RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780696|ref|YP_003065109.1| glutathione synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (316 letters)



>gnl|CDD|179971 PRK05246, PRK05246, glutathione synthetase; Provisional.
          Length = 316

 Score =  499 bits (1287), Expect = e-142
 Identities = 160/309 (51%), Positives = 219/309 (70%), Gaps = 2/309 (0%)

Query: 6   NIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEK 65
            +A QM+ I ++ +K+DSTFA+ LEAQ RG+++F+Y PD L +R  ++ A  +PL++ + 
Sbjct: 3   KVAFQMDPIESINIKKDSTFAMMLEAQRRGHELFYYEPDDLSLRGGEVVARARPLTVRDD 62

Query: 66  KEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPE-TLIVNNPFWIRNS 124
           K  +Y LGEE+ + L+  DVIL+R+DPPF+M YI +TYLLE+     TL+VN P  +R++
Sbjct: 63  KGDWYELGEEQRLPLADFDVILMRKDPPFDMEYIYATYLLERAERPGTLVVNKPQSLRDA 122

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
            EK+F   F ELMPPTL++RD  +I  F  E  DII+KPL G GG G+FR+   D N  S
Sbjct: 123 NEKLFTLWFPELMPPTLVTRDKAEIRAFRAEHGDIILKPLDGMGGAGIFRVKADDPNLGS 182

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVG-AVNRIPSEVDNRSNIHAGGKA 243
           ++E L E   EP+M Q YLP+I++GDKRILL++G+PVG A+ RIP+  + R N+ AGG+ 
Sbjct: 183 ILETLTEHGREPVMAQRYLPEIKEGDKRILLVDGEPVGYALARIPAGGETRGNLAAGGRG 242

Query: 244 ELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVA 303
           E T LT+ D +IC  IG  L+ERGL F GIDVIGDY+TEINVTSPT IREI R  G ++A
Sbjct: 243 EATPLTERDREICAAIGPELKERGLIFVGIDVIGDYLTEINVTSPTGIREIERLTGVDIA 302

Query: 304 SLFWDGIEK 312
            + WD IE 
Sbjct: 303 GMLWDAIEA 311


>gnl|CDD|130447 TIGR01380, glut_syn, glutathione synthetase, prokaryotic.  This
           model was built using glutathione synthetases found in
           Gram-negative bacteria. This gene does not appear to be
           present in genomes of Gram-positive bacteria.
           Glutathione synthetase has an ATP-binding domain in the
           COOH terminus and catalyzes the second step in the
           glutathione biosynthesis pathway: ATP +
           gamma-L-glutamyl-L-cysteine + glycine = ADP + phosphate
           + glutathione. Glutathione is a tripeptide that
           functions as a reductant in many cellular reactions.
          Length = 312

 Score =  366 bits (941), Expect = e-102
 Identities = 142/309 (45%), Positives = 220/309 (71%), Gaps = 2/309 (0%)

Query: 7   IAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKK 66
           +A QM+ I ++ + +D+TFA+  EAQ RG+++F Y P  L + + +++A  +P+ +   K
Sbjct: 3   VAFQMDPIESINIGKDTTFALMEEAQKRGHELFFYEPGDLSVVNGEVFARARPVRVGPNK 62

Query: 67  EQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPE-TLIVNNPFWIRNSP 125
           + +Y+LGE+  + L ++D +L+R+DPPF+M YI +TYLLE  +P  TL++N+P  +R++ 
Sbjct: 63  QDWYTLGEKVRLSLGELDAVLMRKDPPFDMEYIYATYLLELADPTGTLVINSPQGLRDAN 122

Query: 126 EKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSL 185
           EK+F  +F +++PPTL++RD  +I  F  E  DI++KPL G GG G+FR+  GD NF+S+
Sbjct: 123 EKLFTLQFPKVIPPTLVTRDKAEIRAFLAEHGDIVLKPLDGMGGEGIFRLDPGDPNFNSI 182

Query: 186 IEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVG-AVNRIPSEVDNRSNIHAGGKAE 244
           +E + ++  EP+M Q YLP+I++GDKRILL++G+P+G AV RIP+  + R N+  GG+ E
Sbjct: 183 LETMTQRGREPVMAQRYLPEIKEGDKRILLIDGEPIGAAVARIPAGGEFRGNLAVGGRGE 242

Query: 245 LTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVAS 304
            T+L++ D +IC  +   L+ RGL F GIDVIG Y+TE+NVTSPT IREI R  G N+A 
Sbjct: 243 ATELSERDREICADVAPELKRRGLLFVGIDVIGGYLTEVNVTSPTGIREIDRQKGVNIAG 302

Query: 305 LFWDGIEKI 313
           + WD IEK 
Sbjct: 303 MLWDAIEKA 311


>gnl|CDD|183536 PRK12458, PRK12458, glutathione synthetase; Provisional.
          Length = 338

 Score =  196 bits (499), Expect = 1e-50
 Identities = 103/334 (30%), Positives = 164/334 (49%), Gaps = 39/334 (11%)

Query: 11  MNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY 70
           +N   T +   D+T  +A EA  RG+++ + TP  L +RD +  A         K ++Y 
Sbjct: 1   VNPWETEEE-TDTTLRLAHEAVNRGHEVAYTTPGDLTIRDDEALAFCAVTK---KGKKYK 56

Query: 71  SLG-----------EEKIIDLSQMDVILIRQDPPFN------MHYITSTYLLEKINPETL 113
                         +++ + L+  DVI +R +PP +         +   +         L
Sbjct: 57  KPENFLSFLKKAEFKKERLPLAGFDVIFLRANPPLDPLARNWADSVGIAFGRLAARDGVL 116

Query: 114 IVNNPFWIRNSPEKIFVTEFSE-LMPPTLISRDITQITRFYLEMKD--IIIKPLYGNGGT 170
           +VN+P  +R +  K++   F E + P T ISR+   I  F  E     +I+KPL G+GG 
Sbjct: 117 VVNDPDGLRIANNKLYFQSFPEEVRPTTHISRNKEYIREFLEESPGDKMILKPLQGSGGQ 176

Query: 171 GVFRITLGDR-NFSSLIEMLF-EKYPEPLMIQSYLPQIRDGDKRILLLNGKP------VG 222
           GVF I    + N + ++E    + Y   ++ Q YLP   +GD RILLLNG+P        
Sbjct: 177 GVFLIEKSAQSNLNQILEFYSGDGY---VIAQEYLPGAEEGDVRILLLNGEPLERDGHYA 233

Query: 223 AVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITE 282
           A+ R+P+  D RSN+HAGG      LTK +L++C+ I   L   GLFF G+D++GD + E
Sbjct: 234 AMRRVPAGGDVRSNVHAGGSVVKHTLTKEELELCEAIRPKLVRDGLFFVGLDIVGDKLVE 293

Query: 283 INVTSPTCIREIHRNGGENVASLFWDGIEKIKET 316
           +NV SP  +  I++    +    F + I +  E 
Sbjct: 294 VNVFSPGGLTRINKLNKID----FVEDIIEALER 323


>gnl|CDD|162031 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK family.  This
           family, related to bacterial glutathione synthetases,
           contains at least two different alpha-L-glutamate
           ligases. One is RimK, as in E. coli, which adds
           additional Glu residues to the native Glu-Glu C-terminus
           of ribosomal protein S6, but not to Lys-Glu mutants.
           Most species with a member of this subfamily lack an S6
           homolog ending in Glu-Glu, however. Members in
           Methanococcus jannaschii act instead as a
           tetrahydromethanopterin:alpha-l-glutamate ligase
           (MJ0620) and a gamma-F420-2:alpha-l-glutamate ligase
           (MJ1001).
          Length = 277

 Score = 65.4 bits (160), Expect = 2e-11
 Identities = 49/221 (22%), Positives = 100/221 (45%), Gaps = 25/221 (11%)

Query: 80  LSQMDVILIRQDPPFNMHY-ITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSEL-- 136
           L+++DV+++R     +M   +     LE +      +N+   I N+ +K   ++      
Sbjct: 46  LAELDVVIVR---IVSMFRGLAVARYLESLGVPV--INSSDAILNAGDKFLTSQLLAKAG 100

Query: 137 --MPPTLISRDITQITRFYLEMK-DIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKY 193
              P T ++    +  +   E+   +++KP++G+ G  V      D+  +  +   FE+ 
Sbjct: 101 LPQPRTGLAGSPEEALKLIEEIGFPVVLKPVFGSWGRLVSLAR--DKQAAETLLEHFEQL 158

Query: 194 PEPL---MIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTK 250
             P     +Q Y+ +    D R+ ++  + + A+ RI S    R+N+  GGKAE   LT+
Sbjct: 159 NGPQNLFYVQEYIKKPGGRDIRVFVVGDEVIAAIYRITSG-HWRTNLARGGKAEPCPLTE 217

Query: 251 IDLDICKRIGESLRERGLFFTGIDVI-----GDYITEINVT 286
              ++  +  ++L   GL   GID++     G  + E+N  
Sbjct: 218 EIEELAIKAAKAL---GLDVVGIDLLESEDRGLLVNEVNPN 255


>gnl|CDD|117020 pfam08443, RimK, RimK-like ATP-grasp domain.  This ATP-grasp domain
           is found in the ribosomal S6 modification enzyme RimK.
          Length = 190

 Score = 63.2 bits (154), Expect = 9e-11
 Identities = 41/155 (26%), Positives = 84/155 (54%), Gaps = 15/155 (9%)

Query: 138 PPTLISRDITQITRFYLEMKD--IIIKPLYGNGGTGVFRITLGDRNFSSLIEML--FEKY 193
           P T ++       +F  ++K   +++K ++G+ G GVF       +  SL ++L  F+  
Sbjct: 19  PNTGLAWSPEDAEKFIEQIKGFPVVVKSVFGSQGIGVFLA----EDEQSLEQLLEAFKWL 74

Query: 194 PEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDL 253
              +++Q ++ +  + D R L++ G+ VGA++R  +E D R+N+H GG AE  +L++ + 
Sbjct: 75  KNQILVQEFIAEAGNRDIRCLVVGGEVVGAIHRQSNEGDFRTNLHRGGVAEPYQLSQEEE 134

Query: 254 DICKRIGESLRERGLFFTGIDVI----GDYITEIN 284
           +I  +  +++   GL   G+D+     G  + E+N
Sbjct: 135 EIAIKAAQAM---GLDVLGVDIFRSKRGLLVCEVN 166


>gnl|CDD|182468 PRK10446, PRK10446, ribosomal protein S6 modification protein;
           Provisional.
          Length = 300

 Score = 48.7 bits (116), Expect = 2e-06
 Identities = 32/120 (26%), Positives = 60/120 (50%), Gaps = 9/120 (7%)

Query: 197 LMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDIC 256
           +++Q Y+ + +  D R L++  + V A+ R   E D RSN+H GG A +  +T  + +I 
Sbjct: 174 ILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASITPQEREIA 233

Query: 257 KRIGESLRERGLFFTGIDVI----GDYITEINVTSPTCIREIHRNGGENVASLFWDGIEK 312
            +   ++    L   G+D++    G  + E+N  SP  +  I +  G ++A      IE+
Sbjct: 234 IKAARTM---ALDVAGVDILRANRGPLVMEVN-ASPG-LEGIEKTTGIDIAGKMIRWIER 288


>gnl|CDD|184454 PRK14016, PRK14016, cyanophycin synthetase; Provisional.
          Length = 727

 Score = 42.5 bits (101), Expect = 1e-04
 Identities = 33/119 (27%), Positives = 46/119 (38%), Gaps = 38/119 (31%)

Query: 159 IIIKPLYGNGGTGVFRITLGDR-----------NFSSLIEMLFEKYPEPLMIQSYLPQIR 207
           +++KPL GN G GV  + +  R             SS +  + E+Y            I 
Sbjct: 252 VVVKPLDGNHGRGVT-VNITTREEIEAAYAVASKESSDV--IVERY------------IP 296

Query: 208 DGDKRILLLNGKPVGAVNRIPSEV--DNRSNIHA----------GGKAELTKLTKIDLD 254
             D R+L++ GK V A  R P  V  D +  I             G+     LTKI LD
Sbjct: 297 GKDHRLLVVGGKLVAAARREPPHVIGDGKHTIRELIEIVNQDPRRGEGHEKPLTKIKLD 355


>gnl|CDD|131199 TIGR02144, LysX_arch, Lysine biosynthesis enzyme LysX.  The family
           of proteins found in this equivalog include the
           characterized LysX from Thermus thermophilus which is
           part of a well-organized lysine biosynthesis gene
           cluster. LysX is believed to carry out an ATP-dependent
           acylation of the amino group of alpha-aminoadipate in
           the prokaryotic version of the fungal AAA lysine
           biosynthesis pathway. No species having a sequence in
           this equivalog contains the elements of the more common
           diaminopimelate lysine biosythesis pathway, and none has
           been shown to be a lysine auxotroph. These sequences
           have mainly recieved the name of the related enzyme,
           "ribosomal protein S6 modification protein RimK". RimK
           has been characterized in E. coli, and acts by
           ATP-dependent condensation of S6 with glutamate
           residues.
          Length = 280

 Score = 41.6 bits (98), Expect = 3e-04
 Identities = 53/224 (23%), Positives = 91/224 (40%), Gaps = 26/224 (11%)

Query: 75  EKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFS 134
           E+  +L  +DV +IR        Y  S  LLE +      +N+   I    +KIF     
Sbjct: 40  ERPKELEDVDVAIIRCVSQSRALY--SARLLEALGVPV--INSSHVIEACGDKIFTY--L 93

Query: 135 EL------MPPTLISRDITQITRFYLEMK-DIIIKPLYGNGGTGVFRITLGDRNFSSLI- 186
           +L       P T ++ D     +    +   +++KP+ G+ G  V  I   D   S L  
Sbjct: 94  KLAKAGVPTPRTYLAFDREAALKLAEALGYPVVLKPVIGSWGRLVALIRDKDELESLLEH 153

Query: 187 -EMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAEL 245
            E+L     +   IQ Y+      D R+ ++  + + A+ R  +    R+N   GGKAE 
Sbjct: 154 KEVLGGSQHKLFYIQEYI-NKPGRDIRVFVIGDEAIAAIYRYSNHW--RTNTARGGKAEP 210

Query: 246 TKLTKIDLDICKRIGESLRERGLFFTGIDVI-----GDYITEIN 284
             L +   ++  +  E++   G     ID+      G  + E+N
Sbjct: 211 CPLDEEVEELAVKAAEAV---GGGVVAIDIFESKERGLLVNEVN 251


>gnl|CDD|162681 TIGR02068, cya_phycin_syn, cyanophycin synthetase.  Cyanophycin
           synthesis is analogous to polyhydroxyalkanoic acid (PHA)
           biosynthesis, except that PHA polymers lack nitrogen and
           may be made under nitrogen-limiting conditions.
          Length = 864

 Score = 41.7 bits (98), Expect = 3e-04
 Identities = 32/111 (28%), Positives = 48/111 (43%), Gaps = 22/111 (19%)

Query: 159 IIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFE---KYPEPLMIQSYLPQIRDGDKRILL 215
           ++IKP  GN G GV  I +  R+    IE  +E   +    ++++ +   I   D R+L+
Sbjct: 251 VVIKPYDGNHGRGVT-INILTRD---EIESAYEAAVEESSGVIVERF---ITGRDHRLLV 303

Query: 216 LNGKPVGAVNRIPSEV--DNRSNIHA----------GGKAELTKLTKIDLD 254
           + GK V    R+P+ V  D    I             G      LTKI LD
Sbjct: 304 VGGKVVAVAERVPAHVIGDGVHTIEELIEQINTDPLRGDGHDKPLTKIRLD 354


>gnl|CDD|183732 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein;
           Provisional.
          Length = 326

 Score = 37.2 bits (87), Expect = 0.006
 Identities = 36/139 (25%), Positives = 53/139 (38%), Gaps = 35/139 (25%)

Query: 159 IIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRI---LL 215
           + +KP  G+   GVF++     +   L E L E  P  L+IQ +   I   +  +     
Sbjct: 151 LFVKPRDGSASIGVFKV----NDKEEL-EFLLEYVPN-LIIQEF---IEGQEYTVDVLCD 201

Query: 216 LNGKPVGAVNR-----IPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERG--- 267
           LNG+ +  V R        E   +         EL KL        +R+ E+L  RG   
Sbjct: 202 LNGEVISIVPRKRIEVRAGETS-KG--VTVKDPELFKL-------AERLAEALGARGPLN 251

Query: 268 --LFFTGIDVIGDYITEIN 284
              F T       Y+ EIN
Sbjct: 252 IQCFVTD-GEP--YLFEIN 267


>gnl|CDD|162798 TIGR02291, rimK_rel_E_lig, alpha-L-glutamate ligase-related
           protein.  Members of this protein family contain a
           region of homology to the RimK family of
           alpha-L-glutamate ligases (TIGR00768), various members
           of which modify the Glu-Glu C-terminus of ribosomal
           protein S6, or tetrahydromethanopterin, or a form of
           coenzyme F420 derivative. Members of this family are
           found so far in various Vibrio and Pseudomonas species
           and some other gamma and beta Proteobacteria. The
           function is unknown.
          Length = 317

 Score = 34.1 bits (78), Expect = 0.056
 Identities = 34/136 (25%), Positives = 52/136 (38%), Gaps = 44/136 (32%)

Query: 142 ISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRIT------------------------- 176
              ++  I     +  D +IKP  G+GG G+  IT                         
Sbjct: 61  NQAEVKTIHNIVKDHPDFVIKPAQGSGGKGILVITSRKDGRYRKPSGATINKEEIERHVS 120

Query: 177 --------LGDRNFSSLIEMLFEKYPEPLMIQ-SY--LPQIRDGDKRILLLNGKPVGAVN 225
                   LG +N  +LIE   +   +P     SY  +P IR     I++  G PV A+ 
Sbjct: 121 NILAGLYSLGGKNDVALIEYRVK--FDPCFDGFSYEGVPDIR-----IIVFKGYPVMAMM 173

Query: 226 RIP-SEVDNRSNIHAG 240
           R+P    D ++N+H G
Sbjct: 174 RLPTRASDGKANLHQG 189


>gnl|CDD|179427 PRK02471, PRK02471, bifunctional glutamate--cysteine
           ligase/glutathione synthetase; Provisional.
          Length = 752

 Score = 33.0 bits (76), Expect = 0.11
 Identities = 20/100 (20%), Positives = 44/100 (44%), Gaps = 12/100 (12%)

Query: 145 DITQITRFYLEMKD--IIIKPLYGNGGTGV--FRITLGDRNFSSLIEMLFEKYPEPLMIQ 200
            + +    Y    D  I++KP   N G G+  F+      ++   +E+ F +    ++++
Sbjct: 511 SLEEALADYSLFADKAIVVKPKSTNFGLGISIFKEPASLEDYEKALEIAF-REDSSVLVE 569

Query: 201 SYLPQIRDGDK-RILLLNGKPVGAVNRIPSEV--DNRSNI 237
            ++     G + R  +L+GK    + R+P+ V  D    +
Sbjct: 570 EFIV----GTEYRFFVLDGKVEAVLLRVPANVVGDGIHTV 605


>gnl|CDD|183480 PRK12374, PRK12374, putative dithiobiotin synthetase; Provisional.
          Length = 231

 Score = 31.7 bits (72), Expect = 0.29
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 174 RITLGDRNFSSLIEMLFEKYPEPLMIQ-SYLPQI--RDGDKRILLLNGKPVGAVNRIP 228
           RI  G  +++ +I++L +K P PL+ +  YLP+   R+  + I L   + V AV+R+ 
Sbjct: 173 RINPGLAHYAEIIDVLGKKLPAPLIGELPYLPRAEQRELGQYIDLSMLRSVLAVDRVT 230


>gnl|CDD|132147 TIGR03103, trio_acet_GNAT, GNAT-family acetyltransferase TIGR03103.
            Members of this protein family belong to the GNAT
           family of acetyltransferases. Each is part of a
           conserved three-gene cassette sparsely distributed
           across at least twenty different species known so far,
           including alpha, beta, and gamma Proteobacteria,
           Mycobacterium, and Prosthecochloris, which is a member
           of the Chlorobi. The other two members of the cassette
           are a probable protease and an asparagine synthetase
           family protein.
          Length = 547

 Score = 30.9 bits (70), Expect = 0.48
 Identities = 25/104 (24%), Positives = 51/104 (49%), Gaps = 10/104 (9%)

Query: 138 PPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLF--EKYPE 195
           P   ++ +   +  F  E   +++KP+ G  G G   I++  R    L   +    ++ +
Sbjct: 313 PEQQLAGNGEAVEAFLAEHGAVVVKPVRGEQGKG---ISVDVRTPDDLEAAIAKARQFCD 369

Query: 196 PLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEV--DNRSNI 237
            ++++ Y+P     D R+++++ + V A  R P EV  D RS+I
Sbjct: 370 RVLLERYVP---GEDLRLVVIDFEVVAAAVRRPPEVIGDGRSSI 410


>gnl|CDD|172362 PRK13835, PRK13835, conjugal transfer protein TrbH; Provisional.
          Length = 145

 Score = 30.8 bits (70), Expect = 0.50
 Identities = 10/24 (41%), Positives = 19/24 (79%), Gaps = 1/24 (4%)

Query: 14 ISTVKVKEDST-FAIALEAQVRGY 36
           +T+K+K+D++ F  ALEA ++G+
Sbjct: 58 TTTIKLKKDTSPFGQALEAALKGW 81


>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau;
           Provisional.
          Length = 504

 Score = 29.0 bits (65), Expect = 1.7
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 2/25 (8%)

Query: 128 IFVTEFSELMPPTLISRDITQITRF 152
           I  T   E MPPT++SR  TQ  RF
Sbjct: 150 ILATTEPEKMPPTILSR--TQHFRF 172


>gnl|CDD|161993 TIGR00678, holB, DNA polymerase III, delta' subunit.  At position
           126-127 of the seed alignment, this family lacks the HM
           motif of gamma/tau; at 132 it has a near-invariant A vs.
           an invariant F in gamma/tau.
          Length = 188

 Score = 27.6 bits (62), Expect = 4.0
 Identities = 11/41 (26%), Positives = 20/41 (48%), Gaps = 2/41 (4%)

Query: 128 IFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNG 168
           I +T   E + PT+ SR   Q+  F    ++ +++ L   G
Sbjct: 130 ILITPSPEKLLPTIRSR--CQVLPFPPLSEEALLQWLIRQG 168


>gnl|CDD|162206 TIGR01110, mdcA, malonate decarboxylase, alpha subunit.  This model
           describes malonate decarboxylase alpha subunit, from
           both the water-soluble form as found in Klebsiella
           pneumoniae and the form couple to sodium ion pumping in
           Malonomonas rubra. Malonate decarboxylase Na+ pump is
           the paradigm of the family of Na+ transport
           decarboxylases. Essentially, it couples the energy
           derived from decarboxylation of a carboxylic acid
           substrate to move Na+ ion across the bilayer. Functional
           malonate decarboylase is a multi subunit protein. The
           alpha subunit enzymatically performs the transfer of
           malonate (substrate) to an acyl carrier protein subunit
           for subsequent decarboxylation, hence the name:
           acetyl-S-acyl carrier protein:malonate carrier
           protein-SH transferase.
          Length = 543

 Score = 27.5 bits (61), Expect = 5.0
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 141 LISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPL 197
           L +RD   IT   + M  + IK +Y      V R+  G    ++ IE+L   Y E L
Sbjct: 213 LFTRDPANITDVQVLMAMMAIKGIYAE--YQVQRLNHGIGFNTAAIELLLPTYGESL 267


>gnl|CDD|180883 PRK07206, PRK07206, hypothetical protein; Provisional.
          Length = 416

 Score = 26.9 bits (60), Expect = 6.4
 Identities = 9/33 (27%), Positives = 13/33 (39%)

Query: 147 TQITRFYLEMKDIIIKPLYGNGGTGVFRITLGD 179
             +    L  + ++IKPL   G  GVF      
Sbjct: 137 AWLRENGLIDRPVVIKPLESAGSDGVFICPAKG 169


>gnl|CDD|148275 pfam06572, DUF1131, Protein of unknown function (DUF1131).  This
           family consists of several hypothetical bacterial
           proteins of unknown function.
          Length = 192

 Score = 27.0 bits (60), Expect = 6.8
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 205 QIRDGDKRILLLNGKPVGAVNRI 227
           Q   GD+  L++NG+P G V+RI
Sbjct: 86  QAMKGDQVKLVINGQPKGTVSRI 108


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.320    0.140    0.403 

Gapped
Lambda     K      H
   0.267   0.0672    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 5,344,717
Number of extensions: 357625
Number of successful extensions: 699
Number of sequences better than 10.0: 1
Number of HSP's gapped: 684
Number of HSP's successfully gapped: 24
Length of query: 316
Length of database: 5,994,473
Length adjustment: 93
Effective length of query: 223
Effective length of database: 3,984,929
Effective search space: 888639167
Effective search space used: 888639167
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (25.9 bits)