RPSBLAST alignment for GI: 254780696 and conserved domain: pfam02955

>gnl|CDD|111803 pfam02955, GSH-S_ATP, Prokaryotic glutathione synthetase, ATP-grasp domain. Length = 176
 Score =  278 bits (714), Expect = 1e-75
 Identities = 99/176 (56%), Positives = 129/176 (73%)

Query: 126 EKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSL 185
           EK+F   F EL+PPTL++RD  +I  F  E  DII+KPL G GG GVFRI   D N + +
Sbjct: 1   EKLFTLSFPELIPPTLVTRDKEEIRAFLEEHGDIILKPLDGMGGAGVFRIKKDDPNLNVI 60

Query: 186 IEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAEL 245
           +E L +    P+M Q YLP+I++GDKRILL+NG+P+GA+ RIP+E + R N+ AGG+ E 
Sbjct: 61  LETLTQYGRRPVMAQRYLPEIKEGDKRILLVNGEPIGALARIPAEGEFRGNLAAGGRGEA 120

Query: 246 TKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           T+LT+ D +IC+ IG  L+ERGLFF G+DVIGDY+TEINVTSPT IREI R  G +
Sbjct: 121 TELTERDREICETIGPKLKERGLFFVGLDVIGDYLTEINVTSPTGIREIERLTGVS 176