RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780697|ref|YP_003065110.1| large conductance mechanosensitive channel protein [Candidatus Liberibacter asiaticus str. psy62] (141 letters) >2oar_A Large-conductance mechanosensitive channel; stretch activated ION channel mechanosensitive, membrane protein; 3.50A {Mycobacterium tuberculosis H37RA} SCOP: f.16.1.1 Length = 174 Score = 127 bits (321), Expect = 9e-31 Identities = 41/134 (30%), Positives = 65/134 (48%), Gaps = 13/134 (9%) Query: 8 FNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLS 67 FK+F+ARGN++DL+V ++IG AF +V + I+ PL+ + N Sbjct: 25 LKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQS--------- 75 Query: 68 SEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVV-FVLIQFMNKLVKQTENVKNPPA 126 ++ G S +NFF++A V F+++ N L K+ E + Sbjct: 76 ---DVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDT 132 Query: 127 EVQLLTEIRDLLQK 140 +V LLTEIRDLL + Sbjct: 133 QVVLLTEIRDLLAQ 146 >3hzq_A Large-conductance mechanosensitive channel; intermediate state mechanosensitive channel osmoregulation, cell membrane, ION transport; 3.82A {Staphylococcus aureus subsp} Length = 114 Score = 90.6 bits (225), Expect = 1e-19 Identities = 33/115 (28%), Positives = 64/115 (55%), Gaps = 18/115 (15%) Query: 3 QGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNY 62 +G+ + EFK+F +GNV+DL++ +++G AFN+++ S+VE+I+MPL+G + G+ + Sbjct: 17 RGSHMLKEFKEFALKGNVLDLAIAVVMGAAFNKIICSLVENIIMPLIGKIFGSVDFAKEW 76 Query: 63 FLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQ 117 YG F +++F I+A +F+ ++ N L+K+ Sbjct: 77 ------------------SFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKK 113 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 33.8 bits (77), Expect = 0.015 Identities = 25/117 (21%), Positives = 42/117 (35%), Gaps = 48/117 (41%) Query: 3 QGTP-----VFN----EFKKFIARGNV-------IDLSVGIIIGGAFNRVV----QSIV- 41 +G P + N + + ++ + N +++S ++ GA N VV QS+ Sbjct: 332 EGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEIS---LVNGAKNLVVSGPPQSLYG 388 Query: 42 -----EDIMMPLVGCVMGNGTD------------FSNYFLPLSSEIKSSLISEARKQ 81 P +G D FSN FLP++S S L+ A Sbjct: 389 LNLTLRKAKAP-------SGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDL 438 >3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Score = 31.9 bits (73), Expect = 0.054 Identities = 20/104 (19%), Positives = 34/104 (32%), Gaps = 20/104 (19%) Query: 21 IDLSVGIIIGGAF----------NR--VVQSIVEDIMMPLVGCV----MGNGTDFSNYFL 64 +D +V + F NR V + + L + +G+G D Sbjct: 269 LDKAVEGALASKFRNAGQTCVCANRLYVQDGVYDRFAEKLQQAMSKLHIGDGLDNGVTIG 328 Query: 65 PLSSEIK----SSLISEARKQGAVFAYGSFASVLVNFFILAGVV 104 PL E I++A ++GA G A F ++ Sbjct: 329 PLIDEKAVAKVEEHIADALEKGARVVCGGKAHERGGNFFQPTIL 372 >2o0r_A RV0858C (N-succinyldiaminopimelate aminotransferase); PLP-binding enzyme, lysine biosynthesis, structural genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis H37RV} Length = 411 Score = 30.5 bits (67), Expect = 0.14 Identities = 7/23 (30%), Positives = 9/23 (39%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 T VF E R ++L G Sbjct: 11 ATTVFAEMSALATRIGAVNLGQG 33 >1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Length = 386 Score = 30.1 bits (66), Expect = 0.21 Identities = 7/23 (30%), Positives = 11/23 (47%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 GT +F + + I+LS G Sbjct: 16 GTTIFTQMSALAQQHQAINLSQG 38 >1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Length = 429 Score = 29.0 bits (63), Expect = 0.41 Identities = 5/23 (21%), Positives = 11/23 (47%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 V+ E+ + A+ ++L G Sbjct: 23 TKSVWVEYIQLAAQYKPLNLGQG 45 >3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, alternative splicing, aminotransferase, lyase; HET: GLN PMP; 2.26A {Mus musculus} PDB: 2zjg_A* 3e2f_A* 3e2z_A* Length = 410 Score = 28.8 bits (63), Expect = 0.43 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 + V+ EF K A +V++L G Sbjct: 9 DSNVWVEFTKLAADPSVVNLGQG 31 >3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, lyase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Length = 422 Score = 27.4 bits (59), Expect = 1.2 Identities = 6/23 (26%), Positives = 11/23 (47%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 + EF K + +V++L G Sbjct: 14 DYNPWVEFVKLASEHDVVNLGQG 36 >1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Length = 381 Score = 27.0 bits (58), Expect = 1.8 Identities = 4/23 (17%), Positives = 7/23 (30%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 +F R ++L G Sbjct: 11 KESIFPRMSGLAQRLGAVNLGQG 33 >1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3inj_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 2vle_A* 1cw3_A* 1ag8_A 1a4z_A Length = 500 Score = 26.5 bits (58), Expect = 2.4 Identities = 15/79 (18%), Positives = 27/79 (34%), Gaps = 8/79 (10%) Query: 34 NRVVQSIVEDIMMPLVGCV----MGNGTDFSNYFLPLSSEIK----SSLISEARKQGAVF 85 V + I ++ + V +GN D P E + I+ +++GA Sbjct: 308 TFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKL 367 Query: 86 AYGSFASVLVNFFILAGVV 104 G + +FI V Sbjct: 368 LCGGGIAADRGYFIQPTVF 386 >3d6k_A Putative aminotransferase; APC82464, structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Length = 422 Score = 26.3 bits (57), Expect = 2.6 Identities = 5/23 (21%), Positives = 11/23 (47%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 V ++ + A+ +DL+ G Sbjct: 18 REEVTAKYAELKAKNLSLDLTRG 40 >2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* Length = 517 Score = 25.0 bits (54), Expect = 6.5 Identities = 12/76 (15%), Positives = 21/76 (27%), Gaps = 4/76 (5%) Query: 33 FNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIK----SSLISEARKQGAVFAYG 88 + V+ ++ + +GN + P + E K+GA G Sbjct: 331 EESIHNQFVQKVVEEVEKMKIGNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCG 390 Query: 89 SFASVLVNFFILAGVV 104 FF V Sbjct: 391 GNQVPRPGFFFQPTVF 406 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.325 0.141 0.395 Gapped Lambda K H 0.267 0.0704 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,137,580 Number of extensions: 46518 Number of successful extensions: 210 Number of sequences better than 10.0: 1 Number of HSP's gapped: 206 Number of HSP's successfully gapped: 16 Length of query: 141 Length of database: 5,693,230 Length adjustment: 83 Effective length of query: 58 Effective length of database: 3,680,978 Effective search space: 213496724 Effective search space used: 213496724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (23.9 bits)