HHsearch results for GI: 254780698 and protein with PDBid: 3a3d_A

>3a3d_A PBP4, penicillin-binding protein 4; DACB, hydrolase; 1.60A {Haemophilus influenzae} PDB: 3a3e_A* 3a3f_A* 3a3i_A*
Probab=99.46  E-value=2.1e-12  Score=91.60  Aligned_cols=139  Identities=14%  Similarity=0.159  Sum_probs=97.5

Q ss_pred             EEEHHHHHHHHHHHHHHHHHHHHHHCC-------HHHHHHHHHHHHHHHHCCCC--CCEECCCCCCCCCCCCCHHHHHHH
Q ss_conf             830245788998777776545542010-------05789998887688726612--220024543333445301345555
Q gi|254780698|r  127 TTEQGILALITRSANDVSTAFGEFISG-------SEKKFAILMSNKAKKIGMQN--TIYKNASGLHDKNQITTARDQAIL  197 (336)
Q Consensus       127 tv~dLl~~lli~S~NdAa~alAe~i~G-------s~~~Fv~~MN~~A~~lGl~~--t~f~np~Gl~~~~~~tta~Dla~l  197 (336)
                      ++.+++..|+-.|.|-.|..|...++.       +.+.-...+....+++|+..  .++.+.+||...+ ..|+++|..+
T Consensus       272 pL~~il~~mlk~SdN~~AE~L~~~lg~~~~~~~~~~~~~~~~~~~~l~~~gi~~~~~~~~DGSGLSr~N-~it~~~l~~l  350 (453)
T 3a3d_A          272 PLPDLLKKMMKKSDNQIADSLFRAVAFNYYKRPASFQLGTLAVKSILQKQGIRFGNSILADGSGLSRHN-LVAPKTMLSV  350 (453)
T ss_dssp             CHHHHHHHHHHHTCHHHHHHHHHHHHHHHHTSCBCHHHHHHHHHHHHHHTTCCCTTCBCCCSSSCCTTC-BBCHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCC-CCCHHHHHHH
T ss_conf             099999999845971899999999988745898607788988888999729997652552777777344-3189999999


Q ss_pred             HHHHCCCCEEEEEEEEEEEEEECCEEEEEECHHCCC-CCCCEEEEECCCCCCCCEEEEEEE-ECCEEEEEEEE
Q ss_conf             542013620467761156543478699721010257-687005652242333717999999-78979999981
Q gi|254780698|r  198 GILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNK-MHNIDGIKTGYTRNSGFNIVTSLR-YKDDPIVAVVM  268 (336)
Q Consensus       198 ~~~~~~~~p~~~~~~s~~~~~~~~~~~~n~N~lL~~-~~g~~G~KTG~T~~AG~clv~~a~-~~g~~lI~Vvl  268 (336)
                      ..++..+ |.+..+.+.-.......++.++..+... -.|-.-.|||+-+ .-.||++... ++|+.++.+||
T Consensus       351 L~~~~~~-~~~~~~~~sLpv~G~~Gtl~~r~~~~~~~~~g~v~aKTGtL~-~v~sLaGyi~~~~G~~~~fsi~  421 (453)
T 3a3d_A          351 LEYIAKN-EDKLHLMETFPIAGVDGTISGRGGLISPPLVKNVIAKTGSLK-GVYNLAGFMTNARGEKVAFVQF  421 (453)
T ss_dssp             HHHHHHT-HHHHCCGGGSCBTTTSGGGTTCGGGSSTTTTTTCEEEEEEET-TEEEEEEEEECTTSCEEEEEEE
T ss_pred             HHHHHHC-CCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCC-CCEEEEEEEECCCCCEEEEEEE
T ss_conf             9998759-527899973880577775456565567776684999872637-8458799999699899999999