPL G GG  +FR   GD N
Sbjct: 121 RDYNEKLAALLFPQCCPPTLVSRDAAALKAFVLEHGQAVLKPLDGMGGRSIFRSGTGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +   +  + Q ++P I  GDKRILL++G PV     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGNRKLTLAQRFIPDISAGDKRILLVDGVPVDYCLARIPQGDEFRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L++ D  I  ++G  +R RG+ F G+DVIGDY+TE+NVTSPTC+RE+    G 
Sbjct: 241 GRGEGRLLSERDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL 300

Query: 301 NVASLFWDGIE 311
           N+A L +D IE
Sbjct: 301 NIAGLLFDAIE 311


>gi|73540000|ref|YP_294520.1| glutathione synthetase [Ralstonia eutropha JMP134]
 gi|72117413|gb|AAZ59676.1| glutathione synthase [Ralstonia eutropha JMP134]
          Length = 317

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 128/309 (41%), Positives = 181/309 (58%), Gaps = 2/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I    + + T K  +DST+A+  EA  RG+ +F     QL +   ++     PL L  
Sbjct: 1   MRILFITDPLETFKTYKDSTYAMMTEAAARGHHVFWSLQSQLSLFGDQVETVATPLQLTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRN 123
               +Y  G   +  L   D +L+R+DPPF+M Y+TST+LLE   +    + N P  IR+
Sbjct: 61  DSHDWYREGTPALTSLKDFDAVLMRKDPPFDMEYVTSTWLLELAESQGARVFNKPRAIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F E + PTL++RDI +I  F+ E +DIIIKPL G GG GVFR+     N  
Sbjct: 121 HSEKLAINQFPEFITPTLVTRDIARIRDFHAEHRDIIIKPLDGMGGMGVFRVGADGMNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
           +++E L E     LMIQ Y+P I+DGDKRILL+ G PV   + R+P   + R N+ AGG 
Sbjct: 181 AIVETLGEDGRRTLMIQRYIPAIKDGDKRILLIGGVPVPYSLARVPMAGEVRGNLAAGGT 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
               +LT  D DI + +   L E+GL   G+DVIGDY+TE+NVTSPTC +EI +  G  V
Sbjct: 241 GRAQELTVRDRDIAEALAPGLWEQGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFQV 300

Query: 303 ASLFWDGIE 311
           A++F D +E
Sbjct: 301 AAMFIDALE 309


>gi|118602109|ref|YP_903324.1| glutathione synthase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567048|gb|ABL01853.1| glutathione synthase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 320

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 129/318 (40%), Positives = 193/318 (60%), Gaps = 3/318 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           MKKI  IA+ MN IST+  K+DS+ A+ LEA  RG++I+ +    L+ +D  ++A+    
Sbjct: 1   MKKI-KIAVLMNDISTINPKKDSSLAMMLEASKRGWEIYTFDTTDLFAQDGLVFADCAKT 59

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPF 119
           ++    + ++      ++ L + DVIL+R+DPPF+M YI STYLLE+  N   L+VN P 
Sbjct: 60  TVSNNLDHWFERKTNVVMTLDEFDVILMRKDPPFDMTYIYSTYLLEQAENKGVLVVNKPQ 119

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R++ EK+F   F   MP TL+S +  +I  F       +IKPL G GG  +F++   D
Sbjct: 120 SLRDANEKLFALNFPHCMPKTLVSANQNKIKAFIKTQNTAVIKPLDGMGGYDIFKLESYD 179

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
               ++++ L      P+M Q++LP I  GDKRILL+NGKPV   + RIP++ + + N+ 
Sbjct: 180 ITIDAVLKRLTNNGKHPIMAQAFLPDIDKGDKRILLINGKPVDYALARIPAKGNFKGNLA 239

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AG K     L+  D  +C++I  +L+ +GL F G+DVIGDYITEINVTSPTCIRE+    
Sbjct: 240 AGAKGVGQLLSDRDRYLCEQIAPTLKTKGLIFVGLDVIGDYITEINVTSPTCIRELDTQF 299

Query: 299 GENVASLFWDGIEKIKET 316
             N+A    + IE+   T
Sbjct: 300 NLNIAGELLNVIEQKIST 317


>gi|193222203|emb|CAL60381.2| glutathione synthetase (Glutathione synthase) (GSH synthetase)
           (GSH-S) (GSHase) [Herminiimonas arsenicoxydans]
          Length = 317

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 117/310 (37%), Positives = 175/310 (56%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             IA   + +   K+ +DST+A+  EA  RG+ I  +    +     K+ AN   ++L  
Sbjct: 1   MKIAFICDPLDGFKIYKDSTYAMMTEAARRGHAIHVFQHKDMAFEGGKVVANISRVTLTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRN 123
               +Y     +  DL+  D IL R DPPFNM YI +TYLLE        I N P  IR+
Sbjct: 61  DPVDWYRREVPQEQDLTAFDAILERTDPPFNMEYIYATYLLELAQQQGARIFNKPEAIRS 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+ + +F   + PTL+S D  ++  F+ E +DII+KPL G GG G+FR+     N  
Sbjct: 121 FNEKLAIAQFPHYITPTLVSSDAARVRAFHDEHRDIILKPLDGMGGAGIFRVMDDALNLG 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGK 242
           S+IE L +   + +M+Q Y+P+I  GDKRILL+ G+ V     RIP   + R N+  GG 
Sbjct: 181 SIIETLTDNGRQTIMVQRYIPEITQGDKRILLIGGQVVPYCLARIPQGTEIRGNLAVGGV 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
               +++  D ++ + +   L +RGL   G+D IGDY+TE+NVTSPTC +EI +  G +V
Sbjct: 241 GVAHEISARDREMGEALAPVLLKRGLLLVGLDAIGDYMTELNVTSPTCFQEIRQQTGFDV 300

Query: 303 ASLFWDGIEK 312
           A++F + +EK
Sbjct: 301 AAMFVNALEK 310


>gi|87121177|ref|ZP_01077068.1| glutathione synthetase [Marinomonas sp. MED121]
 gi|86163669|gb|EAQ64943.1| glutathione synthetase [Marinomonas sp. MED121]
          Length = 307

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 123/306 (40%), Positives = 198/306 (64%), Gaps = 2/306 (0%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+ I+ +  K+DS+ A+   A  +G+Q+ +   + LY+   K  A  +PL + +  E +Y
Sbjct: 1   MDPIANINYKKDSSLAMLWAAADKGWQLIYMEQEDLYLDSGKACAIAKPLKVFKDPENFY 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRNSPEKIF 129
           SLG+ + I L  +DVIL+R+DPPF+  ++ ST +LE+      ++VNNP  +R+  EK+F
Sbjct: 61  SLGDSEKIALGDLDVILMRKDPPFDSEFVYSTMILEQAERDGAMVVNNPASLRDCNEKLF 120

Query: 130 VTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEML 189
            T+F +  P  L++R    +  F+ E  D+I KPL G GG+ +FR+   D N S +IE L
Sbjct: 121 ATQFPQCCPAVLVTRRSDLLKEFHKEHGDVIFKPLDGMGGSSIFRLRQDDPNVSVIIETL 180

Query: 190 FEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGKAELTKL 248
            +   E +M Q ++P+I+ GDKRIL+++G+PV   + RIP++ + R N+ AGG+ E  +L
Sbjct: 181 TKMGCEQIMAQKFIPEIKQGDKRILIVDGEPVPYALARIPAQGETRGNLAAGGRGEGREL 240

Query: 249 TKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWD 308
           ++ DL IC+++  +L+E+GL F G+DVIGD++TEINVTSPTCIRE++   G ++A    +
Sbjct: 241 SERDLWICQQVIPTLKEKGLMFVGLDVIGDFLTEINVTSPTCIRELNDTYGLDIAMDLMN 300

Query: 309 GIEKIK 314
            IEK  
Sbjct: 301 AIEKKL 306


>gi|294012829|ref|YP_003546289.1| glutathione synthase [Sphingobium japonicum UT26S]
 gi|292676159|dbj|BAI97677.1| glutathione synthase [Sphingobium japonicum UT26S]
          Length = 324

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 134/306 (43%), Positives = 208/306 (67%), Gaps = 2/306 (0%)

Query: 7   IAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK 66
           +A+QM+ +  +++  DSTF I L  Q RG++++HY    L  RD ++ A  +P+ + + +
Sbjct: 9   VAVQMDPMEGIRIGGDSTFHIMLAGQARGHRLYHYLAPDLTYRDGRVLAKARPVKVQKVE 68

Query: 67  EQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSP 125
             ++  GE +++DL   +DV+L+RQDPPF++ YIT+T+LLE++  ETL+VN+P  +RN+P
Sbjct: 69  GDHFVFGEPEMLDLGRDVDVVLMRQDPPFDLSYITATHLLERVQEETLVVNDPASVRNAP 128

Query: 126 EKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSL 185
           EK+FV +++  MPPT+I+RD+ Q+  F  +  +I++KPLYGN G  VF +     N S+L
Sbjct: 129 EKLFVLDYARFMPPTMITRDLEQVKSFLAQHGEIVVKPLYGNAGNAVFHVGRSGANLSAL 188

Query: 186 IEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAEL 245
           +E+    + EP M+Q+++P + +GDKRI+L++G+  GAVNRIP   + RSN+  GG A  
Sbjct: 189 VELFNASWVEPFMVQAFIPGVAEGDKRIVLVDGEVAGAVNRIPGAGEIRSNLAVGGSAAK 248

Query: 246 TKLTKIDLDICKRIGESLRERGLFFTGIDVIGD-YITEINVTSPTCIREIHRNGGENVAS 304
           T LT+ +L+IC+ +G  L+ RGL F GIDVIG  ++TEINVTSPT I  I    G N   
Sbjct: 249 TVLTERELEICEALGPELKRRGLLFVGIDVIGGEWLTEINVTSPTGIVSIDAFNGTNTGG 308

Query: 305 LFWDGI 310
           + WD I
Sbjct: 309 MIWDAI 314


>gi|254447446|ref|ZP_05060912.1| glutathione synthase [gamma proteobacterium HTCC5015]
 gi|198262789|gb|EDY87068.1| glutathione synthase [gamma proteobacterium HTCC5015]
          Length = 320

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 121/312 (38%), Positives = 182/312 (58%), Gaps = 3/312 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M   R I   M+ I  +K  +DST A+ L AQ R +Q+ + T D++YM +  + A     
Sbjct: 1   MSSARRIVFLMDPIEDIKPHKDSTLAMMLAAQARDWQVHYATLDKIYMDNGTVRAEVTQA 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPF 119
           ++ + ++ +YS      I L ++D+I++R+DPPF+  Y+   +LLE       ++VN+P 
Sbjct: 61  TVFDDQQHWYSDQRTCDIALGEIDIIMMRKDPPFDSEYLYCCHLLEFARRAGAVVVNHPE 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            + N  EK+ +  F E   PTL++R    I  F    +D I+KPL G GG  +FR+   D
Sbjct: 121 ALCNINEKLLIGLFPEYCTPTLVTRQTQAIRSFLDTHEDAILKPLDGMGGASIFRLRKND 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N   ++E + +     LM+Q YLP I+ GDKRILL+NG+ V   + RIP+E +NR N+ 
Sbjct: 181 SNVGVILETMSQNSQR-LMVQRYLPDIKQGDKRILLINGQAVDYALARIPTEGENRGNLA 239

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+ E   LT+ D +I   +G  L  RG+ F G+DVIGDY+TE+NVTSPTCIRE+    
Sbjct: 240 AGGRGEARPLTQRDREIAAAVGPELVRRGVIFAGLDVIGDYLTEVNVTSPTCIRELDAQC 299

Query: 299 GENVASLFWDGI 310
             ++A    D I
Sbjct: 300 NLDIAGDLLDAI 311


>gi|332529260|ref|ZP_08405223.1| glutathione synthetase [Hylemonella gracilis ATCC 19624]
 gi|332041270|gb|EGI77633.1| glutathione synthetase [Hylemonella gracilis ATCC 19624]
          Length = 320

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 112/314 (35%), Positives = 177/314 (56%), Gaps = 7/314 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQL-YMRDSK----IYANTQP 59
                  + + + K+ +DST+A+  E+  RG+++    P +L ++ D +    + A  + 
Sbjct: 1   MKFLFIADPLESFKINKDSTYAMMRESARRGHELAACEPGRLRWVSDGRTGGPVRAQVRD 60

Query: 60  LSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNP 118
           + L    + ++     +   L   D +L+R+DPPF+  Y  +T+LLE+       + N P
Sbjct: 61  IVLTGHSDPWFRESTVRDTALRDFDAVLMRKDPPFDSEYFYATHLLEQAEREGARVYNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             +R+ PEK+ + EF + + PTL++R+   +  F+ E +DII+KPL G GG G+FR+   
Sbjct: 121 RALRDHPEKLAILEFPQFIAPTLVTREPQAVRDFHSEHRDIILKPLDGMGGMGIFRVKDD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IE L +   + LM+Q ++P I  GDKRIL++ G+PV   + RIP   + R N+
Sbjct: 181 GLNLGSIIETLNQDGAQTLMVQKFIPAIAQGDKRILVIGGQPVPYALARIPQGGEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGGK     LT  D +I   +G  L  RGL   G+DVIG+ +TEINVTSPTC +EI   
Sbjct: 241 AAGGKGVAQPLTARDREIADSLGPLLASRGLLLVGLDVIGEQLTEINVTSPTCFQEISDQ 300

Query: 298 GGENVASLFWDGIE 311
            G +VA  F D +E
Sbjct: 301 SGFDVAKRFVDALE 314


>gi|170699797|ref|ZP_02890830.1| glutathione synthetase [Burkholderia ambifaria IOP40-10]
 gi|172061821|ref|YP_001809473.1| glutathione synthetase [Burkholderia ambifaria MC40-6]
 gi|170135324|gb|EDT03619.1| glutathione synthetase [Burkholderia ambifaria IOP40-10]
 gi|171994338|gb|ACB65257.1| glutathione synthetase [Burkholderia ambifaria MC40-6]
          Length = 318

 Score =  279 bits (714), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 118/315 (37%), Positives = 182/315 (57%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P QL    S + A+ Q +++  
Sbjct: 1   MDILFIADPLERFKIYKDSTYAMMAEAARRGHAVYTCQPHQLAWTGSGVEADVQRVTIVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  +  +Y  G  +   ++    +L+R+DPPF+M Y+T+T++LE        + N P
Sbjct: 61  DTTDLHRHPWYEAGAHESRQMTSFGAVLMRKDPPFDMEYVTATWMLELAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+    D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAARLRAFHAAHGDVIVKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  ++IEML       LMIQ ++P+I  GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGAIIEMLGHDGTRSLMIQKFIPEITAGDKRILLIAGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I + +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTPHDREIAETLGPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|307295095|ref|ZP_07574937.1| glutathione synthetase [Sphingobium chlorophenolicum L-1]
 gi|306879569|gb|EFN10787.1| glutathione synthetase [Sphingobium chlorophenolicum L-1]
          Length = 325

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 133/306 (43%), Positives = 208/306 (67%), Gaps = 2/306 (0%)

Query: 7   IAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK 66
           +A+QM+ +  +K+  DSTF I L  Q RG++++HY    L  RD ++ A  +P+ + + +
Sbjct: 10  VAVQMDPMEGIKIGGDSTFHIMLAGQARGHRLYHYLATDLTYRDGRVLAKARPVKVQKVE 69

Query: 67  EQYYSLGEEKIIDL-SQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSP 125
             +Y  GE +++DL   +DV+L+RQDPPF++ YIT+T+LLE++  ETL+VN+P  +RN+P
Sbjct: 70  GDHYVFGEPEMLDLGRDVDVVLMRQDPPFDLSYITATHLLERVQAETLVVNDPASVRNAP 129

Query: 126 EKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSL 185
           EK+FV +++  MPPT+I+RD+ ++  F  +  ++++KPLYGN G  VF +     N S+L
Sbjct: 130 EKLFVLDYARFMPPTMITRDLEEVKSFLAQHGEVVVKPLYGNAGNAVFHVGRSGANLSAL 189

Query: 186 IEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAEL 245
           +E+    + EP M+Q+++P + +GDKRI+L++G+  GAVNRIP   + RSN+  GG A  
Sbjct: 190 VELFNVSWVEPFMVQAFIPGVAEGDKRIVLVDGEIAGAVNRIPGAGEIRSNLAVGGSAAK 249

Query: 246 TKLTKIDLDICKRIGESLRERGLFFTGIDVIGD-YITEINVTSPTCIREIHRNGGENVAS 304
           T LT+ +L+IC+ +G  L+ RGL F GIDVIG  ++TEINVTSPT I  I    G +   
Sbjct: 250 TVLTERELEICEALGPELKWRGLLFVGIDVIGGEWLTEINVTSPTGIVSIDAFNGTDTGG 309

Query: 305 LFWDGI 310
           + WD I
Sbjct: 310 MIWDAI 315


>gi|115352969|ref|YP_774808.1| glutathione synthetase [Burkholderia ambifaria AMMD]
 gi|115282957|gb|ABI88474.1| glutathione synthase [Burkholderia ambifaria AMMD]
          Length = 318

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 182/315 (57%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ I+   P QL    S + A+ Q +++  
Sbjct: 1   MDILFIADPLERFKIYKDSTYAMMAEAARRGHAIYTCQPHQLAWTGSGVEADVQRVTIVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  +  +Y  G  +   ++    +L+R+DPPF+M Y+T+T++LE        + N P
Sbjct: 61  DTTDLHRHPWYEAGAHESRQMTSFGAVLMRKDPPFDMEYVTATWMLELAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+    D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAARLRAFHAAHGDVIVKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  ++IEML       LMIQ ++P+I  GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGAIIEMLGHDGTRSLMIQKFIPEITAGDKRILLIAGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I + +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTPHDREIAETLGPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|15838550|ref|NP_299238.1| glutathione synthetase [Xylella fastidiosa 9a5c]
 gi|20138406|sp|Q9PC29|GSHB_XYLFA RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|9107058|gb|AAF84758.1|AE004015_1 glutathione synthetase [Xylella fastidiosa 9a5c]
          Length = 314

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 120/311 (38%), Positives = 182/311 (58%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+ +K+ +D+TFA+ LE Q R +++ +  P  L + + + +A   PL +
Sbjct: 1   MPLDVVVVMDPITGIKIAKDTTFALLLEGQRRSHRLHYVHPGSLSLNEGRTFAQIAPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            + K  +Y+LGE     L Q  +IL+R+DPP N  +I  T LL         ++N+P  +
Sbjct: 61  RDNKTDWYTLGEFSETQLGQGQIILMRKDPPVNAEFIYDTQLLSIAQAAGAQVINHPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+    F +  PPTLISRD+  +  F  + +  I+KPL G GG  +FR + GD N
Sbjct: 121 RDLNEKLAAQLFPQCCPPTLISRDMRALKMFVQKQEQAILKPLDGMGGHSIFRSSNGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +      + Q YL QI +GDKRILL++G P+     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGGRTLAIAQRYLQQIIEGDKRILLIDGVPIDHCLARIPQGDEFRGNMAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L + D  I  ++G  +R RG+ F GIDVIGDY+TEINVTSPTC+RE+    G 
Sbjct: 241 GRGESRPLNEHDRWIAAQVGPEMRRRGMRFVGIDVIGDYLTEINVTSPTCLRELDAQCGL 300

Query: 301 NVASLFWDGIE 311
           N+A   +D IE
Sbjct: 301 NIAGQLFDAIE 311


>gi|71066307|ref|YP_265034.1| glutathione synthetase [Psychrobacter arcticus 273-4]
 gi|71039292|gb|AAZ19600.1| glutathione synthase [Psychrobacter arcticus 273-4]
          Length = 327

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 123/315 (39%), Positives = 193/315 (61%), Gaps = 2/315 (0%)

Query: 2   KKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
           KK  NI + M+ I  V  K+D++ A+   AQ RG+++ +     L++   ++  +TQ ++
Sbjct: 11  KKSLNILVIMDPIEQVNYKKDTSLAMMWSAQDRGHRLGYCQIHDLWLDRGQLMVDTQSVT 70

Query: 62  LDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFW 120
           +    + +Y LG +    +S  DVIL+R+DPPF+M +I +TY+L+       L+VN+P  
Sbjct: 71  VKRDPKDFYILGNKTTGSVSDYDVILMRKDPPFDMRFIYATYMLDHAKTAGVLVVNDPQA 130

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IR+  EK+F T FS+ M PT+++     I +F  E +D+I+KPL G GGTG+FR+T    
Sbjct: 131 IRDCNEKLFATWFSDYMSPTIVTSKQAHIRKFITEQQDVIVKPLDGMGGTGIFRLTADSP 190

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHA 239
           N    +EML E    P+M Q YLP+I++GDKR+L+++G  V     RIP++ + R N+ A
Sbjct: 191 NIGVTLEMLTELETLPIMAQRYLPEIKEGDKRVLIVDGTVVDYTLARIPTKGETRGNLAA 250

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG      LT I+  + + +   ++E+GL F G+D+IG  ITEINVTSPTC+REI    G
Sbjct: 251 GGSGVAMPLTDIERQVAEVVAPIVKEKGLMFVGLDLIGGRITEINVTSPTCVREIDDQCG 310

Query: 300 ENVASLFWDGIEKIK 314
            ++A+ F   IE+  
Sbjct: 311 TDIATDFIIAIERKL 325


>gi|71897927|ref|ZP_00680132.1| Glutathione synthetase, prokaryotic [Xylella fastidiosa Ann-1]
 gi|71732171|gb|EAO34226.1| Glutathione synthetase, prokaryotic [Xylella fastidiosa Ann-1]
          Length = 314

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 122/311 (39%), Positives = 182/311 (58%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+++K  +D+TFA+ LE Q R +++ +  P  L + + +  A T PL +
Sbjct: 1   MPLDVVVVMDPITSIKTAKDTTFALLLEGQRRSHRLHYVHPGSLSLNEGRTLAQTAPLQV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
            + K  +Y+LGE     L Q  +IL+R+DPP N  +I  T LL         ++N+P  +
Sbjct: 61  RDNKTDWYTLGEFSETQLGQGQIILMRKDPPVNAEFIYDTQLLSIAQAAGAQVINHPQGL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EKI    F +  PPTLISRD+  +  F  + +  I+KPL G GG  +FR + GD N
Sbjct: 121 RDLNEKIAAQLFPQCCPPTLISRDMRALKMFVQKQEQAILKPLDGMGGHSIFRSSNGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
            + ++E L +      + Q YL QI +GDKRILL++G P+     RIP   + R N+ AG
Sbjct: 181 LNVILETLTDGGRTLAIAQRYLQQIIEGDKRILLIDGVPIDHCLARIPQGDEFRGNMAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   L + D  I  ++G  +R RG+ F GIDVIGDY+TEINVTSPTC+RE+    G 
Sbjct: 241 GRGESRPLNERDRWIAAQVGPEMRRRGMRFVGIDVIGDYLTEINVTSPTCLRELDAQCGL 300

Query: 301 NVASLFWDGIE 311
           N+A   +D IE
Sbjct: 301 NIAGQLFDAIE 311


>gi|312797408|ref|YP_004030330.1| glutathione synthetase [Burkholderia rhizoxinica HKI 454]
 gi|312169183|emb|CBW76186.1| Glutathione synthetase (EC 6.3.2.3) [Burkholderia rhizoxinica HKI
           454]
          Length = 316

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 122/313 (38%), Positives = 175/313 (55%), Gaps = 5/313 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
            ++    + +   K+ +D+T+A+  EA  RG+ ++   P  L      + A  +  S+  
Sbjct: 1   MDLLFIADPLPQFKIYKDTTYAMMAEAARRGHVLYACEPRHLAYAGGGVEATVRRFSIVG 60

Query: 65  ---KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFW 120
                 Q+Y     +   L     +L+R+DPPF+M Y+TST+LLE        I N P  
Sbjct: 61  DHTNPGQWYDAELAENRGLGTFGAVLMRKDPPFDMEYVTSTWLLEIAERHGARIFNKPRA 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IR+  EK+ + EF+    PTL++RD  ++  F+ E +D+I KPL G GG GVFRI     
Sbjct: 121 IRDHSEKMAIGEFARFTAPTLVTRDAARLRAFHGEHRDVIFKPLDGMGGMGVFRIREDGM 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHA 239
           N  S IEML +     +M Q Y+PQI+DGDKRILL+ G+PV   + RIP   + R N+ A
Sbjct: 181 NLGSTIEMLSDNGARTVMAQRYIPQIKDGDKRILLIGGEPVPYSLARIPQGTEIRGNLAA 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG      L   D +I   +G  L ERGL   G+D IGD++TE+NVTSPTC REI    G
Sbjct: 241 GGVGRAQSLAPRDREIATALGPVLAERGLLLVGLDTIGDWLTEVNVTSPTCFREITEQTG 300

Query: 300 ENVASLFWDGIEK 312
            NVA++F D +E+
Sbjct: 301 FNVAAMFVDALER 313


>gi|325266353|ref|ZP_08133031.1| glutathione synthase [Kingella denitrificans ATCC 33394]
 gi|324982146|gb|EGC17780.1| glutathione synthase [Kingella denitrificans ATCC 33394]
          Length = 317

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 107/315 (33%), Positives = 177/315 (56%), Gaps = 6/315 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            NI    + ++T K  +D+T+A+  EA  RG+++ H    +L +++ K+ A   P     
Sbjct: 1   MNILFIADPLATFKTYKDTTYAMMREAAKRGHKLHHTLAGELSVQNGKVAAQAAPFQFIG 60

Query: 63  --DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPF 119
             D+   +++    +    L++ D +++R DPPF+M Y+ ST LL         + N+  
Sbjct: 61  AKDDHDHEWFKPQGKVQAALTEFDAVIMRTDPPFDMQYLYSTQLLTLAEQQGAKVFNSGQ 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R+  EK+ +  F+    PTL+S     +  F  E  DII+KPL G GG G+FR+T  D
Sbjct: 121 AMRDFNEKLAILNFARFTAPTLVSTRAADVRAFLAEHGDIIVKPLDGMGGMGIFRLTERD 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N  S++E L       +M Q Y+P+I  GDKRIL+++G+ V   + RIP + + R N+ 
Sbjct: 181 PNIGSILETLMRLDTRTIMAQRYIPEIVHGDKRILVIDGEVVPFALARIPQQGETRGNLA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+    +L+  D +I + +   L+ RG+   G+DVIG ++TE+NVTSPT  +EI +  
Sbjct: 241 AGGRGVAQELSGRDREIAETLAPELKRRGILLAGLDVIGSHLTEVNVTSPTGFQEIMKQK 300

Query: 299 GENVASLFWDGIEKI 313
           G +VA+ F D +E+ 
Sbjct: 301 GFDVAAKFIDAVERN 315


>gi|172035406|ref|YP_001801907.1| glutathione synthetase [Cyanothece sp. ATCC 51142]
 gi|171696860|gb|ACB49841.1| glutathione synthetase [Cyanothece sp. ATCC 51142]
          Length = 322

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 121/316 (38%), Positives = 192/316 (60%), Gaps = 10/316 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYA-----NTQP 59
              A  ++ I+ +    DST AI   AQ  G++++     QL + D K +A         
Sbjct: 1   MKFAFIIDPIANLNPVHDSTVAIMEAAQNLGHEVWITEVHQLSVIDGKAWAVLSQVQLTS 60

Query: 60  LSLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLI 114
           ++L   K     Q+Y +   ++  L  MD + +R+DPP  + Y+ +TY+LE I+P +T++
Sbjct: 61  VTLQNGKWVSVSQWYQVSPGELRSLEDMDAVWMRKDPPVTIRYLYATYILELIDPTKTVV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+P  +R + EK++  +F  +MP T++S D   I +F  E +  ++KPL G  G G+  
Sbjct: 121 INSPQGLREANEKMYTLQFYSVMPETVVSLDKKVIRQFVEEKQQAVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+S+IE+      EP+M+Q +LP+ ++GDKRI+LL+GKP+GAVNR+P+  + R
Sbjct: 181 LEPGDRNFNSIIEVSTYHGQEPVMVQRFLPEAKNGDKRIILLDGKPIGAVNRVPTGQEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+ E T+LT  +  IC+ +G  LR+ GL+F GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 GNMAVGGRVEKTQLTPREEHICEVVGPRLRKNGLYFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGI 310
               G N+     + +
Sbjct: 301 DLLDGTNLGIEVVEWL 316


>gi|326566499|gb|EGE16646.1| glutathione synthetase [Moraxella catarrhalis 103P14B1]
 gi|326570684|gb|EGE20718.1| glutathione synthetase [Moraxella catarrhalis BC1]
 gi|326577224|gb|EGE27117.1| glutathione synthetase [Moraxella catarrhalis 101P30B1]
          Length = 323

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 124/318 (38%), Positives = 193/318 (60%), Gaps = 3/318 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           MKK     I M+ I+TV  K+D+T A+   A  RG+++++     L++    +  + QPL
Sbjct: 1   MKK-LRFLIVMDDITTVSYKKDTTLAMMWAADERGHELYYCQIHDLWLSQGTLNVDAQPL 59

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPF 119
            + +  E +Y LGE      +  DVIL+R+DPPF+M ++ + +LL+        ++N+P 
Sbjct: 60  QVFKNPENFYELGEMATYCTTDFDVILMRKDPPFDMKFLYALHLLDYAKQAGVWVINDPL 119

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +++  EK+F T+FSELM PT+++     I  F  E +D+I+KPL G GG G+FR+T   
Sbjct: 120 AVKDCNEKLFATQFSELMSPTIVTNKQMHIQAFITEHQDVIVKPLDGMGGMGIFRLTADS 179

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIH 238
            N S+ +EML +    P+M Q Y+P I +GDKR+L++ GKPV     RIPS+ + R N+ 
Sbjct: 180 PNISATLEMLTQMGKLPIMAQKYIPAIVEGDKRVLIVGGKPVEYCLARIPSQGETRGNLA 239

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+     LT  + ++ + I   L ++GL+F G+DVIG +ITEINVTSPTC+REI    
Sbjct: 240 AGGRGVAMPLTARERELAETIAPILMQKGLYFVGLDVIGGHITEINVTSPTCVREIDDQC 299

Query: 299 GENVASLFWDGIEKIKET 316
           G ++A  F   IE   ++
Sbjct: 300 GTSIAVDFIKFIENNIDS 317


>gi|255022232|ref|ZP_05294227.1| Glutathione synthetase [Acidithiobacillus caldus ATCC 51756]
 gi|254968323|gb|EET25890.1| Glutathione synthetase [Acidithiobacillus caldus ATCC 51756]
          Length = 310

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 123/310 (39%), Positives = 194/310 (62%), Gaps = 3/310 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +   A+ M+ I  ++  +D+TFA+ L  Q RG++++ +T  +L++RDS+ +    P+ + 
Sbjct: 1   MLEAAVLMDPIGGIQPAKDTTFAMLLAGQRRGHRLWVFTLAELWVRDSRAWGRLWPVEVW 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRN 123
           ++   YY LG      L+++D++L+R+DPP ++ ++ + +LL+     T +VN+P  +R 
Sbjct: 61  DRATDYYRLGAPVHRPLAELDLVLMRKDPPVDLDFLLACHLLDH--AGTWVVNDPRSLRE 118

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
           + EK+F   F E +P  LISRD+  +  F  E ++I++KPL   GG GVF + LGD N  
Sbjct: 119 ANEKLFALHFPEFLPEHLISRDMAALRAFLGEHEEIVVKPLNARGGEGVFYLRLGDPNIG 178

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVN-RIPSEVDNRSNIHAGGK 242
           S++E + +    P+M Q YLP IR+GDKRILL++G+P+     R+P+  D R N+ AG +
Sbjct: 179 SILETVTQWGRHPVMAQRYLPAIREGDKRILLVDGEPIATAMLRVPAADDFRGNLVAGAQ 238

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            +   L   +  IC R+G  LRERGL F G+DVIG Y+TEINVTSPT  REI R  G + 
Sbjct: 239 PQAADLNARERAICARLGPVLRERGLLFVGLDVIGGYLTEINVTSPTGAREIQRFSGIDA 298

Query: 303 ASLFWDGIEK 312
           A L W  +E+
Sbjct: 299 ADLLWQRLEQ 308


>gi|326568013|gb|EGE18105.1| glutathione synthetase [Moraxella catarrhalis BC7]
          Length = 323

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 123/318 (38%), Positives = 192/318 (60%), Gaps = 3/318 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           MKK     I M+ I+TV  K+D+T A+   A  RG+++++     L++    +  + QPL
Sbjct: 1   MKK-LRFLIVMDDITTVSYKKDTTLAMMWAADERGHELYYCQIHDLWLSQGTLNVDAQPL 59

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPF 119
            + +  E +Y LGE      +  DVIL+R+DPPF+M ++ + +LL+        ++N+P 
Sbjct: 60  QVFKNPENFYELGEMATYCATDFDVILMRKDPPFDMKFLYALHLLDYAKQAGVWVINDPL 119

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +++  EK+F T+FSELM PT+++     I  F  E +D+I+KPL G GG G+FR+T   
Sbjct: 120 AVKDCNEKLFATQFSELMSPTIVTNKQMHIQAFITEHQDVIVKPLDGMGGMGIFRLTADS 179

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIH 238
            N S+ +EML +    P+M Q Y+P I +GDKR+L++ GKPV     RIPS+ + R N+ 
Sbjct: 180 PNISATLEMLTQMGKLPIMAQKYIPAIVEGDKRVLIVGGKPVEYCLARIPSQGETRGNLA 239

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
            GG+     LT  + ++ + I   L ++GL+F G+DVIG +ITEINVTSPTC+REI    
Sbjct: 240 VGGRGVAMPLTARERELAETIAPILMQKGLYFVGLDVIGGHITEINVTSPTCVREIDDQC 299

Query: 299 GENVASLFWDGIEKIKET 316
           G ++A  F   IE   ++
Sbjct: 300 GTSIAVDFIKFIENNIDS 317


>gi|296112506|ref|YP_003626444.1| glutathione synthase [Moraxella catarrhalis RH4]
 gi|295920200|gb|ADG60551.1| glutathione synthase [Moraxella catarrhalis RH4]
 gi|326561543|gb|EGE11886.1| glutathione synthetase [Moraxella catarrhalis 7169]
 gi|326571240|gb|EGE21263.1| glutathione synthetase [Moraxella catarrhalis BC8]
 gi|326573078|gb|EGE23051.1| glutathione synthetase [Moraxella catarrhalis CO72]
          Length = 323

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 124/318 (38%), Positives = 193/318 (60%), Gaps = 3/318 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           MKK     I M+ I+TV  K+D+T A+   A  RG+++++     L++    +  + QPL
Sbjct: 1   MKK-LRFLIVMDDITTVSYKKDTTLAMMWAADERGHELYYCQIHDLWLSQGTLNVDAQPL 59

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPF 119
            + +  E +Y LGE      +  DVIL+R+DPPF+M ++ + +LL+        ++N+P 
Sbjct: 60  QVFKNPENFYELGEMATYCATDFDVILMRKDPPFDMKFLYALHLLDYAKQAGVWVINDPL 119

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +++  EK+F T+FSELM PT+++     I  F  E +D+I+KPL G GG G+FR+T   
Sbjct: 120 AVKDCNEKLFATQFSELMSPTIVTNKQMHIQAFITEHQDVIVKPLDGMGGMGIFRLTADS 179

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIH 238
            N S+ +EML +    P+M Q Y+P I +GDKR+L++ GKPV     RIPS+ + R N+ 
Sbjct: 180 PNISATLEMLTQMGKLPIMAQKYIPAIVEGDKRVLIVGGKPVEYCLARIPSQGETRGNLA 239

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+     LT  + ++ + I   L ++GL+F G+DVIG +ITEINVTSPTC+REI    
Sbjct: 240 AGGRGVAMPLTARERELAETIAPILMQKGLYFVGLDVIGGHITEINVTSPTCVREIDDQC 299

Query: 299 GENVASLFWDGIEKIKET 316
           G ++A  F   IE   ++
Sbjct: 300 GTSIAVDFIKFIENNIDS 317


>gi|332142456|ref|YP_004428194.1| glutathione synthetase [Alteromonas macleodii str. 'Deep ecotype']
 gi|327552478|gb|AEA99196.1| glutathione synthetase [Alteromonas macleodii str. 'Deep ecotype']
          Length = 316

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 107/308 (34%), Positives = 185/308 (60%), Gaps = 2/308 (0%)

Query: 7   IAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK 66
           + + M+ I+ +K  +D++FA+ LEAQ RG ++ ++    LY+ + K     + + + ++ 
Sbjct: 5   VGVIMDPIANIKPHKDTSFAMMLEAQRRGAKVVYFELKDLYLDNGKPMGLAKTVLVKDQA 64

Query: 67  EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTY-LLEKINPETLIVNNPFWIRNSP 125
             +Y++ +E  + L  +DV+L+R+DPPF+  ++ +T  L    +   L+VNNP  +R+  
Sbjct: 65  TDFYTIEDESTVHLGDIDVLLMRKDPPFDSEFLYATQVLSLAQDAGALVVNNPQALRDYN 124

Query: 126 EKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSL 185
           EK+F + F E +P T++S +   I  F+ + +DII KPL G GG  +FR+     N   +
Sbjct: 125 EKLFTSYFPEHIPHTMVSNNQALIREFHAKHQDIICKPLDGMGGASIFRVKPDGNNLGVI 184

Query: 186 IEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGKAE 244
           IE L +     +M+Q YLP+I+DGDKR+L+++G+ +     R+P++ + R N+ AGG   
Sbjct: 185 IETLTQLGTRYMMVQEYLPEIKDGDKRVLIVDGEVMPYCLARLPTKGETRGNLAAGGTGR 244

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
              ++  D  + + I  +L+E  + F G+DVIG+ ITEIN+TSPTC+REI      N+  
Sbjct: 245 PQPISDSDKALAEAIAPTLKENNILFVGLDVIGNKITEINITSPTCVREIEAAYDVNIMG 304

Query: 305 LFWDGIEK 312
             +D IEK
Sbjct: 305 ALFDAIEK 312


>gi|326564825|gb|EGE15033.1| glutathione synthetase [Moraxella catarrhalis 12P80B1]
          Length = 323

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 123/318 (38%), Positives = 192/318 (60%), Gaps = 3/318 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           MKK     I M+ I+TV  K+D+T A+   A  RG+++++     L++    +  + QPL
Sbjct: 1   MKK-LRFLIVMDDITTVSYKKDTTLAMMWAADERGHELYYCQIHDLWLSQGTLNVDAQPL 59

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPF 119
            + +  E +Y LGE      +  DVIL+R+DPPF+M ++ + +LL+        ++N+P 
Sbjct: 60  QVFKNPENFYELGEMATYCATDFDVILMRKDPPFDMKFLYALHLLDYAKQAGVWVINDPL 119

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +++  EK+F T+FSELM PT+++     I  F  E +D+I+KPL G GG G+FR+T   
Sbjct: 120 AVKDCNEKLFATQFSELMSPTIVTNKQMHIQAFITEHQDVIVKPLDGMGGMGIFRLTADS 179

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIH 238
            N  + +EML +    P+M Q Y+P I +GDKR+L++ GKPV     RIPS+ + R N+ 
Sbjct: 180 PNIGATLEMLTQMGELPIMAQKYIPAIVEGDKRVLIVGGKPVEYCLARIPSQGEIRGNLA 239

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+     LT  + ++ + I   L ++GL+F G+DVIG +ITEINVTSPTC+REI    
Sbjct: 240 AGGRGVAMPLTARERELAETIAPILMQKGLYFVGLDVIGGHITEINVTSPTCVREIDDQC 299

Query: 299 GENVASLFWDGIEKIKET 316
           G ++A  F   IE   ++
Sbjct: 300 GTSIAVDFIKFIENNIDS 317


>gi|307543647|ref|YP_003896126.1| glutathione synthetase [Halomonas elongata DSM 2581]
 gi|307215671|emb|CBV40941.1| glutathione synthetase [Halomonas elongata DSM 2581]
          Length = 319

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 117/312 (37%), Positives = 188/312 (60%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
           +   + + M+ I+ +  K+DS+ A+   AQ RG+ + +   + L++RD + +A  + L +
Sbjct: 4   RPLKVGVVMDPIADLSYKKDSSLAMLWAAQDRGWSLHYMEQEDLFLRDGRAHARWRELEV 63

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
               E +Y+LGE ++  L+++DV+L+R+DPP +  ++ + +LL        L+VN    +
Sbjct: 64  YRDPEHWYALGESRVAPLAELDVVLMRKDPPVDGRFLDAVHLLGFAEREGVLVVNPTRAL 123

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
               EK+F  +F +   PTL+S   T+I  F+ E  D+I+KPL G GG+G+F +    RN
Sbjct: 124 LECNEKLFAQQFPQCCAPTLVSSRDTEIRAFHAEHGDVILKPLDGMGGSGIFHVGPEGRN 183

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
             ++IE L E+     M Q YLP+I+DGD RILL+ G+PV   + R+P   + R N+ AG
Sbjct: 184 LGAVIETLTERGTRQAMAQRYLPEIKDGDTRILLVEGEPVPYGLARVPMAGETRGNLAAG 243

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+    +LT  D  + +++   +RE+GL F G+DVIGDYITEINVTSPTC+REI    G 
Sbjct: 244 GRGVSRELTDRDRWLVEQVQPMIREKGLMFVGLDVIGDYITEINVTSPTCVREIDDQRGT 303

Query: 301 NVASLFWDGIEK 312
           ++A    D I +
Sbjct: 304 DIAGSLMDAISR 315


>gi|160871856|ref|ZP_02061988.1| glutathione synthase [Rickettsiella grylli]
 gi|159120655|gb|EDP45993.1| glutathione synthase [Rickettsiella grylli]
          Length = 316

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 119/310 (38%), Positives = 195/310 (62%), Gaps = 2/310 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
            ++ + + M+ I  +  K+D+TFA+ L AQ R + I +     L++ + K YA+ + L +
Sbjct: 1   MLKPLGVVMDPIEQINPKKDTTFALLLAAQQRDWPIVYMEARDLFLVNEKPYAHVRALHV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
           D+    +++LG+E +I L+ + VIL+R+DPP +MHYI +T LL+K       +VN+P  +
Sbjct: 61  DDDNTSWFNLGKESVIPLTSLSVILMRKDPPIDMHYIYTTQLLDKAQQQGVGVVNHPSRL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK++   F +  PP+L++  +     F  +  DII KPL G GG+ VFR+ + D N
Sbjct: 121 RDFNEKLYTLHFPDCCPPSLVTSRLQAALEFLHKHGDIIAKPLNGMGGSSVFRLRVNDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
              ++E L E     +M+Q Y+ ++  GDKRI++++G+P    + RIP   + R+N+  G
Sbjct: 181 NHVILETLTENNQSYMMVQRYITEVLAGDKRIMMIDGEPFPYALARIPPLGETRANLAVG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           GK ++ KL+K D  IC+R+G SLRE+GL F G+DVIGDY+TEIN+TSPT +REI  +   
Sbjct: 241 GKGKVVKLSKNDYRICQRVGPSLREKGLLFVGLDVIGDYLTEINITSPTGVREIDAHCEG 300

Query: 301 NVASLFWDGI 310
           N++  F + +
Sbjct: 301 NISDQFINML 310


>gi|198284750|ref|YP_002221071.1| glutathione synthetase [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665382|ref|YP_002427430.1| glutathione synthetase [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198249271|gb|ACH84864.1| glutathione synthetase [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517595|gb|ACK78181.1| glutathione synthetase [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 312

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 132/309 (42%), Positives = 189/309 (61%), Gaps = 3/309 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
              AI M+ I+ +K  +D+TFA+ L AQ RG+Q   +    L+ RD + +   + + + +
Sbjct: 4   LKAAILMDPITGIKPAKDTTFAMLLAAQARGHQCRVFGLPDLFFRDGRSWGRLRTIIVRD 63

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNS 124
             E Y++LGE +   L +MDV+L+R+DPP  + Y+T+ YLLE     T +VN+P  +RN+
Sbjct: 64  DVEDYFTLGETEERPLDEMDVVLMRKDPPVGLEYLTACYLLEH--AGTWVVNDPVSLRNA 121

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
            EK++   F E +PP L+SRD+  +  F  E  +I++KPL   GG GVF + L DRN  S
Sbjct: 122 NEKLYALHFPEFLPPLLVSRDLGDLRAFLAEHGEIVVKPLSARGGEGVFYLHLQDRNVGS 181

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVG-AVNRIPSEVDNRSNIHAGGKA 243
           ++E +       +M Q YLP IR+GDKRILL++G PV  A+ R+PS  D R N+ AG   
Sbjct: 182 ILETVTGWGQHHVMAQRYLPAIREGDKRILLVDGVPVPGALLRVPSAADFRGNLVAGATG 241

Query: 244 ELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVA 303
              ++   D DIC  IG +LR  GL F G+DVIG Y+TEINVTSPT  REI R  G + A
Sbjct: 242 VAAEINDRDRDICAAIGPALRAAGLLFVGLDVIGGYVTEINVTSPTGAREIRRFFGVDAA 301

Query: 304 SLFWDGIEK 312
            L W  +E+
Sbjct: 302 DLLWQRLER 310


>gi|319945093|ref|ZP_08019355.1| glutathione synthase [Lautropia mirabilis ATCC 51599]
 gi|319741663|gb|EFV94088.1| glutathione synthase [Lautropia mirabilis ATCC 51599]
          Length = 321

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 109/310 (35%), Positives = 169/310 (54%), Gaps = 2/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
            +I   ++   ++K K++++ A+   A  RG+++F      + +   K+ A   PL L  
Sbjct: 1   MDILFILDPFDSLKPKKETSIAMMRAAVARGHRVFGCLQGDISLDQGKVTARVTPLELTG 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
           +   +Y  GE +   LS  D +L+R+DPPF+M Y+ STY+LE+ +     + NNP  IR+
Sbjct: 61  ELSPWYKAGEVRTEPLSAFDAVLMRKDPPFDMEYVYSTYMLERAVEQGARVYNNPAAIRD 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK  +T + +L    +++RD  ++  F     + ++K L G GG  +FR    D N S
Sbjct: 121 HNEKFSITAYPQLTTDVMVTRDPARLREFVARHGEAVLKLLDGMGGASIFRARQDDPNLS 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
            ++E +       +M Q YLP I  GDKRILL++G+ V   + RIP   + R N+ AGGK
Sbjct: 181 VILETMNRFGTRTVMAQRYLPAIAQGDKRILLIDGEVVPHALARIPQAGEARGNMAAGGK 240

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
                L+  D +I + +G  L  +GLF  G+DVIGD +TEINVTSPT   EI    G +V
Sbjct: 241 PVAQPLSARDEEIARYLGPRLAAKGLFLVGLDVIGDSLTEINVTSPTGFMEITAQTGFDV 300

Query: 303 ASLFWDGIEK 312
              F   +EK
Sbjct: 301 PDFFIAQLEK 310


>gi|67921377|ref|ZP_00514895.1| Glutathione synthetase, prokaryotic [Crocosphaera watsonii WH 8501]
 gi|67856489|gb|EAM51730.1| Glutathione synthetase, prokaryotic [Crocosphaera watsonii WH 8501]
          Length = 323

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 127/320 (39%), Positives = 198/320 (61%), Gaps = 10/320 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ-----P 59
             +A  ++ I+ +    DST A+   AQ+ G++++     QL + D K  A        P
Sbjct: 1   MKLAFIIDPIAKLDPGHDSTVAMMEAAQILGHEVWITEVHQLSVIDGKALAILSQVQLVP 60

Query: 60  LSLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLI 114
           ++L E K     Q+Y L   ++  L  MD + +R+DPP  + Y+ +TY+LE INP +TL+
Sbjct: 61  VTLKEGKWLSVPQWYELSSPELRCLEDMDAVFMRKDPPVTIRYLYATYILELINPEKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+P  +R + EK++  +F  +MP T++S+D   I RF  E K  ++KPL G  G G+  
Sbjct: 121 INSPQGLREANEKMYTLQFYSVMPETVVSQDKDIIRRFVEEKKQAVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+S+IE+   +  EP+MIQ +LP+ ++GDKRI+LL+GKP+GAVNR+P+  + R
Sbjct: 181 LETGDRNFNSIIEVSTHQGQEPVMIQRFLPEAKNGDKRIILLDGKPIGAVNRVPTGQEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+ E  +LT  + +IC+ +G  L E GL+F GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 GNMAVGGRVEKAELTPREYNICEIVGPQLSENGLYFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIEKIK 314
                +N+       + K++
Sbjct: 301 DLLDSKNLGQEVIQWLSKVR 320


>gi|107023796|ref|YP_622123.1| glutathione synthetase [Burkholderia cenocepacia AU 1054]
 gi|116690883|ref|YP_836506.1| glutathione synthetase [Burkholderia cenocepacia HI2424]
 gi|105893985|gb|ABF77150.1| glutathione synthase [Burkholderia cenocepacia AU 1054]
 gi|116648972|gb|ABK09613.1| glutathione synthase [Burkholderia cenocepacia HI2424]
          Length = 318

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 116/315 (36%), Positives = 178/315 (56%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P  L    S + A+ + ++   
Sbjct: 1   MDILFIADPLDHFKIYKDSTYAMMAEAARRGHAVYAGEPRHLAWTGSAVEADVRRITFVG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++ ++  G      L     +L+R+DPPF+M Y+TST+LLE        + N  
Sbjct: 61  ELDDLHRDTWFEAGPVDARRLESFGAVLMRKDPPFDMEYVTSTWLLELAERAGARVFNKA 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF + + PTL++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QSIRDHSEKLAIGEFPQFVAPTLVTRDAKRLRAFHAEHGDVILKPLDGMGGMGVFRVKPD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S++EML       +M Q ++P+I+ GDKRILL+ G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIVEMLSHDRTRSVMAQKFIPEIKAGDKRILLIGGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT  D +I   +G  L  RGL   G+D IGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGLGVAQPLTARDREIADTLGPVLASRGLLLVGLDAIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA++F D +E+
Sbjct: 301 TGFDVAAMFIDALER 315


>gi|332977771|gb|EGK14531.1| glutathione synthase [Psychrobacter sp. 1501(2011)]
          Length = 322

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 122/315 (38%), Positives = 196/315 (62%), Gaps = 2/315 (0%)

Query: 2   KKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
            K  NI + M+ I TV  K+DST A+   A  RG+ + +     +++   ++  + Q ++
Sbjct: 7   NKPLNILVVMDPIETVNYKKDSTLAMMWAASDRGHDLGYCQIYDMWLDRGELKVDAQKVT 66

Query: 62  LDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFW 120
           +    + +YSL  +    ++  DV+L+R+DPPFNM ++ STY+L+       L+VN+P  
Sbjct: 67  VRRDPQDFYSLENKVTQPITDYDVVLMRKDPPFNMRFLYSTYMLDHAKKAGVLVVNDPQA 126

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IR+  EK+F T FS+LM PT+++   + I +F  E +D+I+KPL G GGTG+FR+T    
Sbjct: 127 IRDCNEKLFATWFSDLMSPTIVTSKQSHIRQFITEQQDVIVKPLDGMGGTGIFRLTADSP 186

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHA 239
           N  + +EML E    P+M Q YLP+I++GDKRIL+++G+ V     RIP++ + R N+ A
Sbjct: 187 NIGATLEMLTELETLPIMAQRYLPEIKEGDKRILIVDGEVVPFCLARIPTKGETRGNLAA 246

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG+     ++  ++ + K++   ++++GL F G+DVIG  ITEINVTSPTCIREI+   G
Sbjct: 247 GGQGVAMPVSDKEMAVAKKVAPIVKQKGLMFVGLDVIGGRITEINVTSPTCIREINDQCG 306

Query: 300 ENVASLFWDGIEKIK 314
            ++A+     IEK  
Sbjct: 307 TDIATDLMIAIEKKL 321


>gi|262277712|ref|ZP_06055505.1| glutathione synthase [alpha proteobacterium HIMB114]
 gi|262224815|gb|EEY75274.1| glutathione synthase [alpha proteobacterium HIMB114]
          Length = 317

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 138/315 (43%), Positives = 212/315 (67%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           MKK   IAIQM+ +  +  KEDSTF IA EAQ RGY++FHY+P  + ++++ I A     
Sbjct: 2   MKKHFKIAIQMDPLEKINPKEDSTFVIAQEAQRRGYKLFHYSPKDISLKNNTIIAKGCYF 61

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            +  + ++++   ++  I+L+Q   +L+RQDPPFNM YIT+TY LE +N + L+VNNP  
Sbjct: 62  KIINQGKKFFKKQKKISINLNQFHCVLVRQDPPFNMEYITATYFLEMLNQKVLVVNNPTE 121

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IRN+PEK+ +  F  L+P TLIS D+T+I  F  + K  I+KPLYGNGG G+ ++T G  
Sbjct: 122 IRNNPEKLSMFNFKNLIPDTLISGDLTEIQNFIKKYKFTILKPLYGNGGEGIKKVTKGSL 181

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
              ++I+ + +KY   ++ Q ++ +I  GD+RI+L++G+ VG+V RIP +   ++N HAG
Sbjct: 182 KNKTIIQRMIKKYKGAIITQKFIKEISQGDRRIILIDGEYVGSVARIPKKGSIKANFHAG 241

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G A+ + L   D  IC ++   L+++GLFFTGID IG+Y+TEINVTSPT ++EI++    
Sbjct: 242 GSAQRSGLVFKDRKICSKLKPYLKKKGLFFTGIDAIGNYLTEINVTSPTGMQEINQLDNT 301

Query: 301 NVASLFWDGIEKIKE 315
            +  +FWD +EK  +
Sbjct: 302 RLEKIFWDKLEKKIK 316


>gi|93006857|ref|YP_581294.1| glutathione synthetase [Psychrobacter cryohalolentis K5]
 gi|92394535|gb|ABE75810.1| glutathione synthase [Psychrobacter cryohalolentis K5]
          Length = 327

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 123/313 (39%), Positives = 194/313 (61%), Gaps = 2/313 (0%)

Query: 2   KKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
           KK  NI + M+ I  V  K+D++ A+   AQ RG+++ +     L++   ++  +TQ ++
Sbjct: 11  KKSLNILVIMDPIEQVNYKKDTSLAMMWSAQDRGHRLGYCQIHDLWLDRGQLMIDTQSVT 70

Query: 62  LDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFW 120
           +    E +Y+LG++    +S  DVIL+R+DPPF+M +I +TY+L+       L+VN+P  
Sbjct: 71  VKRDPEDFYTLGDKTTGSVSDYDVILMRKDPPFDMRFIYATYMLDHAKAAGVLVVNDPQA 130

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IR+  EK+F T FS+ M PT+++     I +F  E +D+I+KPL G GGTG+FR+T    
Sbjct: 131 IRDCNEKLFATWFSDYMSPTIVTSKQAHIRKFIAEHQDVIVKPLDGMGGTGIFRLTADSP 190

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHA 239
           N    +EML E    P+M Q YLP+I++GDKR+L+++G  V     RIP++ + R N+ A
Sbjct: 191 NIGVTLEMLTELETLPIMAQRYLPEIKEGDKRVLIVDGTVVDYTLARIPTKGETRGNLAA 250

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG      LT I+  + + +   ++ +GL F G+D+IG  ITEINVTSPTC+REI    G
Sbjct: 251 GGSGVAMPLTDIERQVAEVVASIVKAKGLMFVGLDLIGGRITEINVTSPTCVREIDDQCG 310

Query: 300 ENVASLFWDGIEK 312
            ++A+ F   IE+
Sbjct: 311 TDIATDFIIAIER 323


>gi|293604691|ref|ZP_06687091.1| glutathione synthase [Achromobacter piechaudii ATCC 43553]
 gi|292816860|gb|EFF75941.1| glutathione synthase [Achromobacter piechaudii ATCC 43553]
          Length = 323

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 114/318 (35%), Positives = 179/318 (56%), Gaps = 6/318 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            ++   ++ +  +K  +DS+ A+      RG+ +       LY+    + A T P++L  
Sbjct: 1   MHVLFVLDPLPLLKAYKDSSVAMMRALVARGHTLSVAMQGDLYIEAGSVKAVTTPIALVA 60

Query: 63  --DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPF 119
             D     +++    + + L+    +++R+DPPF+M Y+ ST+LLE        + N+  
Sbjct: 61  DADLHGHDWWTESPAQDLPLADFGAVVMRKDPPFDMEYVYSTHLLEYAEAQGARVFNSGA 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            IRN PEK+ +TE SE   PTL++R++ ++  F+    D+I+KPL G GGTGVFR+   D
Sbjct: 121 AIRNHPEKLAITEISEFTAPTLVTRNMARLKAFHDTHHDVIVKPLDGMGGTGVFRLQPKD 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N ++++E L +     +M Q Y+P I  GDKRILL+ G+PV   + RIP   + R N+ 
Sbjct: 181 PNLNAILETLTDNGARTIMAQRYIPDIVKGDKRILLIGGEPVPYSLARIPLAGETRGNLA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+    +L+  D  I + +   L  RGL   G+DVIGDY+TE+NVTSPTC  EI    
Sbjct: 241 AGGRGVAQELSPRDRQIAEAVAPKLAARGLLLVGLDVIGDYVTEVNVTSPTCFVEIAEQT 300

Query: 299 GENVASLFWDGIEKIKET 316
           G +VA +F   +EK   T
Sbjct: 301 GFDVAGMFVQALEKAVAT 318


>gi|148244223|ref|YP_001218917.1| glutathione synthetase [Candidatus Vesicomyosocius okutanii HA]
 gi|146326050|dbj|BAF61193.1| glutathione synthetase [Candidatus Vesicomyosocius okutanii HA]
          Length = 320

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 131/317 (41%), Positives = 198/317 (62%), Gaps = 3/317 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           MKKI  IA+ M++I+ +  K+DS+ A+ LEA  RG++I+ +    L+ +D  ++AN    
Sbjct: 1   MKKI-KIAVLMDNINNINPKKDSSLAMMLEASKRGWEIYTFNTCDLFAQDGSVFANCAKT 59

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPE-TLIVNNPF 119
           ++ +    ++      I+ LS+ +VIL+R+DPPFNM+YI +TYLLE+   + TLI+N P 
Sbjct: 60  TVHDNLNHWFKKETNTIMILSEFNVILMRKDPPFNMNYIYATYLLEQSENKNTLIINKPQ 119

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R++ EK+F   F   +P TLIS +  QI  F       IIKPL G GG  +F+    D
Sbjct: 120 SLRDANEKLFALNFPHCIPKTLISSNQMQIKTFIKIQNTAIIKPLDGMGGHDIFKFKTND 179

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
               ++++ L     +P+M+Q +LP I  GDKRILL+NGKPV   + RIP++ + + N+ 
Sbjct: 180 IKIDAILKRLTNNGKKPIMVQEFLPDITKGDKRILLINGKPVDYALARIPAKGNFKGNLA 239

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AG       L+K D  +CK+I  +L+ +GL F G+DVIGDYITEINVTSPTCIRE+ +  
Sbjct: 240 AGAIGIGQPLSKHDYYLCKQISPTLKAKGLIFVGLDVIGDYITEINVTSPTCIRELDKQF 299

Query: 299 GENVASLFWDGIEKIKE 315
             N+A   +D IE+  +
Sbjct: 300 NLNIAGELFDVIEQKIK 316


>gi|188591054|ref|YP_001795654.1| glutathione synthetase [Cupriavidus taiwanensis LMG 19424]
 gi|170937948|emb|CAP62932.1| glutathione synthetase [Cupriavidus taiwanensis LMG 19424]
          Length = 321

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 120/313 (38%), Positives = 183/313 (58%), Gaps = 6/313 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I    + + T K  +DSTFA+  EA  RG++++     QL +    +      L L  
Sbjct: 1   MRILFITDPLETFKTYKDSTFAMMAEAAARGHELYWCLQPQLALSGRTVETVATRLHLTG 60

Query: 65  K----KEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPF 119
                   +Y  G   +  LS  D +L+R+DPPF+M Y+TST+LLE        + N P 
Sbjct: 61  DDGGEHGAWYREGNSALEPLSAFDAVLMRKDPPFDMEYVTSTWLLELAEAQGARVFNKPQ 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            IR+  EK+ + ++ E + PTL++RD+ +I  F+ E +DII+KPL G GG GVFR+    
Sbjct: 121 AIRDHSEKLAIAQYPEFITPTLVTRDLARIRDFHAEHRDIIVKPLDGMGGMGVFRVGADG 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N ++++E L +     LM+Q Y+P I+DGDKR+LL+ G PV   + R+P   + R N+ 
Sbjct: 181 MNLAAIVETLGQDGARSLMVQRYIPAIKDGDKRVLLIGGVPVPYSLARVPMAGEVRGNLA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG     +L++ D +I + +   L E+GL   G+DVIGDY+TE+NVTSPTC +EI +  
Sbjct: 241 AGGTGRAQELSRRDREIAEALAPGLWEQGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQT 300

Query: 299 GENVASLFWDGIE 311
           G +VA++F D +E
Sbjct: 301 GFHVAAMFIDALE 313


>gi|119486624|ref|ZP_01620674.1| glutathione synthetase [Lyngbya sp. PCC 8106]
 gi|119456241|gb|EAW37373.1| glutathione synthetase [Lyngbya sp. PCC 8106]
          Length = 324

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 117/321 (36%), Positives = 193/321 (60%), Gaps = 10/321 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
              A  ++ I  +    DS+ AI   AQ  G++++     QL +   K +A   P+ L  
Sbjct: 1   MKFAFIIDPIEKLNPGHDSSVAIMEAAQALGHEVWITQMPQLTVTQGKAWATLIPVRLTP 60

Query: 65  KKEQ---------YYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLI 114
            K +         ++SL + +++ L +MD + IR DPP  + Y+ +TY+L+ I+  +TL+
Sbjct: 61  VKREGDRWISAELWFSLDKPQLLALEEMDAVFIRTDPPVTVPYLYATYILDYIDSRKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+P  +R + EK++  +F+E +P T++S++   I  F  +    ++KPL G  G G+  
Sbjct: 121 INSPQGLRAANEKMYALQFTEAIPETIVSQNKQVIREFVEKQGAGVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+SLIE+  ++  EP+M+Q+YLP  ++GDKRI+LL+G+P+GA+NRIP+  + R
Sbjct: 181 LEAGDRNFNSLIEISTKQGREPVMVQTYLPAAKEGDKRIILLDGEPIGAINRIPTGKEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+    ++T  + DIC ++   L+E GL+F GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 GNMAVGGRVAQAEITDRERDICMQLASKLKEDGLYFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIEKIKE 315
                 N+     + IE   +
Sbjct: 301 DLLDNVNLGKQVIEWIENRSK 321


>gi|21672792|ref|NP_660859.1| glutathione synthetase [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25008516|sp|Q8K931|GSHB_BUCAP RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|21623441|gb|AAM68070.1| glutathione synthetase [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 320

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 199/315 (63%), Gaps = 2/315 (0%)

Query: 2   KKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
           KK   I I M+ I+ + +K+DS+FAI LEAQ R ++I++   + LY+R  + YA T+ + 
Sbjct: 4   KKNLKIGIVMDSITLINIKKDSSFAILLEAQKRQHEIYYMEMNDLYLRKGQSYATTKSIE 63

Query: 62  LDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFW 120
           + + +  Y+   ++K I L+++D IL+R+DPPFN  +I +TY+LE+      L++N P  
Sbjct: 64  IQKNQNNYFKFIQKKDISLNELDAILMRKDPPFNTEFIYATYILERAEEKGVLVINKPKS 123

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +R+  EKIF++ FS     TL++R +++I  F+ E  DII+KPL   GG GVFRI   D 
Sbjct: 124 LRDCNEKIFISWFSRFTTDTLVTRKLSKIHNFWKEKNDIILKPLDAMGGKGVFRIKKDDP 183

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPV-GAVNRIPSEVDNRSNIHA 239
           NFS ++E L     +  MIQ+YLP+++ GDKRIL++NGKP+  ++ RIP   + R+N+  
Sbjct: 184 NFSVIVETLTNYEKKYCMIQTYLPEVQFGDKRILIVNGKPIPWSLTRIPKHGETRANLAV 243

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG+  + KL   D +I   +   L++RGL   G+DVIGD +TEINVTSPTCI EI     
Sbjct: 244 GGEGRVQKLNDKDWEIANYLAPILKKRGLILVGLDVIGDKLTEINVTSPTCICEIEEKKN 303

Query: 300 ENVASLFWDGIEKIK 314
            ++  +  D IE   
Sbjct: 304 ISITGILIDYIEDKI 318


>gi|218248734|ref|YP_002374105.1| glutathione synthetase [Cyanothece sp. PCC 8801]
 gi|218169212|gb|ACK67949.1| glutathione synthetase [Cyanothece sp. PCC 8801]
          Length = 334

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 123/320 (38%), Positives = 197/320 (61%), Gaps = 10/320 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ-----P 59
             +A   + +  +    DST A+   AQV G++++     QL + + K +A        P
Sbjct: 1   MKLAFIADPLPRLDPTHDSTVAMMEAAQVAGHEVWITEIHQLNVIEGKAWATLYQVQLTP 60

Query: 60  LSLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLI 114
           ++L  +K      +Y++ E  ++ L  MD + +R+DPP N+ YI +TY+LE INP +TL+
Sbjct: 61  ITLQGEKWVAVPNWYAISEGVLMCLEDMDAVFMRKDPPVNVRYIYATYILELINPDKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+P  +R + EK++  +F  LM  T++S+D   I +F  E    ++KPL G  G G+  
Sbjct: 121 INSPQGLREANEKMYTLQFYSLMAETVVSQDKAVIRKFVDEKGLAVLKPLGGKAGEGILM 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +   DRNF+S+IE+  +   EP+M+Q ++P+ +DGDKRI+LL+G+P+GAVNR+P+  + R
Sbjct: 181 LETSDRNFNSIIEVSTDYGKEPVMVQRFIPEAKDGDKRIILLDGQPIGAVNRVPTGKEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+ E TK++  + +IC  I   L++ GL+F GIDVIG Y+TE+NVTSPTCIREI
Sbjct: 241 GNMAVGGRIEKTKISPREAEICATIASKLQKDGLYFVGIDVIGGYLTEVNVTSPTCIREI 300

Query: 295 HRNGGENVASLFWDGIEKIK 314
               G N+     + +EK  
Sbjct: 301 DLLDGTNLGKKVIEWVEKKV 320


>gi|219681892|ref|YP_002468278.1| glutathione synthetase [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
 gi|257471597|ref|ZP_05635596.1| glutathione synthetase [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|219624735|gb|ACL30890.1| glutathione synthetase [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
          Length = 320

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 132/318 (41%), Positives = 204/318 (64%), Gaps = 4/318 (1%)

Query: 1   MKK--IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ 58
           M K     I I M+ I ++ +K+DS+FAI LEAQ R + I +   + LY+R  + +A T+
Sbjct: 1   MSKKISLKIGILMDSIESINIKKDSSFAILLEAQKRNHIIHYMEMNDLYLRKEQAFARTR 60

Query: 59  PLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNN 117
            + L +  +++Y   +++ I LS++DVIL+R+DPPFN  +I STY+LE+      LI+N 
Sbjct: 61  LIKLIKNTQKWYQFIKQQSISLSELDVILMRKDPPFNTEFIYSTYILERAEETGVLIINK 120

Query: 118 PFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITL 177
           P  +R+  EKIF + F +L+  TL++R+I QI +F+ + +DIIIKPL   GG+ +FRI  
Sbjct: 121 PKSLRDCNEKIFTSWFPDLITDTLVTRNIFQIRQFWEKYQDIIIKPLDAMGGSNIFRIKK 180

Query: 178 GDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPV-GAVNRIPSEVDNRSN 236
            D NFS ++E +     +  M+Q+YLP+I+ GDKRIL++NGKP+   + RI    + R+N
Sbjct: 181 NDPNFSVIVENMTNYERKYCMVQNYLPEIKLGDKRILIINGKPIPWCLARIARIGETRAN 240

Query: 237 IHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHR 296
           + AGG+ ++  L++ D  I   +  +L++RGL   G+DVIGD +TEINVTSPTCI EI  
Sbjct: 241 LAAGGEGKIQSLSETDWKIANYLSPTLKKRGLILVGLDVIGDKLTEINVTSPTCICEIES 300

Query: 297 NGGENVASLFWDGIEKIK 314
               ++  +  D IEK  
Sbjct: 301 QKNISITGMLLDYIEKKV 318


>gi|219682447|ref|YP_002468831.1| glutathione synthetase [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219622180|gb|ACL30336.1| glutathione synthetase [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|311086268|gb|ADP66350.1| glutathione synthetase [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086843|gb|ADP66924.1| glutathione synthetase [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087432|gb|ADP67512.1| glutathione synthetase [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087923|gb|ADP68002.1| glutathione synthetase [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 320

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 133/318 (41%), Positives = 204/318 (64%), Gaps = 4/318 (1%)

Query: 1   MKK--IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ 58
           M K     I I M+ I ++ +K+DS+FAI LEAQ R + I +   + LY+R  + +A T+
Sbjct: 1   MSKKISLKIGILMDSIESINIKKDSSFAILLEAQKRNHIIHYMEMNDLYLRKEQAFARTR 60

Query: 59  PLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNN 117
            + L +  +++Y   +++ I LS++DVIL+R+DPPFN  +I STY+LE+      LI+N 
Sbjct: 61  LIKLIKNTQKWYQFIKQQSISLSELDVILMRKDPPFNTEFIYSTYILERAEETGVLIINK 120

Query: 118 PFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITL 177
           P  +R+  EKIF + F +L+  TL++R+I QI +F+ + +DIIIKPL   GG+ +FRI  
Sbjct: 121 PKSLRDCNEKIFTSWFPDLITDTLVTRNIFQIRQFWEKYQDIIIKPLDAMGGSNIFRIKK 180

Query: 178 GDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPV-GAVNRIPSEVDNRSN 236
            D NFS ++E +     +  M+Q+YLP+I+ GDKRIL++NGKP+   V RI    + R+N
Sbjct: 181 NDPNFSVIVENMTNYERKYCMVQNYLPEIKLGDKRILIINGKPIPWCVARIARIGETRAN 240

Query: 237 IHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHR 296
           + AGG+ ++  L++ D  I   +  +L++RGL   G+DVIGD +TEINVTSPTCI EI  
Sbjct: 241 LAAGGEGKIQSLSETDWKIANYLSPTLKKRGLILVGLDVIGDKLTEINVTSPTCICEIES 300

Query: 297 NGGENVASLFWDGIEKIK 314
               ++  +  D IEK  
Sbjct: 301 QKNISITGMLLDYIEKKV 318


>gi|257061792|ref|YP_003139680.1| glutathione synthetase [Cyanothece sp. PCC 8802]
 gi|256591958|gb|ACV02845.1| glutathione synthetase [Cyanothece sp. PCC 8802]
          Length = 334

 Score =  275 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 124/320 (38%), Positives = 197/320 (61%), Gaps = 10/320 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ-----P 59
             +A   + +  +    DST A+   AQV G++++     QL + + K +A        P
Sbjct: 1   MKLAFIADPLPRLDPTHDSTVAMMEAAQVAGHEVWITEIHQLNVIEGKAWATLYQVQLTP 60

Query: 60  LSLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLI 114
           ++L  +K      +Y++ E  ++ L  MD + +R+DPP N+ YI +TY+LE INP +TL+
Sbjct: 61  ITLQGEKWVAVPNWYAISEGVLMCLEDMDAVFMRKDPPVNVRYIYATYILELINPDKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+P  +R + EK++  +F  LM  T++SRD   I +F  E    ++KPL G  G G+  
Sbjct: 121 INSPQGLREANEKMYTLQFYSLMAETVVSRDKAVIRKFVDEKGLAVLKPLGGKAGEGILM 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +   DRNF+S+IE+  +   EP+M+Q ++P+ +DGDKRI+LL+G+P+GAVNR+P+  + R
Sbjct: 181 LETSDRNFNSIIEVSTDYGKEPVMVQRFIPEAKDGDKRIILLDGQPIGAVNRVPTGKEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+ E TK++  + +IC  I   L++ GL+F GIDVIG Y+TE+NVTSPTCIREI
Sbjct: 241 GNMAVGGRIEKTKISPREAEICATIASKLQKDGLYFVGIDVIGGYLTEVNVTSPTCIREI 300

Query: 295 HRNGGENVASLFWDGIEKIK 314
               G N+     + +EK  
Sbjct: 301 DLLDGTNLGKKVIEWVEKKV 320


>gi|332709586|ref|ZP_08429546.1| glutathione synthase [Lyngbya majuscula 3L]
 gi|332351619|gb|EGJ31199.1| glutathione synthase [Lyngbya majuscula 3L]
          Length = 324

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 120/320 (37%), Positives = 197/320 (61%), Gaps = 10/320 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL---- 60
              A  ++ +  +    D++ A+   AQ  G++++     QL +   + +   +P+    
Sbjct: 1   MKFAFIIDPLPKLDPGHDTSVALMEAAQELGHEVWVTQAQQLSVIQGQAWGLLEPVQLTP 60

Query: 61  -SLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLI 114
             LD+       Q+Y  G+  +  L +MD + +R DPP  + Y+ +TY+L+ INP +TL+
Sbjct: 61  AKLDDGHWVVSEQWYQTGKALLKPLEEMDAVWMRTDPPVTIPYLYATYILDYINPDKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N P  IR + EK++  +F E++P T++S+D + I +F  E +  ++KPL G  G G+  
Sbjct: 121 INAPTGIRTANEKMYALQFQEVIPQTIVSQDKSVIRQFVEEKEAAVLKPLGGKAGEGIIF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +   DRNF+SL+E+  ++  EP+M+Q+YLP  +DGDKRI+LLNG+P+GAVNRIP+  + R
Sbjct: 181 LQASDRNFNSLVEISTKQGSEPVMVQAYLPAAKDGDKRIILLNGEPIGAVNRIPTGKEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+   T++T  + +IC R+   L++ GL+F GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 GNMAVGGRVAATEITPREEEICARLLPKLQQDGLYFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIEKIK 314
            R  G ++A      +E +K
Sbjct: 301 DRLDGTHLAKEVITWVEAVK 320


>gi|307152864|ref|YP_003888248.1| glutathione synthetase [Cyanothece sp. PCC 7822]
 gi|306983092|gb|ADN14973.1| glutathione synthetase [Cyanothece sp. PCC 7822]
          Length = 320

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 117/317 (36%), Positives = 194/317 (61%), Gaps = 10/317 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
              A+ ++ ++ +    D++ A+   AQ  G++++     QL + + K YA  Q + L  
Sbjct: 1   MKFALIIDPLAKLDPGHDTSVALMEAAQALGHEVWVSEVHQLCVINGKAYAILQKIELTP 60

Query: 65  KK---------EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLI 114
            +           +Y +GE  + +L +MD + +R+DPP  + Y+ +TY+L  I+  +TL+
Sbjct: 61  VELGENRWVAVPNWYHVGEGMLTNLEEMDAVFMRKDPPVTIQYLYATYILTLIDENKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+P  +R + EK++  +F ++MP T++S D   I RF  E    ++KPL G  G G+  
Sbjct: 121 INSPRGLREANEKMYTLQFHQVMPETVVSLDKKIIRRFVEEKGAAVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+S+IE+  ++  EP+M+Q YLP  ++GDKRI+LLNG+P+GAVNR+P+  + R
Sbjct: 181 LEPGDRNFNSIIEVSTKQGQEPVMVQDYLPAAKEGDKRIILLNGEPIGAVNRVPTGAEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+ E T++T  + +IC  +G  LRE GL+F G+DVIG Y+TE+NVTSPT +REI
Sbjct: 241 GNMAVGGRVEKTEITPREQEICAVVGPKLREDGLYFVGLDVIGGYLTEVNVTSPTGVREI 300

Query: 295 HRNGGENVASLFWDGIE 311
            R    ++       +E
Sbjct: 301 DRLNNVSLGKQVIQWLE 317


>gi|332526429|ref|ZP_08402549.1| glutathione synthetase [Rubrivivax benzoatilyticus JA2]
 gi|332110559|gb|EGJ10882.1| glutathione synthetase [Rubrivivax benzoatilyticus JA2]
          Length = 315

 Score =  275 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 118/310 (38%), Positives = 174/310 (56%), Gaps = 3/310 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQL-YMRDSKIYANTQPLSLD 63
            ++    + +   K  +DSTFA+  EA  RG+ + H     L +     + A T+ + L 
Sbjct: 1   MDLLFVADPLEGFKTTKDSTFAMMREAARRGHGLLHCEARALRWHSGGSVVATTRRIELT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLL-EKINPETLIVNNPFWIR 122
                ++ + E     ++    +L+RQDPPF+  Y  +T+LL +       + N P  +R
Sbjct: 61  GDAHDWFRVVETVETRVADTGAVLMRQDPPFDSEYFYATHLLGQAEREGARVFNKPAALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ + EF +  PPTL++RD   +  F+ E +DII+KPL G GG G+FR+     N 
Sbjct: 121 DHPEKLAIMEFPQFTPPTLVTRDAAAVRAFHAEHRDIILKPLDGMGGMGIFRVGADGLNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L       LM+Q YLP+I  GDKR+L++ GKPV  V  RIP   + R N+ AGG
Sbjct: 181 GSIIETLNAGGTRTLMVQRYLPEIVHGDKRVLIIGGKPVPHVLARIPQGSEIRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L   D +I + +G  L  RGL   G+DVIG+ ITEINVTSPTC +EI +  G +
Sbjct: 241 KGVAQPLAPRDREIAEALGPVLAARGLLLVGLDVIGERITEINVTSPTCFQEIQQQTGFD 300

Query: 302 VASLFWDGIE 311
           VA++F D +E
Sbjct: 301 VAAMFVDALE 310


>gi|124265373|ref|YP_001019377.1| glutathione synthetase [Methylibium petroleiphilum PM1]
 gi|124258148|gb|ABM93142.1| glutathione synthase [Methylibium petroleiphilum PM1]
          Length = 316

 Score =  275 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 114/311 (36%), Positives = 174/311 (55%), Gaps = 4/311 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQ-LYMRDSKIYANTQPLSLD 63
             +    + +   K  +D+TF++  EA  RG+ +    P   ++ R   + A  Q  +L 
Sbjct: 1   MQLLFIADPLDHFKTYKDTTFSMMREAAARGHTLLACEPRHVMWARGGVVSARMQAFTLT 60

Query: 64  EKKEQYYSLG-EEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
              + +Y      +   L  +  +L+R+DPPF+  Y  +T+LLE+       + N P  +
Sbjct: 61  GDAKDWYRTDGAAQQRPLKDVGAVLMRKDPPFDSEYFYATHLLEQAEREGARVFNAPRAL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+ PEK+ + EF EL+ PTL++RD   +  F+ E +DII+KPL G GG G+FR+     N
Sbjct: 121 RDHPEKLAILEFPELIGPTLVTRDADDVRAFHAEHRDIILKPLDGMGGMGIFRVREDGLN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
             S+ E L +   + +M+Q +LP+I  GDKRILL+ G+PV   + RIP   + R N+ AG
Sbjct: 181 LGSITETLNKFGAQTVMVQRFLPEIAQGDKRILLIGGEPVPFSLARIPQGSEVRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           GK     L+  D +I + +G  L  RGL   G+DVIGD +TEINVTSPT  +EI +  G 
Sbjct: 241 GKGVALPLSARDREIAETLGPVLAARGLLLVGLDVIGDCLTEINVTSPTGFQEITQQTGF 300

Query: 301 NVASLFWDGIE 311
           +VA  F D +E
Sbjct: 301 DVARRFVDALE 311


>gi|15617140|ref|NP_240353.1| glutathione synthetase [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
 gi|11386819|sp|P57612|GSHB_BUCAI RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|25293530|pir||G84993 glutathione synthase (EC 6.3.2.3) [imported] - Buchnera sp.
           (strain APS)
 gi|10039205|dbj|BAB13239.1| glutathione synthetase [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
          Length = 320

 Score =  275 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 133/318 (41%), Positives = 203/318 (63%), Gaps = 4/318 (1%)

Query: 1   MKK--IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ 58
           M K     I I M+ I ++ +K+DS+FAI LEAQ R + I +   + LY+R  + +A T+
Sbjct: 1   MSKKISLKIGILMDSIESINIKKDSSFAILLEAQKRNHIIHYMEMNDLYLRKEQAFARTR 60

Query: 59  PLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNN 117
            + L +  +++Y   +++ I LS++DVIL+R+DPPFN  +I STY+LE+      LI+N 
Sbjct: 61  LIKLIKNTQKWYQFIKQQSISLSELDVILMRKDPPFNTEFIYSTYILERAEETGVLIINK 120

Query: 118 PFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITL 177
           P  +R+  EKIF + F +L+  TL++R+I QI +F+ + +DIIIKPL   GG  +FRI  
Sbjct: 121 PKSLRDCNEKIFTSWFPDLITDTLVTRNIFQIRQFWEKYQDIIIKPLDAMGGANIFRIKK 180

Query: 178 GDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPV-GAVNRIPSEVDNRSN 236
            D NFS ++E +     +  M+Q+YLP+I+ GDKRIL++NGKP+   V RI    + R+N
Sbjct: 181 NDPNFSVIVENMTNYERKYCMVQNYLPEIKLGDKRILIINGKPIPWCVARIARIGETRAN 240

Query: 237 IHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHR 296
           + AGG+ ++  L++ D  I   +  +L++RGL   G+DVIGD +TEINVTSPTCI EI  
Sbjct: 241 LAAGGEGKIQSLSETDWKIANYLSPTLKKRGLILVGLDVIGDKLTEINVTSPTCICEIES 300

Query: 297 NGGENVASLFWDGIEKIK 314
               ++  +  D IEK  
Sbjct: 301 QKNISITGMLLDYIEKKV 318


>gi|296284087|ref|ZP_06862085.1| glutathione synthetase [Citromicrobium bathyomarinum JL354]
          Length = 323

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 128/321 (39%), Positives = 194/321 (60%), Gaps = 8/321 (2%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRD-----SKIYANT 57
                A QM+ I +VK+  DS+FA+ L AQ RG++++HY    L          KI A  
Sbjct: 1   MTLRTAFQMDPIESVKIAGDSSFALMLSAQERGHEVWHYDVKSLAWESDGSPAGKITAFA 60

Query: 58  QPLSLDEKKEQYYSL--GEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIV 115
           +P+ +      ++        I     +DV+ +RQDPPF++ YIT+ +LL+++   TL+V
Sbjct: 61  RPVRVKRVGGDHFEWLGERRIIDLAKDIDVVWLRQDPPFDLGYITAAFLLDRLKGTTLVV 120

Query: 116 NNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRI 175
           N+P  + N+PEK+FV +++  MPPTLI+R +  I  F  +   +++KPL+GNGG  +F+I
Sbjct: 121 NDPREVVNAPEKMFVLDYARFMPPTLIARRLADIQAFQKKHGAVVVKPLHGNGGKAIFKI 180

Query: 176 TLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRS 235
                N S+L E+   ++PE  M+Q++LP + +GDKRI+L++G+  GA+NR P E + RS
Sbjct: 181 DESGTNLSALSEVFDNQWPEAHMVQAFLPTVSEGDKRIVLVDGEVAGAINRKPGEGEFRS 240

Query: 236 NIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGD-YITEINVTSPTCIREI 294
           N+  GG AE  +LT  + +IC  +G  L+ RGL F GIDVIG  ++TEINVTSPT I  I
Sbjct: 241 NLAQGGSAEAAQLTAREEEICAAMGPELKRRGLVFVGIDVIGGEWLTEINVTSPTGIVAI 300

Query: 295 HRNGGENVASLFWDGIEKIKE 315
            R  G + A   WD  E+   
Sbjct: 301 DRFNGTDTAGALWDATERRHR 321


>gi|264680688|ref|YP_003280598.1| glutathione synthetase [Comamonas testosteroni CNB-2]
 gi|262211204|gb|ACY35302.1| glutathione synthetase [Comamonas testosteroni CNB-2]
          Length = 315

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 181/311 (58%), Gaps = 3/311 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMR-DSKIYANTQPLSLD 63
             I    + + +  + +DSTFA+  EAQ RG+QI    P  +  +   K+ A  + +SL 
Sbjct: 1   MQILFVADPLESFVIYKDSTFAMMREAQRRGHQIVACEPRHISWQSGGKVMAQVRHISLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLL-EKINPETLIVNNPFWIR 122
            ++++++      +  L+  D I++R+DPPF+  +  +T++L +       + N P  +R
Sbjct: 61  GEQDRWFEETRSALAALADFDAIVMRKDPPFDSEFFYATHMLGQAEREGAKVFNKPSALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
             PEK+ + EF++ + PTL++R    I  F+ E KDII+KPL G GG G+FR+    RN 
Sbjct: 121 EHPEKLAIMEFAQFISPTLVTRSAQDIRAFHAEHKDIILKPLDGMGGMGIFRVGEDGRNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L +     +M+Q +LP I  GDKR+L++ GKPV     RIP   + R N+ AGG
Sbjct: 181 GSIIETLNQGGSTSVMVQKFLPDIVHGDKRVLIIGGKPVPFCLARIPQGNEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L + D  I + IGE L +RGL   G+DVIG  +TEINVTSPTC +EI    G +
Sbjct: 241 KGIAQPLAQQDKAIAEFIGERLVQRGLLLIGLDVIGHNVTEINVTSPTCFQEIFDQTGCD 300

Query: 302 VASLFWDGIEK 312
           VA+LF D +E+
Sbjct: 301 VAALFVDALEQ 311


>gi|148652334|ref|YP_001279427.1| glutathione synthetase [Psychrobacter sp. PRwf-1]
 gi|148571418|gb|ABQ93477.1| glutathione synthase [Psychrobacter sp. PRwf-1]
          Length = 325

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 122/313 (38%), Positives = 197/313 (62%), Gaps = 2/313 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
           K+ NI + M+ I TV  K+DST A+   A  RG+ + +     L++   ++  + Q +++
Sbjct: 8   KLLNILVVMDPIETVNYKKDSTLAMMWSASDRGHGLGYCQIHDLWLDKGELKVDAQAVTV 67

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFWI 121
                 +YSL ++    ++  DVIL+R+DPPFNM ++ STY+L+       L+VN+P  I
Sbjct: 68  RRDPNDFYSLADKVTQPITDYDVILMRKDPPFNMRFLYSTYMLDHAKAAGVLVVNDPQAI 127

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T FS+LM PT+++     I +F  E +D+I+KPL G GGTG+FR+T    N
Sbjct: 128 RDCNEKLFATWFSDLMSPTIVTSKQQHIRKFIQEHQDVIVKPLDGMGGTGIFRLTQDSPN 187

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
             + +EML E    P+M Q YLP+I+ GDKR+L+++G+ V   + RIP++ + R N+ AG
Sbjct: 188 IGATLEMLTELETLPIMAQRYLPEIKQGDKRVLIVDGEIVPFSLARIPTKGETRGNLAAG 247

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     +T+ ++ + K++   ++++GL F G+D+IG  ITEINVTSPTC+REI+   G 
Sbjct: 248 GQGVAMPVTEQEMAVAKKVAPIVKQKGLMFVGLDLIGARITEINVTSPTCVREINDQCGT 307

Query: 301 NVASLFWDGIEKI 313
           ++A+     IEK 
Sbjct: 308 DIATDLIIAIEKK 320


>gi|257454277|ref|ZP_05619543.1| glutathione synthase [Enhydrobacter aerosaccus SK60]
 gi|257448294|gb|EEV23271.1| glutathione synthase [Enhydrobacter aerosaccus SK60]
          Length = 320

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 128/317 (40%), Positives = 188/317 (59%), Gaps = 2/317 (0%)

Query: 2   KKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLS 61
            K  N  I M+ I T+  K+D+T A+      RG+   +     L++ +  +  ++Q L 
Sbjct: 1   MKPLNFLIVMDDIHTINYKKDTTLAMLWAIADRGHTAHYCQIHDLWLDNGALQIDSQSLK 60

Query: 62  LDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFW 120
             +   ++Y LGE+     S  DVIL+R+DPPF+M ++ S YLLE       L+VNNP  
Sbjct: 61  TLKDPARFYELGEKTTQPASAFDVILMRKDPPFDMQFLYSLYLLEYAQRAGVLVVNNPES 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           +R+  EK+F T+F ELM PT+++   T I  F    +D+I+KPL G GG G+FR+T    
Sbjct: 121 VRDCNEKLFATQFPELMTPTIVTNKQTHIRDFIKTHQDVIVKPLDGMGGMGIFRLTADSP 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHA 239
           N  S +EML +    P+M Q YLP+I+DGDKRIL++ GKPV     RIPS+ + R N+ A
Sbjct: 181 NIGSTLEMLTQLESLPVMAQKYLPEIKDGDKRILIVGGKPVDYCLARIPSQGETRGNLAA 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG+     L+  +  + +++   L ++GL+F G+DVIG  +TEINVTSPTC+REI    G
Sbjct: 241 GGRGVAMPLSAQERQVAEQVAPVLLQKGLYFVGLDVIGGKVTEINVTSPTCVREIDDQCG 300

Query: 300 ENVASLFWDGIEKIKET 316
            ++A  F   IE   ET
Sbjct: 301 THIAEDFIAFIESHIET 317


>gi|124024966|ref|YP_001014082.1| glutathione synthetase [Prochlorococcus marinus str. NATL1A]
 gi|123960034|gb|ABM74817.1| putative Glutathione synthetase [Prochlorococcus marinus str.
           NATL1A]
          Length = 309

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 110/307 (35%), Positives = 174/307 (56%), Gaps = 5/307 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
                 ++ I  +  K+DS+ A+   A      ++  TP  L  R    +  +  ++   
Sbjct: 1   MKQLFVLDPIENINPKKDSSAALMQAASRANIDVWICTPSDLQARGDDAWVVSNKVN--- 57

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
             E + ++   + + L     I +R+DPP +  ++ +T+LLE        ++N P  +R 
Sbjct: 58  -CEPWINVQSPRSLPLRDFSCIWMRKDPPVDEAFLYATHLLEVAERDGVNVINKPASLRA 116

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+    FS+LM PTL++  + Q+  F  E  ++++KPL G GG GV RI        
Sbjct: 117 WNEKLGALRFSDLMAPTLVASRVEQLITFAKEYGEVVLKPLGGKGGQGVIRIAKDAPGLE 176

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKA 243
           +L+E++  +   P+M+Q +LP++ +GDKRILL+NG+P+GA+NR P E D RSN+  GGKA
Sbjct: 177 ALLELVTSQEHLPVMMQQFLPEVINGDKRILLVNGEPLGAINRRPKEGDFRSNLALGGKA 236

Query: 244 ELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVA 303
           E TKLT  +++IC +I  +L+E GLFF GIDVIG  ++EINVTSPT IRE+       +A
Sbjct: 237 ETTKLTPKEIEICNQIKPALQEEGLFFVGIDVIGGMLSEINVTSPTGIREVENLMNVPLA 296

Query: 304 SLFWDGI 310
               D +
Sbjct: 297 DQVIDYL 303


>gi|22298451|ref|NP_681698.1| glutathione synthetase [Thermosynechococcus elongatus BP-1]
 gi|29611754|sp|Q8DKF1|GSHB_THEEB RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|22294631|dbj|BAC08460.1| glutathione synthetase [Thermosynechococcus elongatus BP-1]
          Length = 318

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 110/316 (34%), Positives = 191/316 (60%), Gaps = 10/316 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD- 63
            +IA  ++ I+++    D++ A+   AQ  G +++     QL +R+ +++A   P+ L  
Sbjct: 1   MDIAFIIDPIASLDPGHDTSVALMEAAQAAGARVWVTEISQLLIREGQVWAALTPIQLSP 60

Query: 64  --------EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIV 115
                   +  + ++ LG  +   L+    + +R+DPP N  Y+ +TY L+ ++P+T +V
Sbjct: 61  VQLVDGQWQIPQPWFELGALEWRPLNTFRAVWMRKDPPVNTAYLYATYCLDLVDPQTTLV 120

Query: 116 -NNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
            N+P  +R++ EK++  +F+ ++P T+++ D  +I  F  +    ++KPL G GG G+  
Sbjct: 121 LNSPAGLRHANEKMYALQFTSVIPKTIVTADKQRIREFVQQQGMAVLKPLGGKGGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRN +S+IE+  ++   P+M+Q YLP  ++GDKRI+LLNG+P+GAVNRIP+  + R
Sbjct: 181 LQAGDRNLNSMIEISTQRGQLPVMLQEYLPAAKEGDKRIILLNGEPIGAVNRIPTGDEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+    ++T+ D  IC+ +  +LR  GL+F GIDVIG Y+TE+NVTSPT +REI
Sbjct: 241 GNMATGGRVAAAEITERDRQICQTLAPALRRDGLYFVGIDVIGGYLTEVNVTSPTGVREI 300

Query: 295 HRNGGENVASLFWDGI 310
            R  G  +       +
Sbjct: 301 DRLNGTRLGQQVMAWL 316


>gi|294671217|ref|ZP_06736070.1| hypothetical protein NEIELOOT_02927 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307045|gb|EFE48288.1| hypothetical protein NEIELOOT_02927 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 316

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 101/314 (32%), Positives = 175/314 (55%), Gaps = 6/314 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + ++  K  +D+T+A+  EA  RG+++FH    +L +++  +YA   P     
Sbjct: 1   MDILFIADPLAGFKTYKDTTYAMMREAARRGHRLFHTLSAELSVQNGIVYAAAAPFEFLG 60

Query: 63  --DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPF 119
             D+    ++  G      L++   +++R DPPF+M Y+ +T LL    + +  + N+  
Sbjct: 61  AKDDHDHAWFEAGSPVQTALTEFGAVIMRTDPPFDMQYLYATQLLTLAESQDAKVFNSGQ 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R+  EK+ +  F + + PT+++     +  F  E  DII+KPL G GG G+FR+T  D
Sbjct: 121 AMRDFNEKLAILNFPQFVSPTIVTTRAADVRTFLAEHGDIIVKPLDGMGGMGIFRLTGQD 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N  S++E L       +M Q Y+P I  GDKR+L++ G+ V   + RIP   + R N+ 
Sbjct: 181 PNIGSILETLMRLDTRTIMAQRYIPDIVKGDKRVLVIGGEVVPYALARIPQNGETRGNLA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+    +L+  D +I + +   L+ RG+   G+D+IG+ +TE+NVTSPT  +EI +  
Sbjct: 241 AGGRGVAQELSARDREIAETLAPELKRRGILLAGLDIIGECLTEVNVTSPTGFQEISKQK 300

Query: 299 GENVASLFWDGIEK 312
           G +VA+ F D +E+
Sbjct: 301 GWDVAARFIDAVEQ 314


>gi|220910182|ref|YP_002485493.1| glutathione synthetase [Cyanothece sp. PCC 7425]
 gi|219866793|gb|ACL47132.1| glutathione synthetase [Cyanothece sp. PCC 7425]
          Length = 322

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 125/318 (39%), Positives = 192/318 (60%), Gaps = 10/318 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
             +A  ++ I+ +    D++ A    AQ  G++++    D+L + + K +A+ QP+ L  
Sbjct: 1   MKLAFIIDPIARLDPGHDTSVAFMEAAQELGHEVWITEIDRLNVVEGKAWAHLQPVQLEP 60

Query: 63  -------DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKI-NPETLI 114
                       ++YSLGE + + L  MD + +R+DPP    Y+ +TY+L+ I    TL+
Sbjct: 61  VQLIEGRWRAITEWYSLGESEFLPLESMDAVFMRKDPPVTTAYLYATYILDYIDPRRTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N P  +RN+ EK++  +F E MP T++SRD T I +F       ++KPL G  G G+  
Sbjct: 121 INAPTGLRNANEKMYALQFREAMPATIVSRDKTVIRQFVEAKGAAVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+SL+E+  E+   P+MIQ YLP  +DGDKRI+LL+G+P+GAVNRIP+  + R
Sbjct: 181 LDPGDRNFNSLVEVSTERGLLPVMIQEYLPAAKDGDKRIILLDGEPIGAVNRIPTGNEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+ E + LT+ +  IC ++  +LR  GL F GIDVIG Y+TE+NVTSPT IRE 
Sbjct: 241 GNMATGGRVEQSGLTEREKQICAQLAPTLRRDGLIFVGIDVIGGYLTEVNVTSPTGIREA 300

Query: 295 HRNGGENVASLFWDGIEK 312
            R     +A    D I++
Sbjct: 301 DRLDQTRLADRVIDWIKR 318


>gi|126643344|ref|YP_001086328.1| glutathione synthetase [Acinetobacter baumannii ATCC 17978]
          Length = 308

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 130/303 (42%), Positives = 189/303 (62%), Gaps = 2/303 (0%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E    YY
Sbjct: 1   MDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFEDYNHYY 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRNSPEKIF 129
            LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+  EK+F
Sbjct: 61  ELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRDCNEKLF 120

Query: 130 VTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEML 189
            T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  S +EML
Sbjct: 121 ATQFPELQVPTLVTSQQSLIREFITEYGDVIVKPLDGMGGMGIFRLYQDGVNIGSTLEML 180

Query: 190 FEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGKAELTKL 248
            E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG  +   L
Sbjct: 181 TELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGLGQARPL 240

Query: 249 TKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWD 308
           T+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++A   +D
Sbjct: 241 TENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSIADDLFD 300

Query: 309 GIE 311
            +E
Sbjct: 301 VLE 303


>gi|311105448|ref|YP_003978301.1| glutathione synthase [Achromobacter xylosoxidans A8]
 gi|310760137|gb|ADP15586.1| glutathione synthase [Achromobacter xylosoxidans A8]
          Length = 323

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 112/314 (35%), Positives = 173/314 (55%), Gaps = 6/314 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            ++   ++ +  +K  +DS+ A+      RG+ +       LY+    +     P+ L  
Sbjct: 1   MHVLFVLDPLPLLKAYKDSSVAMMRALVARGHTLSVAMQGDLYIEAGTVKTAATPIELVA 60

Query: 63  --DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPF 119
             D     ++     + + L++   +++R+DPPF+M Y+ ST+LLE        + N   
Sbjct: 61  DADLHGHDWWRESSAQDLPLAEFGAVVMRKDPPFDMEYVYSTHLLEYAEAQGARVFNTGA 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            IRN PEK+ +TE SE   PTL++R + ++  F+ E  D+I+KPL G GGTGVFR+   D
Sbjct: 121 AIRNHPEKLAITEISEFTAPTLVTRSMARLKAFHDEHHDVIVKPLDGMGGTGVFRLQPKD 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIH 238
            N ++++E L +     +M Q Y+P I  GDKRILL+ G PV     RIP   + R N+ 
Sbjct: 181 PNLNAILETLTDNGARTIMAQRYIPDIVKGDKRILLIGGVPVPYCLARIPLAGETRGNLA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+    +L+  D +I + +   L  RGL   G+DVIGDY+TE+NVTSPTC  EI    
Sbjct: 241 AGGRGVAQELSPRDREIAEAVAPKLAARGLLLVGLDVIGDYVTEVNVTSPTCFVEIAEQT 300

Query: 299 GENVASLFWDGIEK 312
           G +VA +F   +EK
Sbjct: 301 GFDVAGMFVQALEK 314


>gi|323519779|gb|ADX94160.1| glutathione synthetase [Acinetobacter baumannii TCDC-AB0715]
          Length = 308

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 130/303 (42%), Positives = 189/303 (62%), Gaps = 2/303 (0%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E    YY
Sbjct: 1   MDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFEDYNHYY 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRNSPEKIF 129
            LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+  EK+F
Sbjct: 61  ELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRDCNEKLF 120

Query: 130 VTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEML 189
            T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  S +EML
Sbjct: 121 ATQFPELQVPTLVTSQQSLIREFITEHGDVIVKPLDGMGGMGIFRLYQDGVNIGSTLEML 180

Query: 190 FEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGKAELTKL 248
            E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG  +   L
Sbjct: 181 TELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGLGQARPL 240

Query: 249 TKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWD 308
           T+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++A   +D
Sbjct: 241 TENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSIADDLFD 300

Query: 309 GIE 311
            +E
Sbjct: 301 VLE 303


>gi|114330956|ref|YP_747178.1| glutathione synthetase [Nitrosomonas eutropha C91]
 gi|114307970|gb|ABI59213.1| glutathione synthase [Nitrosomonas eutropha C91]
          Length = 316

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 186/315 (59%), Gaps = 5/315 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
             +A  ++ + ++K+ +DS++A+  EA  R +Q++      L  ++ ++    + L+L  
Sbjct: 1   MKLAFILDPLDSIKIGKDSSYAMMCEAASRHHQLYTLQQSGLAWKNHQVIGFARSLTLID 60

Query: 63  -DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFW 120
             +   ++Y  G  + I L++ D +L+R+DPPF+  YI STYLLE        +VN+P  
Sbjct: 61  PPDNPHRWYEEGVIEEIPLTEFDAVLMRKDPPFDTEYIYSTYLLELAERQGAYVVNSPRG 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IR+  EK+ +TEF + +P +L++     I +F  E KDII+KPL G GG G+FR+   D 
Sbjct: 121 IRDHNEKLAITEFPQFIPSSLVTSQEQLILQFLAEHKDIILKPLDGMGGAGIFRMQNTDH 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHA 239
           N   +IE L       +M Q +LP+IR+GDKRILL+ GKPV   + RIP   + R N+  
Sbjct: 181 NIGVIIETLTRYGTRTIMAQRFLPEIREGDKRILLIAGKPVDYALARIPKPGETRGNLAV 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG  ++  L+  D  I + +G+ L  RGL   G+DVIG+++TEINVTSPT +REI    G
Sbjct: 241 GGTGKVQPLSARDRKISEELGQILYARGLMLIGLDVIGNHLTEINVTSPTGMREISDQTG 300

Query: 300 ENVASLFWDGIEKIK 314
            NVA L  D +E+  
Sbjct: 301 INVAGLMIDALEQNI 315


>gi|218440237|ref|YP_002378566.1| glutathione synthetase [Cyanothece sp. PCC 7424]
 gi|218172965|gb|ACK71698.1| glutathione synthetase [Cyanothece sp. PCC 7424]
          Length = 320

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 118/320 (36%), Positives = 192/320 (60%), Gaps = 10/320 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ-----P 59
                 ++ ++ +    D++ A+   AQ  G++I+     QL + + K  A        P
Sbjct: 1   MKFVFIIDPLAKLDPGHDTSVALMEAAQSLGHEIWVTEIHQLSVINGKACAILHQVELTP 60

Query: 60  LSLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLI 114
           + L E +      +Y + E  + +L +MD + +R+DPP  + Y+ +TY+L  I+  +TL+
Sbjct: 61  VELRENRWIAVSLWYQVSEGVVTNLEEMDAVFMRKDPPVTIQYLYATYILALIDESKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+P  +R + EK++  +F ++MP T++S D   I RF  E K  ++KPL G  G G+  
Sbjct: 121 INSPRGLREANEKMYTLQFHQVMPETVVSLDKKIIRRFVEEKKAAVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+S+IE+  +   EP+M+Q YLP  ++GDKRI+LLNG+P+GAVNR+P+  + R
Sbjct: 181 LEPGDRNFNSIIEVSTKHGQEPVMVQDYLPAAKEGDKRIILLNGEPIGAVNRVPTGAEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+ E T++T  + +IC  +G  LRE GL+F G+DVIG Y+TE+NVTSPT +REI
Sbjct: 241 GNMAVGGRVEKTEITAREKEICALVGPKLREDGLYFVGLDVIGGYLTEVNVTSPTGVREI 300

Query: 295 HRNGGENVASLFWDGIEKIK 314
            R    ++       +E  K
Sbjct: 301 DRLNNVSLGKQVIQWLENYK 320


>gi|72383382|ref|YP_292737.1| glutathione synthetase [Prochlorococcus marinus str. NATL2A]
 gi|72003232|gb|AAZ59034.1| glutathione synthase [Prochlorococcus marinus str. NATL2A]
          Length = 309

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 110/307 (35%), Positives = 173/307 (56%), Gaps = 5/307 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
                 ++ I  +  K+DS+ A+   A      ++  TP  L  R    +  +  ++   
Sbjct: 1   MKQLFVLDPIENINPKKDSSAALMQAASRADIDVWICTPSDLQARGDDAWVVSNKVN--- 57

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
             E + ++   + + L     I +R+DPP +  ++ +T+LLE        ++N P  +R 
Sbjct: 58  -CEPWINVQSSRSLPLRDFSCIWMRKDPPVDEAFLYATHLLEVAERDGVNVINKPASLRA 116

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
             EK+    FS LM PTL++  + Q+  F  E  ++++KPL G GG GV RI        
Sbjct: 117 WNEKLGALRFSNLMAPTLVASRVEQLITFAKEYGEVVLKPLGGKGGQGVIRIAKDAPGLE 176

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKA 243
           +L+E++  +   P+M+Q +LP++ +GDKRILL+NG+P+GA+NR P E D RSN+  GGKA
Sbjct: 177 ALLELVTSQEHLPVMMQQFLPEVINGDKRILLVNGEPLGAINRRPKEGDFRSNLALGGKA 236

Query: 244 ELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVA 303
           E TKLT  +++IC +I  +L+E GLFF GIDVIG  ++EINVTSPT IRE+       +A
Sbjct: 237 ETTKLTPKEIEICNQIKPALQEEGLFFVGIDVIGGMLSEINVTSPTGIREVESLMNVPLA 296

Query: 304 SLFWDGI 310
               D +
Sbjct: 297 DQVIDYL 303


>gi|82701351|ref|YP_410917.1| glutathione synthetase [Nitrosospira multiformis ATCC 25196]
 gi|82409416|gb|ABB73525.1| glutathione synthase [Nitrosospira multiformis ATCC 25196]
          Length = 316

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 121/312 (38%), Positives = 174/312 (55%), Gaps = 5/312 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
              A  ++H+ ++K ++DS+ AI  EA  RG+ +F      L  +        +PL L  
Sbjct: 1   MRFAFVLDHLDSIKTRKDSSVAIMREAAARGHTLFSMQQGDLAWQRGNTVGFARPLELTG 60

Query: 65  KKEQ---YYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFW 120
           +  Q   +Y + E + I L + D +L+R+DPPF+M YI STYLLE        ++N+   
Sbjct: 61  EDSQGRLWYRVDEPEEIPLQEFDAVLMRKDPPFDMEYIYSTYLLELAETRGAHVINSARA 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IR+  EK+ V +FSE    TL++R  + +  F  E  DII+KPL G GG  VFR+   D 
Sbjct: 121 IRDHNEKLAVAKFSEYAVETLVTRSESLLRHFLAEHDDIILKPLDGMGGASVFRVHREDH 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHA 239
           N   +IE L     + +M Q Y+ +I DGDKRILL+ G+PV     RIP   + R N++ 
Sbjct: 181 NIGVIIETLTHYGTKTIMAQRYIHEITDGDKRILLIAGEPVPYTLARIPKPGEFRGNLNV 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           G       L+  D +I + +G  L   GL   G+DVIGDY+TEINVTSPT +REI    G
Sbjct: 241 GATGIAQPLSPRDREIAEALGPVLFNEGLMLVGLDVIGDYLTEINVTSPTGMREISDQTG 300

Query: 300 ENVASLFWDGIE 311
            NVA++  D +E
Sbjct: 301 FNVAAMMVDALE 312


>gi|119713531|gb|ABL97584.1| glutathione synthetase [uncultured marine bacterium EB0_35D03]
          Length = 318

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 120/313 (38%), Positives = 196/313 (62%), Gaps = 3/313 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           MK+I  + + M+ I+++K K+DS+FA+ LEAQ RG+ I+ +  + ++    +++AN    
Sbjct: 1   MKQII-LGVLMDDIASIKPKKDSSFAMMLEAQRRGWIIYTFDSNDMFHLKGEVFANACKT 59

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPF 119
            L + +  +Y   E   + LS+ DV+ +R+DPPF+M YI +TYLLE+      L+VN P 
Sbjct: 60  KLKDSELDWYQCEEPITLPLSETDVVFMRKDPPFDMDYIYATYLLEQAELSGVLVVNKPS 119

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R++ EK+F   FS+ +P TL+S +  ++  F     ++++KPL G GG  ++++  GD
Sbjct: 120 SLRDANEKMFALNFSDFIPKTLVSSNNEKLIDFINSNNEVVVKPLDGMGGKDIYKLQKGD 179

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N   +++ +  +    +M Q +LP+I+ GDKRILL+NG+PV   + R+P++   + N+ 
Sbjct: 180 ANIKEVLQKITNQGKRFIMAQEFLPEIKYGDKRILLINGEPVDYALARMPAKGSFKGNLA 239

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AG K    +L+  D  +CK+I   L E+ L F G+DVIGDYITEINVTSPTCIRE+    
Sbjct: 240 AGAKGVGQELSDRDRFLCKQIAPMLIEKDLLFVGLDVIGDYITEINVTSPTCIRELDSEF 299

Query: 299 GENVASLFWDGIE 311
             N++S   D +E
Sbjct: 300 NLNISSSILDAVE 312


>gi|322509766|gb|ADX05220.1| gshB [Acinetobacter baumannii 1656-2]
          Length = 308

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 130/303 (42%), Positives = 189/303 (62%), Gaps = 2/303 (0%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           M+ I TV +K+DST A+   A  RG+++ +     LY+   K Y    PL + E    YY
Sbjct: 1   MDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLIAPLKVFEDYNHYY 60

Query: 71  SLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRNSPEKIF 129
            LGE+K   ++  DV+L+R+DPPF+M+++ +TY+LE+     + I+N P  +R+  EK+F
Sbjct: 61  ELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRDCNEKLF 120

Query: 130 VTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEML 189
            T+F EL  PTL++   + I  F  E  D+I+KPL G GG G+FR+     N  S +EML
Sbjct: 121 ATQFPELQVPTLVTSQQSLIREFITEHGDVIVKPLDGMGGMGIFRLYQDGVNIGSTLEML 180

Query: 190 FEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGGKAELTKL 248
            E    P+M Q Y+P+I +GDKRIL++NG+P+     RIP   + R N+ AGG  +   L
Sbjct: 181 TELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGLGQARPL 240

Query: 249 TKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWD 308
           T+ D  I  ++G  LRE+GL F G+DVIG+Y+TEINVTSPTCIREI    G ++A   +D
Sbjct: 241 TENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSIADDLFD 300

Query: 309 GIE 311
            +E
Sbjct: 301 VLE 303


>gi|121997726|ref|YP_001002513.1| glutathione synthetase [Halorhodospira halophila SL1]
 gi|121589131|gb|ABM61711.1| glutathione synthase [Halorhodospira halophila SL1]
          Length = 314

 Score =  272 bits (695), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 112/311 (36%), Positives = 179/311 (57%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I+ +K ++DST A+ LEAQ RGY+++++    LY          +PL++
Sbjct: 1   MSARLGVVMDPIAAIKPRKDSTLALLLEAQRRGYELWYFLATDLYADGGAACGRGRPLTV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
            +    +Y++GE + + L+++D IL+R+DPP +  YI++T LL         +VN P  +
Sbjct: 61  RDDVHDWYTVGEPRAMPLAELDTILMREDPPVDAGYISATQLLSLAEAQGVRVVNRPAAL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R++ EK+F   +  L P T ++ D   +  F  E    ++KPL   GG  +F +  GD N
Sbjct: 121 RDANEKLFALHWPHLCPATRVAADPALLRGFIAEQGKAVLKPLDAMGGASIFVLADGDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
            S ++E L +      M Q YLP+I +GDKR+L+  G+P    + RIP+  + R N+ AG
Sbjct: 181 TSVVLETLTDGGRRYAMAQEYLPRIDEGDKRVLVFGGEPFPHALARIPARGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E   +T+ +  +C  +  +LRERGL   G+D IG+ +TEINVTSPTC REI    G 
Sbjct: 241 GRGEAAPVTERERAVCAELAPTLRERGLELVGLDFIGERLTEINVTSPTCFREIDALCGV 300

Query: 301 NVASLFWDGIE 311
           N A  F+D +E
Sbjct: 301 NTAGAFFDHLE 311


>gi|294341551|emb|CAZ89968.1| Glutathione synthetase (Glutathione synthase) (GSH synthetase)
           (GSH-S) (GSHase) [Thiomonas sp. 3As]
          Length = 342

 Score =  271 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 113/333 (33%), Positives = 181/333 (54%), Gaps = 26/333 (7%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSK------------ 52
             +    + I++ K+ +D+TFA+  EAQ RG+ ++      L+ R               
Sbjct: 1   MQLLFIADPIASFKIYKDTTFAMMREAQARGHVLWVCEAADLHWRGGNSSTPTLATGGEE 60

Query: 53  -----IYANTQPLSLDEKK--EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLL 105
                + A  + + L        +Y + +++ + L ++D +L+R+DPPF+  Y  +T+LL
Sbjct: 61  AIAAPVTAVCRRIELTGATSGHDWYRVLDQRPLALREVDAVLMRKDPPFDSEYFYATHLL 120

Query: 106 EK-INPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPL 164
           ++       + N+P  +R+ PEK+ + EF + + PTL+SR   +I  FY E  D+I+KPL
Sbjct: 121 QQAEREGAAVFNSPRALRDHPEKLAILEFPQFITPTLVSRRAAEIKAFYGEHGDVILKPL 180

Query: 165 YGNGGTGVFRITLG-----DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGK 219
            G GGTG+FR+        D N + +IE L       +M Q ++P I  GDKR+L+++G+
Sbjct: 181 DGMGGTGIFRLRQQADGSPDPNLNVVIETLTAFGATTVMAQRFVPAIAQGDKRVLIIDGE 240

Query: 220 PVGAV-NRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGD 278
           PV     RIP   + R N+ AGG      L++ D  I + +G  L  RGL   GID+IGD
Sbjct: 241 PVPYCLARIPQGGETRGNLAAGGLGVAQPLSETDWAIARALGPVLAARGLLLVGIDIIGD 300

Query: 279 YITEINVTSPTCIREIHRNGGENVASLFWDGIE 311
            +TEINVTSPTC +EI +  G +VA+ F   +E
Sbjct: 301 KLTEINVTSPTCFQEITQQSGCDVAARFISALE 333


>gi|225024438|ref|ZP_03713630.1| hypothetical protein EIKCOROL_01313 [Eikenella corrodens ATCC
           23834]
 gi|224942819|gb|EEG24028.1| hypothetical protein EIKCOROL_01313 [Eikenella corrodens ATCC
           23834]
          Length = 316

 Score =  271 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 107/313 (34%), Positives = 174/313 (55%), Gaps = 6/313 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            NI    + ++T K  +D+T+A+  EA  RG+++ H    +L ++  ++     P     
Sbjct: 1   MNILFIADPLATFKTYKDTTYAMMREAAKRGHKLHHTLAGELSVQKGQVVVQAAPFQFIG 60

Query: 63  --DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPF 119
             D+   +++    +    L++ D +++R DPPF+M Y+ ST LL         + NN  
Sbjct: 61  AKDDHDHEWFKPQGKVQAALTEFDAVIMRTDPPFDMQYLYSTQLLTLAEQQGAKVFNNGQ 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R+  EK+ +  FS    PTL+S     +  F  E  DII+KPL G GG G+FR+T  D
Sbjct: 121 AMRDFNEKLAILNFSRFTAPTLVSTRAADVRAFLAEHGDIIVKPLDGMGGMGIFRLTERD 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N  S++E L       +M Q Y+P+I  GDKRIL+++G+ V   + RIP + + R N+ 
Sbjct: 181 PNIGSILETLMRLDTRTIMAQRYIPEIVHGDKRILVIDGEVVPFALARIPQQGETRGNLA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+    +L+  D +I + +   L+ RG+   G+DVIG ++TE+NVTSPT  +EI +  
Sbjct: 241 AGGRGVAQELSARDREIAETLAPELKRRGILLAGLDVIGSHLTEVNVTSPTGFQEITKQK 300

Query: 299 GENVASLFWDGIE 311
           G +VA+ F D +E
Sbjct: 301 GFDVAAKFIDSVE 313


>gi|167892633|ref|ZP_02480035.1| glutathione synthetase [Burkholderia pseudomallei 7894]
          Length = 307

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 116/307 (37%), Positives = 181/307 (58%), Gaps = 7/307 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + +   K+ +DST+A+  EA  RG+ ++   P+QL    + + A+ + +++  
Sbjct: 1   MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWTGAGVEADVRRVTIAG 60

Query: 63  ---DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
              D  ++++Y     +   L     IL+R+DPPF+M Y+TST+LLE        + N P
Sbjct: 61  DTADLHRDRWYEAAARESRALPSFGAILMRKDPPFDMEYVTSTWLLELAERAGARVFNKP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IR+  EK+ + EF++ + P+L++RD  ++  F+ E  D+I+KPL G GG GVFR+   
Sbjct: 121 QTIRDHSEKLAIGEFAQFVAPSLVTRDAARLRAFHAEHGDVILKPLDGMGGMGVFRVKAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
             N  S+IEML       +M+Q ++P+I+ GDKRILL++G+PV   + RIP   + R N+
Sbjct: 181 GMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEPVPYSLARIPQGSEVRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG      LT+ D +I   +G  L  RGL   G+DVIGD++TE+NVTSPTC REI   
Sbjct: 241 AAGGVGVAQPLTERDREIAAALGPVLAARGLLLVGLDVIGDWLTEVNVTSPTCFREIMEQ 300

Query: 298 GGENVAS 304
            G +VA 
Sbjct: 301 TGFDVAG 307


>gi|92112192|ref|YP_572120.1| glutathione synthase [Chromohalobacter salexigens DSM 3043]
 gi|91795282|gb|ABE57421.1| glutathione synthase [Chromohalobacter salexigens DSM 3043]
          Length = 317

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 116/312 (37%), Positives = 185/312 (59%), Gaps = 2/312 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
           +   + + M+ I+ +  K+D+T A+   AQ RG+ +++  P+ LY+   +     + L  
Sbjct: 4   RALKLGVVMDPIADIAYKKDTTLAMLWAAQERGWSLYYLEPEDLYLEGGRAMGRMRALEA 63

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
               E +Y L   +   L+++DVIL+RQDPP + H++ + +LL        L+VN    +
Sbjct: 64  YRDPEAWYRLDVSRAAPLAELDVILMRQDPPVDGHFLNAVHLLGFAEREGVLVVNPTQAL 123

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
             S EK+F  +F + +PP+++S     +  F+    D+I+KPL G GG+G+F IT   RN
Sbjct: 124 LTSNEKLFAQQFPQCIPPSVVSCHDGVLRDFHARHGDVILKPLDGMGGSGIFHITPEGRN 183

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
             S+IE L E+    +M Q YLP+I+ GD RILL++G+PV   + RIPS  + R N+ AG
Sbjct: 184 LGSVIEQLTERGTRQIMAQRYLPEIQAGDTRILLIDGEPVPYGLARIPSAGETRGNLAAG 243

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+ E  +LT  D  + +++  ++ E+GL F G+DVIGDYITEINVTSPTC+REI    G 
Sbjct: 244 GRGEARELTDRDHWLIEQVKPAILEKGLIFVGLDVIGDYITEINVTSPTCVREIDAQRGT 303

Query: 301 NVASLFWDGIEK 312
           ++     + I +
Sbjct: 304 DIGGQLMEAIAR 315


>gi|163857144|ref|YP_001631442.1| glutathione synthetase [Bordetella petrii DSM 12804]
 gi|163260872|emb|CAP43174.1| glutathione synthetase [Bordetella petrii]
          Length = 318

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 111/315 (35%), Positives = 177/315 (56%), Gaps = 7/315 (2%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD- 63
            ++   ++ +  +K  +DS+ A+      RG+ +       L++    + A    + L  
Sbjct: 1   MHVLFVIDPLPRLKAYKDSSVAMMRALVARGHTLSVAMQGDLFIDAGVVQARATGIELVA 60

Query: 64  ----EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNP 118
                    +   G  + + LS+   +L+R+DPPF+M Y+ ST++LE        + N+ 
Sbjct: 61  DADLHGHHWWRDTGAAQDVPLSRFGAVLMRKDPPFDMEYVYSTHMLEYAQAQGARVFNDA 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             IRN PEK+ +TEF+EL  PTL++RD+ +I  F+   +D+I+KPL G GGTG+FR+   
Sbjct: 121 AAIRNHPEKLAITEFAELAAPTLVTRDMARIKAFHAHHQDVIVKPLDGMGGTGIFRLQAA 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
           + N ++++E L E     +M Q Y+P+I  GDKRILL+ G+ V   + RIP   + R N+
Sbjct: 181 EPNLNAILETLTEDGTRTIMAQRYIPEIVQGDKRILLIGGEAVPYSLARIPLAGETRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG+     L++ D +I   +   L  RGL   G+DVIGDY+TE+NVTSPTC  EI   
Sbjct: 241 AAGGRGVAQPLSERDREIAAIVAPRLAARGLLLVGLDVIGDYVTEVNVTSPTCFVEIAEQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA +F   +E+
Sbjct: 301 TGFDVAGMFAQALER 315


>gi|113477620|ref|YP_723681.1| glutathione synthetase [Trichodesmium erythraeum IMS101]
 gi|110168668|gb|ABG53208.1| glutathione synthase [Trichodesmium erythraeum IMS101]
          Length = 324

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 120/316 (37%), Positives = 193/316 (61%), Gaps = 10/316 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
              A  ++ I  +    D++ A+   +Q  G++++    +QL + +SK  A TQ ++L  
Sbjct: 1   MKFAFIIDPIDRLNPVHDTSVALMEASQELGHEVWITEMNQLTVINSKTCAKTQRVNLSP 60

Query: 65  KK---------EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKI-NPETLI 114
            +           +YSL +  +  L  MD + +RQDPP  + Y+ +TYLL+ I   +TL+
Sbjct: 61  IQRRENHWVASNPWYSLEKTVLEPLELMDAVFMRQDPPVTIPYLYATYLLDYINPQKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+P  +R + EKI+  +F++++P T++S+D   I  F    +  ++KPL G  G G+  
Sbjct: 121 INSPQGLRAANEKIYALQFTKVIPETIVSQDKQVIRDFLDSQEAAVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +   D+NF+SLIE+  ++  EP+MIQSYLP  ++GDKRI++LNGKP+GAVNRIP+  D R
Sbjct: 181 LEPTDKNFNSLIEISTKQGQEPVMIQSYLPAAKEGDKRIIILNGKPIGAVNRIPTGQDFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+   T++T+ + +IC+++   L E GL+F GIDVIG Y+TEINVTSPT IREI
Sbjct: 241 GNMAVGGRVAQTEITQKEYEICEQLAPKLIEDGLYFVGIDVIGGYLTEINVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGI 310
                 N+     + +
Sbjct: 301 DFFDHVNLGKKVIEWV 316


>gi|296137252|ref|YP_003644494.1| glutathione synthetase [Thiomonas intermedia K12]
 gi|295797374|gb|ADG32164.1| glutathione synthetase [Thiomonas intermedia K12]
          Length = 342

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 115/333 (34%), Positives = 181/333 (54%), Gaps = 26/333 (7%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSK------------ 52
             +    + I++ K+ +D+TFA+  EAQ RG+ ++      L+ R               
Sbjct: 1   MQLLFIADPIASFKIYKDTTFAMMREAQARGHVLWVCEAADLHWRGGNSSTPALATGGEE 60

Query: 53  -----IYANTQPLSLDEKK--EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLL 105
                + A  + + L        +Y + +++ + L ++D +L+R+DPPF+  Y  +T+LL
Sbjct: 61  AIAAPVTAVCRRIELTGATSGHDWYRVLDQRPLALREVDAVLMRKDPPFDSEYFYATHLL 120

Query: 106 EK-INPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPL 164
           ++       + N+P  +R+ PEK+ + EF + + PTL+SR   +I  FY E  DII+KPL
Sbjct: 121 QQAEREGAAVFNSPRALRDHPEKLAILEFPQFITPTLVSRRAAEIKAFYGEHGDIILKPL 180

Query: 165 YGNGGTGVFRITLG-----DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGK 219
            G GGTG+FR+        D N + +IE L       +M Q ++P I  GDKR+L+++G+
Sbjct: 181 DGMGGTGIFRLRQQADGSPDPNLNVVIETLSAFGATTVMAQRFVPAIAQGDKRVLIIDGE 240

Query: 220 PVGAV-NRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGD 278
           PV     RIP   + R N+ AGG      LT+ D  I + +G  L  RGL   GID+IGD
Sbjct: 241 PVPYCLARIPQGGETRGNLAAGGLGVAQPLTETDWAIARALGPVLAARGLLLVGIDIIGD 300

Query: 279 YITEINVTSPTCIREIHRNGGENVASLFWDGIE 311
            +TEINVTSPTC +EI +  G +VA+ F   +E
Sbjct: 301 KLTEINVTSPTCFQEITQQSGCDVAARFISALE 333


>gi|17231351|ref|NP_487899.1| glutathione synthetase [Nostoc sp. PCC 7120]
 gi|20141389|sp|P45480|GSHB_ANASP RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|17132993|dbj|BAB75558.1| glutathione synthetase [Nostoc sp. PCC 7120]
          Length = 324

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 117/321 (36%), Positives = 192/321 (59%), Gaps = 10/321 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ-----P 59
             +A  ++ I  +    D++ A+   AQ+ G++++    + L + DSK +A  Q     P
Sbjct: 1   MKLAFIIDPIHQLDPCHDTSVALMEAAQILGHEVWVTQANWLSVVDSKAWAILQQVELVP 60

Query: 60  LSLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKI-NPETLI 114
           + L + +      +Y+L       L  MD + +R DPP N  Y+ +TY+L+ +   +TL+
Sbjct: 61  VQLIDGRWVAASPWYTLNTRSFSSLETMDAVFMRTDPPVNDAYLYATYVLDYVDQRKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +NNP  IR + EK++  +F++ +P T++S D   I +F       ++KPL    G G+  
Sbjct: 121 INNPNGIRGANEKMYALQFTKAIPETIVSADKDFIRQFVEAKGATVLKPLGNKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+S++E+  ++   P+M+Q+YLP+ ++GDKRI+LLNG+P+GA+NR+ S  D R
Sbjct: 181 LQAGDRNFNSIVELSTQQGRLPVMVQTYLPEAKEGDKRIILLNGEPIGALNRLASGSDFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
           +N+  GG    T++T  + +IC +I  +LR+ GL F GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 NNMATGGTVAKTEITPREEEICSQIAANLRQDGLIFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIEKIKE 315
            R  G  +A      +EK  +
Sbjct: 301 DRLDGTRLAHQVIQWVEKNLQ 321


>gi|261855131|ref|YP_003262414.1| glutathione synthetase [Halothiobacillus neapolitanus c2]
 gi|261835600|gb|ACX95367.1| glutathione synthetase [Halothiobacillus neapolitanus c2]
          Length = 321

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 111/308 (36%), Positives = 180/308 (58%), Gaps = 4/308 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I I M+ I+ +K  +D++FA+ L AQ RG+ +F+  PD LY    +  +    +++ +
Sbjct: 1   MKIGILMDPIAGIKPYKDTSFALLLAAQSRGWSVFYLEPDWLYAEQGRPRSRMHAITVFD 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIRN 123
           +   ++ LG  +  DL+++D+I+ RQDPP  ++Y   T LL    +   L+ N P  +R 
Sbjct: 61  RNTDWFELGPAQTFDLNELDIIIQRQDPPVTLNYHYVTALLALAESEGVLVANRPNALRA 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
           + EK+    + +L PPTL++RD  Q+  F      I++KPL   GG+ +F+I  GD N +
Sbjct: 121 ANEKLLAQHYPDLCPPTLVTRDPAQLRDFLSLHGHIVLKPLDAMGGSSIFQIQAGDLNTA 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGGK 242
            +IE +       +M Q +LP +R+GD+RILL+NG+PV   + R+P   + R+N+ AGG+
Sbjct: 181 VIIETMLAHGL--IMAQKFLPAVREGDRRILLINGEPVDHALLRVPQADEFRANLAAGGR 238

Query: 243 AELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENV 302
            ++  L   D +I  R+G  +   G +F G+DVIGDY+TE+NVTSPTC REI      + 
Sbjct: 239 GQVVPLRARDREIAARVGPDMAAAGFWFVGLDVIGDYLTEVNVTSPTCAREIDAVCHNDP 298

Query: 303 ASLFWDGI 310
           A    D +
Sbjct: 299 AGQLLDFL 306


>gi|332991912|gb|AEF01967.1| glutathione synthetase [Alteromonas sp. SN2]
          Length = 317

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 110/316 (34%), Positives = 191/316 (60%), Gaps = 2/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
               + + M+ I+ +K  +D++ A+ LEAQ RG  + ++    +++ + K     + +++
Sbjct: 1   MHYTLGVIMDPIAVIKPHKDTSLAMMLEAQRRGATVLYFELKDIFINNGKPMGLARTITV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
            ++   +Y+LGEE  + L  +DV+L+R+DPPF+  ++ +T++L    +   L+VNNP  +
Sbjct: 61  RDQATDFYTLGEEHTVSLGDIDVLLMRKDPPFDSEFLYATHILSLAQDEGALVVNNPQAL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F + F E +P TL++ +   I  F+ + +DII KPL G GG  +FR+     N
Sbjct: 121 RDYNEKLFTSLFPEHIPNTLVTNNQKLIRDFHAKHQDIICKPLDGMGGASIFRVKPDGNN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              +IE L       +M+Q YLPQI+DGDKRIL+++G+ +     R+P++ + R N+ AG
Sbjct: 181 LGVIIETLTNLGKRYMMVQEYLPQIKDGDKRILIVDGEVIPYCLARLPTKGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G     ++++ D  + + +  +LRE  + F G+DVIG+ ITEIN+TSPTC+REI  +   
Sbjct: 241 GTGRPQEISETDRALAEAVAPTLRENNILFVGLDVIGEKITEINITSPTCVREIEGHYNI 300

Query: 301 NVASLFWDGIEKIKET 316
           N+ +  +D IEK   T
Sbjct: 301 NIMASLFDAIEKRLTT 316


>gi|254417317|ref|ZP_05031060.1| glutathione synthase [Microcoleus chthonoplastes PCC 7420]
 gi|196175855|gb|EDX70876.1| glutathione synthase [Microcoleus chthonoplastes PCC 7420]
          Length = 322

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 112/322 (34%), Positives = 192/322 (59%), Gaps = 10/322 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
              A  ++ +S +    D++ A+   AQ  G+ ++     +L + +++ +AN + + L  
Sbjct: 1   MKFAFIIDPLSKLNPSHDTSVALMEAAQALGHDVWITQAQKLTVVNNQAWANLEKVQLTP 60

Query: 65  KK---------EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPE-TLI 114
            +         E++Y++ +   + L  MD + +R DPP  + Y+ +TY+L+ INP+ T +
Sbjct: 61  AELVEGRWVVSERWYAISDTVSLPLEDMDAVFMRTDPPVTIPYLYATYILDYINPKKTQV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N P  +R + EK++  +F E++P T++S+D   I +F  +    ++KPL G  G G+  
Sbjct: 121 INTPTGLRRANEKMYALQFKEVIPETIVSQDKLTIQKFVEKQGAAVLKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+SL+E+  +   EP+M+Q+YLP  ++GDKRI+LLNG P+GAVNRIP+  + R
Sbjct: 181 LEAGDRNFNSLVEISTKWGYEPVMVQTYLPAAKEGDKRIILLNGDPIGAVNRIPTGSEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+   T++T  +  IC  +   L++ GL+F GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 GNMAVGGRVAATEITSQEQKICALLKPQLQQDGLYFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIEKIKET 316
            +  G  +       +E  + +
Sbjct: 301 DQLNGTCLGKDVIAWVENPRNS 322


>gi|237749216|ref|ZP_04579696.1| glutathione synthetase [Oxalobacter formigenes OXCC13]
 gi|229380578|gb|EEO30669.1| glutathione synthetase [Oxalobacter formigenes OXCC13]
          Length = 313

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 115/311 (36%), Positives = 181/311 (58%), Gaps = 3/311 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A   + +   K+++DSTFA+  EA  RG++I  +      +   ++      + L  
Sbjct: 1   MELAFFADPLGEFKLEKDSTFAMMAEAAKRGHRIVAFGQGDFALDRDEVTVRASHIELTG 60

Query: 65  KKE-QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIR 122
           K++  ++ + E +   L   D +++R+DPPF++ Y+ STY LE        + N P  IR
Sbjct: 61  KEDASWFRVLETRNRRLESFDAVIVRKDPPFDVEYVNSTYFLELAEKKGAKVFNRPEAIR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+ + +F E + PTL++ D  ++  F+ E  D+I+KPL   GGTGVFR+ +   N 
Sbjct: 121 SHNEKLTIAQFPEFIVPTLVTSDENRLRAFHREHHDVILKPLNAMGGTGVFRVRVDGINL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAGG 241
            ++IE L E   + +M+Q Y+P+I  GDKR+LL+NG+ V   + RIP   + R N+ AGG
Sbjct: 181 GAIIETLTENGHKTVMMQKYIPEIARGDKRVLLINGQLVPFALARIPQNGEIRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
                 L+K D  I + +   L ERGLF  G+D+IGD++TE+NVTSPTC REI    G +
Sbjct: 241 LGRAQPLSKRDRQIAETLAPVLAERGLFLVGLDIIGDWLTEVNVTSPTCFREITSQTGFD 300

Query: 302 VASLFWDGIEK 312
           VA +F D +EK
Sbjct: 301 VARMFVDELEK 311


>gi|301630040|ref|XP_002944139.1| PREDICTED: glutathione synthetase-like [Xenopus (Silurana)
           tropicalis]
          Length = 329

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 117/315 (37%), Positives = 183/315 (58%), Gaps = 3/315 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYM-RDSKIYANTQPLSLD 63
             +    + + + +  +D+TFA+  EAQ RG+Q+    P ++   R  ++ A  + + L 
Sbjct: 1   MKLLFVADPLESFQTYKDTTFAMMREAQRRGHQLAACEPQEMAWQRGGRVCAQVRDIVLT 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
              + +++    +   L+  D +L+R+DPPF+  Y  +T+LLE+       + N P  +R
Sbjct: 61  GDTQTWFNAQPVRTAALADFDAVLMRKDPPFDSEYFYATHLLEQAEREGAKVFNQPRALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           + PEK+ V EF EL+ PTL++R+   I  F+   +DII+KPL G GG G+FR+     N 
Sbjct: 121 DHPEKLAVMEFPELIGPTLVTRNAQDIRAFHATHQDIILKPLDGMGGMGIFRVGPDGLNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
            S+IE L +   + +M+Q +LP I  GDKR+L++ GKPV     RIP   + R N+ AGG
Sbjct: 181 GSIIETLNQGGAQSVMVQKFLPAIAQGDKRVLIIGGKPVPYCLARIPQGGEVRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           K     L+  D +I + +G  L  RGL   G+DVIGD +TEINVTSPTC +E+H   G +
Sbjct: 241 KGVAQPLSARDREIAETLGPILLARGLLLAGVDVIGDCVTEINVTSPTCFQELHDQTGCD 300

Query: 302 VASLFWDGIEKIKET 316
           VA+LF D +E+   +
Sbjct: 301 VAALFLDALEQALAS 315


>gi|86606855|ref|YP_475618.1| glutathione synthetase [Synechococcus sp. JA-3-3Ab]
 gi|86555397|gb|ABD00355.1| glutathione synthase [Synechococcus sp. JA-3-3Ab]
          Length = 315

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 118/311 (37%), Positives = 188/311 (60%), Gaps = 1/311 (0%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A  ++ +S ++V  D++ A+    Q RG++IF      LY    + + + + + LD 
Sbjct: 1   MQVAFIVDPLSQLQVGHDTSVALMEALQKRGHRIFCLGLADLYWDQGETWGSVEEIVLDL 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIRN 123
             + +Y + E +++ LSQM  + +R+DPP +  Y+ +TYLL+      TL++N+P  IR+
Sbjct: 61  GADPWYEVKERRLLPLSQMQAVWMRKDPPVDAAYLYATYLLDHLSPRRTLVLNHPAGIRS 120

Query: 124 SPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFS 183
           + EK++   F E +P T +S     + +F  ++   ++KPL G GG G+ R+  GD N +
Sbjct: 121 ANEKLYALRFKEWIPRTCVSSSKALLRQFVEQVGQAVLKPLGGKGGEGILRVNAGDPNLN 180

Query: 184 SLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKA 243
           SLIE+  +    P+M+Q YLPQ   GDKRILLL G+P+GAVNRIP E D R N+ AGG+ 
Sbjct: 181 SLIELSTQFGRLPVMVQEYLPQAAAGDKRILLLEGEPLGAVNRIPGEGDFRGNVAAGGRV 240

Query: 244 ELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVA 303
           E T++ + +  +C  +   LR+  L+F GIDVIG+ +TEINVTSPT +REI +  G ++A
Sbjct: 241 EKTEIAEKERALCAALAPVLRQEKLYFVGIDVIGERLTEINVTSPTMLREICQLEGVDLA 300

Query: 304 SLFWDGIEKIK 314
                 +EK  
Sbjct: 301 DQVAQWLEKKV 311


>gi|217969009|ref|YP_002354243.1| glutathione synthetase [Thauera sp. MZ1T]
 gi|217506336|gb|ACK53347.1| glutathione synthetase [Thauera sp. MZ1T]
          Length = 318

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 112/315 (35%), Positives = 178/315 (56%), Gaps = 3/315 (0%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ-P 59
           M +   +   ++ +  +K  +DS+ A+   A  RG++++      L  R+  +       
Sbjct: 1   MTRKLKLLFILDPLEGLKAYKDSSIAMMRAAARRGHEVWALQRAGLTWREGVVVGTGCVA 60

Query: 60  LSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNP 118
           L++ +    +Y  GE + + L+  D +L+RQDPPF+  Y+T+T+LLE+       + N+P
Sbjct: 61  LAVCDDDAAWYRAGEAQALPLAAFDAVLMRQDPPFDFEYVTATWLLERAAQAGVRVFNDP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             +R+  EKI +TEF +    TL++RD   I  F  E+ D+I+KPL G GG+ +FR+   
Sbjct: 121 RAVRDHSEKIAITEFPQFTATTLVARDPADIHAFIDELGDVILKPLDGMGGSQIFRVRAD 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNI 237
           D N + ++E L       +M Q YLPQI DGDKR+L++ G+ V   + RIP   + R N+
Sbjct: 181 DPNRNVIVETLAHDGTRTIMAQRYLPQIVDGDKRVLIIGGEVVPFALARIPRAGETRGNL 240

Query: 238 HAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRN 297
            AGG+     LT  + +I   +  +L  RGL   G+DVIG ++TEINVTSPTC+ EI   
Sbjct: 241 AAGGRGVAMALTAREREIAGFLAPTLWARGLLIVGLDVIGGHLTEINVTSPTCMVEIAAQ 300

Query: 298 GGENVASLFWDGIEK 312
            G +VA L  D +E+
Sbjct: 301 QGFDVAGLVIDKLER 315


>gi|325982974|ref|YP_004295376.1| glutathione synthetase [Nitrosomonas sp. AL212]
 gi|325532493|gb|ADZ27214.1| glutathione synthetase [Nitrosomonas sp. AL212]
          Length = 328

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 117/317 (36%), Positives = 183/317 (57%), Gaps = 5/317 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A  ++ + ++K  +D+++A+  EA  R +Q++      + + +  +   ++ LSL  
Sbjct: 1   MKLAFIIDPLDSIKTHKDTSYALICEAIARNHQVWVLYQHDIALINHVVTGFSRALSLTN 60

Query: 65  K---KEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKIN-PETLIVNNPFW 120
                  +Y + +     L + D++L+R+DPPF+M YI STYLLE        ++N+P  
Sbjct: 61  PSSADGLWYKISDISATPLHEFDIVLMRKDPPFDMEYIYSTYLLELAEAQGAWVINSPRS 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IR+  EK  +T+F + + PTL++     I  F +  +DII+KPL G GG  VFRI L D 
Sbjct: 121 IRDYNEKFAITQFPQFITPTLVTSQAHLIREFLVIHQDIILKPLDGMGGANVFRIHLADY 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHA 239
           N S ++EML       +M+Q ++P+I  GDKRILL+ GK V   + RIP   + R N+ A
Sbjct: 181 NISVILEMLTHYGTRTIMVQRFIPEIAQGDKRILLIAGKAVPFALARIPKLGETRGNLAA 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG      L+  D DI   +G  L + GL   G+DVIGDY+TEINVTSPT ++EI +  G
Sbjct: 241 GGTGTTQPLSTRDKDIADSLGPQLVKNGLMLVGLDVIGDYLTEINVTSPTGMQEITQQTG 300

Query: 300 ENVASLFWDGIEKIKET 316
            NVA++  D IE+  ++
Sbjct: 301 FNVAAMMLDAIEENFKS 317


>gi|555916|gb|AAA85527.1| glutathione synthetase, gsh-II [Nostoc sp. PCC 7120]
          Length = 324

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 117/321 (36%), Positives = 191/321 (59%), Gaps = 10/321 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ-----P 59
             +A  ++ I  +    D++ A+   AQ+ G++++    + L + DSK  A  Q     P
Sbjct: 1   MKLAFIIDPIHQLDPCHDTSVALMEAAQILGHEVWVTQANWLSVVDSKACAILQQVELVP 60

Query: 60  LSLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKI-NPETLI 114
           + L + +      +Y+L       L  MD + +R DPP N  Y+ +TY+L+ +   +TL+
Sbjct: 61  VQLIDGRWVAASPWYTLNTRSFSSLETMDAVFMRTDPPVNDAYLYATYVLDYVDQRKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +NNP  IR + EK++  +F++ +P T++S D   I +F       ++KPL    G G+  
Sbjct: 121 INNPNGIRGANEKMYALQFTKAIPETIVSADKDFIRQFVEAKGATVLKPLGNKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+S++E+  ++   P+M+Q+YLP+ ++GDKRI+LLNG+P+GA+NR+ S  D R
Sbjct: 181 LQAGDRNFNSIVELSTQQGRLPVMVQTYLPEAKEGDKRIILLNGEPIGALNRLASGSDFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
           +N+  GG    T++T  + +IC +I  +LR+ GL F GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 NNMATGGTVAKTEITPREEEICSQIAANLRQDGLIFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIEKIKE 315
            R  G  +A      +EK  +
Sbjct: 301 DRLDGTRLAHQVIQWVEKNLQ 321


>gi|159028595|emb|CAO90597.1| gshB [Microcystis aeruginosa PCC 7806]
          Length = 327

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 111/317 (35%), Positives = 185/317 (58%), Gaps = 10/317 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ-----P 59
             +A  ++ I  +    D++ AI   +Q+ G++++  +   L     K +A        P
Sbjct: 1   MKLAFIIDPIEYLDPGHDTSVAIMEASQLLGHEVWMTSITDLSAIAGKAWAKLTKVELVP 60

Query: 60  LSLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPE-TLI 114
           + L +       Q+Y   E     L   D + +R+DPP  + Y+ +TYLL+ I+P+ T +
Sbjct: 61  VELKDNHWVAVSQWYQRQETVFTCLENFDFVWMRKDPPVTITYLYATYLLDLIDPKKTQV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+   +R++ EK++   F+++MP T++S+D   I  F  +    ++KPL G  G G+  
Sbjct: 121 INSTRGLRHANEKLYTIHFAQVMPATIVSQDKATIREFVNQKGAAVMKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           ++  DRN +S+IE+  +   EP+MIQ YLP  ++GDKRI++LNG+P+GAVNRIP+  + R
Sbjct: 181 LSPEDRNLNSMIEISTKWGQEPVMIQDYLPAAKEGDKRIIVLNGEPIGAVNRIPTGSEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+   T+++  +L+IC  +   LRE GL+F G+DVIG Y+TE+NVTSPT IREI
Sbjct: 241 GNMAVGGRVAKTEISDRELEICATLAPKLREDGLYFVGLDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIE 311
            R    ++       +E
Sbjct: 301 DRLNNVSLGQQVIQWLE 317


>gi|37523251|ref|NP_926628.1| glutathione synthetase [Gloeobacter violaceus PCC 7421]
 gi|39931339|sp|Q7NF44|GSHB_GLOVI RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|35214254|dbj|BAC91623.1| glutathione synthetase [Gloeobacter violaceus PCC 7421]
          Length = 324

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 108/312 (34%), Positives = 167/312 (53%), Gaps = 6/312 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             I   ++ + T+K   D++ A+   A  RG+ ++      L +   +  A  + L++  
Sbjct: 1   MKILFIVDPLETLKPGHDTSVALMQAAARRGHSVWAAEVGDLQVHHHRAAAQVRTLTIHP 60

Query: 65  KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPE------TLIVNNP 118
            +  +Y++       LS+ DVI +R+DPP    Y+ +T +L+ +N        T ++N P
Sbjct: 61  GRTPFYTVEAVGFYPLSEADVIWMRKDPPVTSAYLWATQVLDLVNAGRGDGRTTFVLNRP 120

Query: 119 FWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLG 178
             +RN  EK++   F +L+P T +      I  F       +IKPL G GG G+F +   
Sbjct: 121 SGLRNDNEKLYALHFPDLVPETRVCTHRQDILDFVDIHGRAVIKPLDGKGGEGIFLLARA 180

Query: 179 DRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIH 238
           DRN +++IE         +M+Q YL + R GDKRI+LL G+P+GA+ R+P E D R N+ 
Sbjct: 181 DRNLNAIIEASTAYGTRHVMVQRYLEESRQGDKRIVLLAGEPIGALLRVPREDDVRGNMA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+   T LT+ D +IC+ +G  L   G +F GIDVIG Y+TEINVTSPT I EI    
Sbjct: 241 AGGRVVKTTLTERDREICRVVGPRLVADGHYFVGIDVIGAYLTEINVTSPTGICEIDVLD 300

Query: 299 GENVASLFWDGI 310
           G  +     D +
Sbjct: 301 GVVLEDEIVDWL 312


>gi|166363468|ref|YP_001655741.1| glutathione synthetase [Microcystis aeruginosa NIES-843]
 gi|166085841|dbj|BAG00549.1| glutathione synthetase [Microcystis aeruginosa NIES-843]
          Length = 326

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 110/317 (34%), Positives = 183/317 (57%), Gaps = 10/317 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQ-----P 59
             +A  ++ I  +    D++ AI   +Q+ G++++  +   L     K +A        P
Sbjct: 1   MKLAFIIDPIEYLDPGHDTSVAIMEASQLLGHEVWMTSITDLSAIAGKAWAKLTKIELVP 60

Query: 60  LSLDEKKE----QYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKI-NPETLI 114
           + L +       Q+Y   E     L   D + +R+DPP  + Y+ +TYLL+ I   +T +
Sbjct: 61  VELKDNHWEAVSQWYQRQETVFTCLENFDFVWMRKDPPVTIAYLYATYLLDLIDPQKTQV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +N+   +R++ EK++   F+++MP T++S+D   I  F  +    ++KPL G  G G+  
Sbjct: 121 INSTRGLRHANEKLYTIHFAQVMPATIVSQDKATIREFVNQKGAAVMKPLGGKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           ++  DRN +S+IE+  +   EP+MIQ YLP  ++GDKRI++LNG+P+GAVNRIP+  + R
Sbjct: 181 LSPEDRNLNSMIEISTKWGQEPVMIQDYLPAAKEGDKRIIVLNGEPIGAVNRIPTGSEFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
            N+  GG+   T+++  +L+IC  +   LRE GL+F G+DVIG Y+TE+NVTSPT IREI
Sbjct: 241 GNMAVGGRVAKTEISDQELEICATLAPKLREDGLYFVGLDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIE 311
            R    ++       +E
Sbjct: 301 DRLNNVSLGQQVIKWLE 317


>gi|270157209|ref|ZP_06185866.1| glutathione synthase [Legionella longbeachae D-4968]
 gi|289164392|ref|YP_003454530.1| glutathione synthetase [Legionella longbeachae NSW150]
 gi|269989234|gb|EEZ95488.1| glutathione synthase [Legionella longbeachae D-4968]
 gi|288857565|emb|CBJ11403.1| glutathione synthetase [Legionella longbeachae NSW150]
          Length = 320

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 115/311 (36%), Positives = 186/311 (59%), Gaps = 4/311 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
            ++ I ++ I  +K  +D+T A   +AQ  G+    +T + L+ ++ + +A    LS+ +
Sbjct: 1   MHLGILLDPIDQLKPYKDTTLAFLKKAQNMGWSCVVFTQEDLFCKEGRAFAQVYDLSMGD 60

Query: 65  -KKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWIR 122
             +  +  +       L  +D+IL+R+DPPFN  YI +TY+L+       L+ NNP  +R
Sbjct: 61  LYRNDWAKITNLGERPLGSLDIILMRKDPPFNTEYIYTTYILDLAEREGVLVANNPQALR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           ++ EK F   F +  P TL+S++I ++  F+ E K +I KPL G GG  VF +    +N 
Sbjct: 121 DANEKFFTLNFPQCCPTTLVSKNIKRLKAFWEEHKQVIFKPLEGMGGNSVFHVEEQGKNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIR-DGDKRILLLNGKPVGA-VNRIPSEVDNRSNIHAG 240
           + ++E+L +   + ++ Q Y+ +I+  GDKRILL+NG+P+   + RIP+E D R N+ AG
Sbjct: 181 AVILEVLTKNQTQTIIAQRYVDEIKTAGDKRILLINGQPIPYALARIPAEGDLRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
            + E+  +T  D  IC +I  +L+ +GL+F GIDVIGDY+TEINVTSPTC+REI      
Sbjct: 241 ARGEVVPITTRDQWICDQIAPTLKAKGLYFVGIDVIGDYLTEINVTSPTCLREIEAETKL 300

Query: 301 NVASLFWDGIE 311
           +VA  F   +E
Sbjct: 301 DVAGDFLRCLE 311


>gi|75908057|ref|YP_322353.1| glutathione synthetase [Anabaena variabilis ATCC 29413]
 gi|75701782|gb|ABA21458.1| glutathione synthase [Anabaena variabilis ATCC 29413]
          Length = 324

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 115/321 (35%), Positives = 189/321 (58%), Gaps = 10/321 (3%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDE 64
             +A  ++ I  +    D++ A+   AQ+ G++++    + L + DSK +A  Q + L  
Sbjct: 1   MKLAFIIDPIHQLDPCHDTSVALMEAAQILGHEVWVTQANWLSVVDSKAWAILQQVELVP 60

Query: 65  KK---------EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKI-NPETLI 114
            +           +Y L    +  L  MD + +R DPP N  Y+ +TY+L+ +   +TL+
Sbjct: 61  VQLVDGRWVAANPWYKLNARSLNSLETMDAVFMRTDPPVNDAYLYATYVLDYVDQQKTLV 120

Query: 115 VNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFR 174
           +NNP  IR + EK++  +F++ +P T++S D   I +F       I+KPL    G G+  
Sbjct: 121 INNPNGIRKANEKMYALQFTKAIPETIVSADKDFIRQFVEAKGATILKPLGNKAGEGILF 180

Query: 175 ITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNR 234
           +  GDRNF+S++E+  ++   P+M+Q+YL + ++GDKRI+LLNG+P+GA+NR+ S  D R
Sbjct: 181 LQAGDRNFNSIVELSTQQGRLPVMVQTYLSEAKEGDKRIILLNGEPIGALNRLASGSDFR 240

Query: 235 SNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREI 294
           +N+  GG    T++T  + +IC  +  +LR+ GL F GIDVIG Y+TE+NVTSPT IREI
Sbjct: 241 NNMATGGTVAKTEITPREQEICGDLAANLRQDGLVFVGIDVIGGYLTEVNVTSPTGIREI 300

Query: 295 HRNGGENVASLFWDGIEKIKE 315
            R  G  +A+     +EK  +
Sbjct: 301 DRLDGTRLANQVIQWVEKNLQ 321


>gi|27904964|ref|NP_778090.1| glutathione synthetase [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|29611723|sp|P59495|GSHB_BUCBP RecName: Full=Glutathione synthetase; AltName: Full=GSH synthetase;
           Short=GSH-S; Short=GSHase; AltName: Full=Glutathione
           synthase
 gi|27904362|gb|AAO27195.1| glutathione synthetase [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 324

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 130/316 (41%), Positives = 204/316 (64%), Gaps = 3/316 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              N+ I M+ IS++ +K+DS+FAI LEAQ R Y+I++     LY++D+K Y++T+ L +
Sbjct: 1   MTINLGIIMDPISSINIKKDSSFAILLEAQNRKYKIYYMELKDLYLKDNKPYSHTKLLRI 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWI 121
              K+Q+++L ++K + LS +DVIL+R++PP N  YI +TY+LE+     + I+N P  +
Sbjct: 61  KNNKKQWFTLEQQKDVSLSNLDVILMRKNPPINRAYIYATYILEQAERNGSYIINKPSSL 120

Query: 122 RNSPEK-IFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           R+  EK    T F + +P TLI+ + T+I  F    KDIIIKPL+G  G  +FRI   D 
Sbjct: 121 RSYNEKLFTTTHFPQYIPKTLITSNSTKIHNFIKTYKDIIIKPLHGMAGLSIFRIKEHDP 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPV-GAVNRIPSEVDNRSNIHA 239
           N S +IE + +    P + Q+Y+  I+ GDKRIL++NG P    + RIP + +NR N+  
Sbjct: 181 NTSVIIETMTKYETIPCISQNYITDIQKGDKRILIINGIPFPWCLARIPKKHENRGNLSI 240

Query: 240 GGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGG 299
           GG     KL+K D +I   I  +L ++G+FF GID+IG  +TEIN+TSPTCI+EI ++ G
Sbjct: 241 GGYGNTQKLSKNDWEIALSIAPTLNKKGIFFAGIDIIGTKLTEINITSPTCIQEIEQDTG 300

Query: 300 ENVASLFWDGIEKIKE 315
            +++++  D +EK  +
Sbjct: 301 ISISTIILDNLEKNLK 316


>gi|329119076|ref|ZP_08247768.1| glutathione synthase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464815|gb|EGF11108.1| glutathione synthase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 316

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 102/313 (32%), Positives = 174/313 (55%), Gaps = 6/313 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL-- 62
            +I    + ++  K  +D+T+++  EA  RG+ +FH    +L ++ +++YA   P     
Sbjct: 1   MDILFIADPMAGFKTYKDTTYSMMREAVRRGHALFHTLAGELLVKGNQVYAQAAPFDFLG 60

Query: 63  --DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPF 119
             D+    ++         L+  D +++R DPPF+M Y+ +T LL    +    + N+  
Sbjct: 61  AKDDNDHAWFRAASPVRTALTAFDAVIMRTDPPFDMQYLYATQLLTLAASHGANVFNSGQ 120

Query: 120 WIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
            +R+  EK+ V  F +  PPT+++     +  F  E  DII+KPL G GG G+FR+T  D
Sbjct: 121 SMRDFNEKLAVLNFPQFAPPTIVTTRAADVRAFLAEHGDIIVKPLDGMGGMGIFRLTAHD 180

Query: 180 RNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGA-VNRIPSEVDNRSNIH 238
            N  S++E L       +M Q YLP I  GDKR+L++ G+ V   + RIP + + R N+ 
Sbjct: 181 PNIGSILETLMRLETRTIMAQRYLPDIVKGDKRVLVIGGEVVPYALARIPQQGETRGNLA 240

Query: 239 AGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNG 298
           AGG+    +L++ D +I + +   L+ RG+   G+D+IG+++TE+NVTSPT  +EI +  
Sbjct: 241 AGGRGVAQELSERDREIAQTLAPELKRRGILLAGLDIIGEHLTEVNVTSPTGFQEITQQK 300

Query: 299 GENVASLFWDGIE 311
           G +V + F D +E
Sbjct: 301 GYDVPARFIDALE 313


>gi|192361999|ref|YP_001980605.1| glutathione synthase [Cellvibrio japonicus Ueda107]
 gi|190688164|gb|ACE85842.1| glutathione synthase [Cellvibrio japonicus Ueda107]
          Length = 317

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 184/311 (59%), Gaps = 2/311 (0%)

Query: 3   KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL 62
              ++ + M+ I+ +   +D+T A+ L AQ RG+ + +     LY++  +  A  + LS+
Sbjct: 1   MAISLGVVMDPIADITFYKDTTLALLLAAQARGWSLHYMEQGDLYIQQGEARAGMRSLSV 60

Query: 63  DEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLE-KINPETLIVNNPFWI 121
            +  + ++ LG      L  +DVIL+R+DPPF+  YI STY+LE       L+VN+P  +
Sbjct: 61  ADNADGWFELGARADCKLGDLDVILMRKDPPFDNEYIYSTYILEAAQQQGALVVNDPRSL 120

Query: 122 RNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRN 181
           R+  EK+F T+F +  PP L+SRD+ ++  F+    D+I KPL G GG+ +FR    D N
Sbjct: 121 RDCNEKLFATQFPQCCPPLLVSRDMVRLREFHQSQGDVIFKPLDGMGGSRIFRCRADDPN 180

Query: 182 FSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAG 240
              ++E L +   +  M Q Y+P I  GDKRIL+++G+ V     RIP++ + R N+ AG
Sbjct: 181 VGVILETLTDFGRQLTMAQRYIPAISQGDKRILVVDGEAVPYCLARIPAQGETRGNLAAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           G+     L++ D  I  ++  SL+ RGL F G+DVIGDY+TEINVTSPTC REI +  G 
Sbjct: 241 GRGVAQPLSERDQWIVSQVAPSLKARGLMFVGLDVIGDYLTEINVTSPTCAREIDKAYGT 300

Query: 301 NVASLFWDGIE 311
            + +   D IE
Sbjct: 301 GIGARLMDAIE 311


>gi|253997629|ref|YP_003049693.1| glutathione synthetase [Methylotenera mobilis JLW8]
 gi|253984308|gb|ACT49166.1| glutathione synthetase [Methylotenera mobilis JLW8]
          Length = 311

 Score =  265 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 110/310 (35%), Positives = 178/310 (57%), Gaps = 5/310 (1%)

Query: 5   RNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSL