RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780696|ref|YP_003065109.1| glutathione synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (316 letters)



>gnl|CDD|111803 pfam02955, GSH-S_ATP, Prokaryotic glutathione synthetase, ATP-grasp
           domain. 
          Length = 176

 Score =  278 bits (714), Expect = 1e-75
 Identities = 99/176 (56%), Positives = 129/176 (73%)

Query: 126 EKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSL 185
           EK+F   F EL+PPTL++RD  +I  F  E  DII+KPL G GG GVFRI   D N + +
Sbjct: 1   EKLFTLSFPELIPPTLVTRDKEEIRAFLEEHGDIILKPLDGMGGAGVFRIKKDDPNLNVI 60

Query: 186 IEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAEL 245
           +E L +    P+M Q YLP+I++GDKRILL+NG+P+GA+ RIP+E + R N+ AGG+ E 
Sbjct: 61  LETLTQYGRRPVMAQRYLPEIKEGDKRILLVNGEPIGALARIPAEGEFRGNLAAGGRGEA 120

Query: 246 TKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           T+LT+ D +IC+ IG  L+ERGLFF G+DVIGDY+TEINVTSPT IREI R  G +
Sbjct: 121 TELTERDREICETIGPKLKERGLFFVGLDVIGDYLTEINVTSPTGIREIERLTGVS 176


>gnl|CDD|30538 COG0189, RimK, Glutathione synthase/Ribosomal protein S6
           modification enzyme (glutaminyl transferase) [Coenzyme
           metabolism / Translation, ribosomal structure and
           biogenesis].
          Length = 318

 Score =  231 bits (589), Expect = 2e-61
 Identities = 109/324 (33%), Positives = 178/324 (54%), Gaps = 23/324 (7%)

Query: 6   NIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEK 65
            +AI M+ I +  + +D+TFA+   AQ RG+++       L +R  +I A  + + + E 
Sbjct: 2   KLAILMDPIES-DIYKDTTFALMEAAQKRGHELAILDDGDLSLRKGEIKALARLVEVGEV 60

Query: 66  KEQYYSLGEEK-IIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPE-TLIVNNPFWIRN 123
              +Y L EE+ +  L ++DVI++R+DPPF+      T  L     +   ++N+P  IR 
Sbjct: 61  IGLHYELIEEEDLSLLDELDVIIMRKDPPFDFA----TRFLRLAERKGVPVINDPQSIRR 116

Query: 124 SPEKIFVTEFSEL----MPPTLISRDITQITRFYLEMK--DIIIKPLYGNGGTGVFRITL 177
              K++ T+        +PPTLI+RD  +   F  E     +++KPL G+GG GVF +  
Sbjct: 117 CRNKLYTTQLLAKAGIPVPPTLITRDPDEAAEFVAEHLGFPVVLKPLDGSGGRGVFLVED 176

Query: 178 GDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVG--AVNRIPSEVDNRS 235
            D    SL+E L ++  + +++Q Y+P+ +  D+R+L+  G+ V   A+ RIP+  D RS
Sbjct: 177 ADPELLSLLETLTQEGRKLIIVQEYIPKAKRDDRRVLVGGGEVVAIYALARIPASGDFRS 236

Query: 236 NIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVI----GDYITEINVTSPTCI 291
           N+  GG+AE  +LT+ + ++  +   +L   GL   G+D+I    G Y+TE+NV SPT  
Sbjct: 237 NLARGGRAEPCELTEEEEELAVKAAPAL---GLGLVGVDIIEDKDGLYVTEVNV-SPTGK 292

Query: 292 REIHRNGGENVASLFWDGIEKIKE 315
            EI R  G N+A L  D IEK   
Sbjct: 293 GEIERVTGVNIAGLIIDAIEKFVR 316


>gnl|CDD|145876 pfam02951, GSH-S_N, Prokaryotic glutathione synthetase, N-terminal
           domain. 
          Length = 119

 Score =  179 bits (457), Expect = 9e-46
 Identities = 52/118 (44%), Positives = 82/118 (69%), Gaps = 1/118 (0%)

Query: 6   NIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEK 65
            +A  M+ I ++ +K+DSTFA+ LEAQ RG+++F+Y P  L +R  ++ A  +PL++ + 
Sbjct: 2   KLAFVMDPIESINIKKDSTFAMMLEAQRRGHELFYYEPGDLSLRGGRVRARARPLTVRDD 61

Query: 66  KEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPE-TLIVNNPFWIR 122
              +Y LGEE+ + L+  DVIL+R+DPPF+M YI +TYLLE+     TL+VN+P  +R
Sbjct: 62  PGDWYELGEEERLPLADFDVILMRKDPPFDMEYIYATYLLERAERAGTLVVNDPQSLR 119


>gnl|CDD|145680 pfam02655, ATP-grasp_3, ATP-grasp domain.  No functional
           information or experimental verification of function is
           known in this family. This family appears to be an
           ATP-grasp domain (Pers. obs. A Bateman).
          Length = 160

 Score = 37.0 bits (86), Expect = 0.007
 Identities = 35/152 (23%), Positives = 61/152 (40%), Gaps = 31/152 (20%)

Query: 146 ITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQ 205
                    E K  I+KP  G GG GV  +  G  +             E ++IQ ++  
Sbjct: 21  TLSAEEPTEEEKKYIVKPRDGCGGEGVRFVENGREDEEF---------IENVIIQEFIEG 71

Query: 206 -------IRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAE-LTKLTKIDLDICK 257
                  + DG+K + L       +VNR   +      ++AG      T+L +   ++ +
Sbjct: 72  EPLSVSLLSDGEKALPL-------SVNRQLIDNAGSGFVYAGNLTPSRTELKEELEELAE 124

Query: 258 RIGESLRE-RGLFFTGIDVI----GDYITEIN 284
            + E+L   RG    G+D++    G Y+ E+N
Sbjct: 125 EVVEALPGLRGYV--GVDLVLTDNGPYVIEVN 154


>gnl|CDD|39608 KOG4407, KOG4407, KOG4407, Predicted Rho GTPase-activating protein
            [General function prediction only].
          Length = 1973

 Score = 32.9 bits (74), Expect = 0.11
 Identities = 12/35 (34%), Positives = 19/35 (54%)

Query: 183  SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLN 217
            SSL++M   K PEPL+     P   + +++   LN
Sbjct: 1235 SSLLKMFLRKLPEPLLTDKLYPFFIEANRKSTHLN 1269


>gnl|CDD|32413 COG2232, COG2232, Predicted ATP-dependent carboligase related to
           biotin carboxylase [General function prediction only].
          Length = 389

 Score = 32.7 bits (74), Expect = 0.13
 Identities = 47/278 (16%), Positives = 88/278 (31%), Gaps = 55/278 (19%)

Query: 28  ALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVIL 87
           A +     Y + +Y P  L               L     ++ +L E+K+I+        
Sbjct: 28  ASKLGFEVYSVQYYDPADLPGDAISYLRERPGELLG----RFENLDEQKLIE------AA 77

Query: 88  IRQDPPFNMHYITSTYLLEKINPETLIVNNPFW---IRNSPEKIFVT-----EFSELMPP 139
                  +   I  +        E L  +         N PE   V      +F   +  
Sbjct: 78  EDLAEDVDAPIIPFSGF------EALRTSGELGCEVAGNEPEVKVVEASNKLKFYRKLEV 131

Query: 140 T-LISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLM 198
             +      +I       K +I+KP+ G G  G+  +   D           E  P   +
Sbjct: 132 LGMPEPSEKKIEPLEEGEKTLILKPVSGAG--GLVELVKFDE----------EDPPPGFI 179

Query: 199 IQSYLPQ-------IRDG-DKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTK 250
            Q ++         I +G D   L +N + +  +    S+   + N+      E+ +   
Sbjct: 180 FQEFIEGRPVSVSFISNGSDALTLAVNDQIIDGLRGEYSQFVYKGNLTPFPYEEVEEAE- 238

Query: 251 IDLDICKRIGESLRERGLFFTGIDVI----GDYITEIN 284
               + + + E L   G    G+D +    G Y+ E+N
Sbjct: 239 ---RLAEELVEELGLVGS--NGVDFVLNDKGPYVIEVN 271


>gnl|CDD|63864 cd04395, RhoGAP_ARHGAP21, RhoGAP_ARHGAP21: RhoGAP (GTPase-activator
           protein [GAP] for Rho-like small GTPases) domain of
           ArhGAP21-like proteins. ArhGAP21 is a multi-domain
           protein, containing RhoGAP, PH and PDZ domains, and is
           believed to play a role in the organization of the
           cell-cell junction complex. It has been shown to
           function as a GAP of Cdc42 and RhoA, and to interact
           with alpha-catenin and Arf6. Small GTPases cluster into
           distinct families, and all act as molecular switches,
           active in their GTP-bound form but inactive when
           GDP-bound. The Rho family of GTPases activates effectors
           involved in a wide variety of developmental processes,
           including regulation of cytoskeleton formation, cell
           proliferation and the JNK signaling pathway. GTPases
           generally have a low intrinsic GTPase hydrolytic
           activity but there are family-specific groups of GAPs
           that enhance the rate of GTP hydrolysis by several
           orders of magnitude..
          Length = 196

 Score = 30.2 bits (68), Expect = 0.84
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 6/48 (12%)

Query: 170 TGVFRITLGDRNF------SSLIEMLFEKYPEPLMIQSYLPQIRDGDK 211
            G F I L D  +      SSL++  F K PEPL      P   + ++
Sbjct: 58  RGGFDIDLQDPRWRDVNVVSSLLKSFFRKLPEPLFTNELYPDFIEANR 105


>gnl|CDD|146948 pfam04556, DpnII, DpnII restriction endonuclease.  Members of this
           family are type II restriction enzymes (EC:3.1.21.4).
           They recognize the double-stranded unmethylated sequence
           GATC and cleave before G-1.
           http://rebase.neb.com/rebase/enz/DpnII.html.
          Length = 284

 Score = 29.6 bits (67), Expect = 1.3
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 177 LGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNG 218
           +G  +  +    LF+KYPE L +   L  IRD  K  LL NG
Sbjct: 44  IGKDDIDNEFRELFKKYPEVLKVLPILLAIRDKKKDKLLANG 85


>gnl|CDD|30788 COG0439, AccC, Biotin carboxylase [Lipid metabolism].
          Length = 449

 Score = 28.3 bits (63), Expect = 2.6
 Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 4/30 (13%)

Query: 158 DIIIKPLYGNGGTGVFRITLGDRNFSSLIE 187
            +I+K   G GG G+  +    RN   L  
Sbjct: 154 PVIVKAAAGGGGRGMRVV----RNEEELEA 179


>gnl|CDD|37745 KOG2534, KOG2534, KOG2534, DNA polymerase IV (family X)
           [Replication, recombination and repair].
          Length = 353

 Score = 28.4 bits (63), Expect = 3.0
 Identities = 13/60 (21%), Positives = 23/60 (38%), Gaps = 7/60 (11%)

Query: 34  RGYQIFHYTPDQLYMRDSKIYANTQPLSLDE-------KKEQYYSLGEEKIIDLSQMDVI 86
            G+ +  +T  + + RD + YA  +  SLDE        +       E+ I     +  I
Sbjct: 287 FGFALLGWTGSKEFNRDLRRYATHKGFSLDEHALFDLTVRIFLPVESEKDIFRYLGLKYI 346


>gnl|CDD|38496 KOG3286, KOG3286, KOG3286, Selenoprotein T [General function
           prediction only].
          Length = 226

 Score = 26.9 bits (59), Expect = 6.9
 Identities = 34/136 (25%), Positives = 50/136 (36%), Gaps = 21/136 (15%)

Query: 67  EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIV--NNPFWIRNS 124
           EQY    +EK      +D+      PP    Y+     + K+    LI+   NPF     
Sbjct: 87  EQYKKFLKEK---YPGLDIEGANYPPPAWKRYLAKVVSVVKMGVIGLIIGGKNPF----- 138

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNG--GTGVFRITLGDRNF 182
                  EF  L  P++      Q  +FY  M    +  +  +    TG F ITL D   
Sbjct: 139 -------EFIGLGYPSIWQH--AQANKFYSCMMVFFLGNMLESQLISTGAFEITLNDEPV 189

Query: 183 SSLIEMLFEKYPEPLM 198
            S +E      P+ L+
Sbjct: 190 WSKLESGRLPSPQELV 205


>gnl|CDD|143597 cd07573, CPA, N-carbamoylputrescine amidohydrolase (CPA) (class 11
           nitrilases).  CPA (EC 3.5.1.53, also known as
           N-carbamoylputrescine amidase and carbamoylputrescine
           hydrolase) converts N-carbamoylputrescine to putrescine,
           a step in polyamine biosynthesis in plants and bacteria.
           This subgroup includes Arabidopsis thaliana CPA, also
           known as nitrilase-like 1 (NLP1), and Pseudomonas
           aeruginosa AguB. This subgroup belongs to a larger
           nitrilase superfamily comprised of nitrile- or
           amide-hydrolyzing enzymes and amide-condensing enzymes,
           which depend on a Glu-Lys-Cys catalytic triad. This
           superfamily has been classified in the literature based
           on global and structure based sequence analysis into
           thirteen different enzyme classes (referred to as 1-13),
           this subgroup corresponds to class 11. Members of this
           superfamily generally form homomeric complexes, the
           basic building block of which is a homodimer; P.
           aeruginosa AugB is a homohexamer, Arabidopsis thaliana
           NLP1 is a homooctomer.
          Length = 284

 Score = 26.8 bits (60), Expect = 8.1
 Identities = 12/21 (57%), Positives = 13/21 (61%)

Query: 217 NGKPVGAVNRIPSEVDNRSNI 237
           NG PV AVNR+  E D  S I
Sbjct: 205 NGVPVAAVNRVGVEGDPGSGI 225


>gnl|CDD|37366 KOG2155, KOG2155, KOG2155, Tubulin-tyrosine ligase-related protein
           [Posttranslational modification, protein turnover,
           chaperones].
          Length = 631

 Score = 26.5 bits (58), Expect = 8.9
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 94  FNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSE 135
           F++ YI    LL  I P T  V N FWIR S  +  ++ F +
Sbjct: 463 FDLRYIV---LLRSIAPLTAYVYNRFWIRFSNNEFSLSNFED 501


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.320    0.140    0.403 

Gapped
Lambda     K      H
   0.267   0.0760    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 3,955,356
Number of extensions: 218555
Number of successful extensions: 490
Number of sequences better than 10.0: 1
Number of HSP's gapped: 481
Number of HSP's successfully gapped: 22
Length of query: 316
Length of database: 6,263,737
Length adjustment: 94
Effective length of query: 222
Effective length of database: 4,232,491
Effective search space: 939613002
Effective search space used: 939613002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (25.7 bits)