RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780697|ref|YP_003065110.1| large conductance mechanosensitive channel protein [Candidatus Liberibacter asiaticus str. psy62] (141 letters) >2oar_A Large-conductance mechanosensitive channel; stretch activated ION channel mechanosensitive, membrane protein; 3.50A {Mycobacterium tuberculosis H37RA} (A:1-126) Length = 126 Score = 99.8 bits (249), Expect = 1e-22 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 13/114 (11%) Query: 7 VFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPL 66 + FK+F+ARGN++DL+V ++IG AF +V + I+ PL+ + N Sbjct: 24 MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQS-------- 75 Query: 67 SSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVV-FVLIQFMNKLVKQTE 119 ++ G S +NFF++A V F+++ N L K+ E Sbjct: 76 ----DVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGE 125 >3hzq_A Large-conductance mechanosensitive channel; intermediate state mechanosensitive channel osmoregulation, cell membrane, ION transport; 3.82A {Staphylococcus aureus subsp} (A:33-114) Length = 82 Score = 79.3 bits (196), Expect = 2e-16 Identities = 27/99 (27%), Positives = 53/99 (53%), Gaps = 18/99 (18%) Query: 19 NVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEA 78 NV+DL++ +++G AFN+++ S+VE+I+MPL+G + G+ + Sbjct: 1 NVLDLAIAVVMGAAFNKIICSLVENIIMPLIGKIFGSVDFAKEWS--------------- 45 Query: 79 RKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQ 117 YG F +++F I+A +F+ ++ N L+K+ Sbjct: 46 ---FWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKK 81 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.325 0.141 0.395 Gapped Lambda K H 0.267 0.0732 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 987,967 Number of extensions: 38723 Number of successful extensions: 132 Number of sequences better than 10.0: 1 Number of HSP's gapped: 129 Number of HSP's successfully gapped: 4 Length of query: 141 Length of database: 4,956,049 Length adjustment: 80 Effective length of query: 61 Effective length of database: 2,251,649 Effective search space: 137350589 Effective search space used: 137350589 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.0 bits)