RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780699|ref|YP_003065112.1| hypothetical protein CLIBASIA_02930 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >gnl|CDD|180950 PRK07373, PRK07373, DNA polymerase III subunit alpha; Reviewed. Length = 449 Score = 25.4 bits (56), Expect = 3.3 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Query: 8 IENILKEDREDNNIKSLAQL-QRIAIRTVLANR 39 IE+ILK E KSLA R+ +R V NR Sbjct: 127 IESILKAREEGGEFKSLADFCDRVDLRVV--NR 157 >gnl|CDD|147814 pfam05861, PhnI, Bacterial phosphonate metabolism protein (PhnI). This family consists of several Proteobacterial phosphonate metabolism protein (PhnI) sequences. Bacteria that use phosphonates as a phosphorus source must be able to break the stable carbon-phosphorus bond. In Escherichia coli phosphonates are broken down by a C-P lyase that has a broad substrate specificity. The genes for phosphonate uptake and degradation in E. coli are organized in an operon of 14 genes, named phnC to phnP. Three gene products (PhnC, PhnD and PhnE) comprise a binding protein-dependent phosphonate transporter, which also transports phosphate, phosphite, and certain phosphate esters such as phosphoserine; two gene products (PhnF and PhnO) may have a role in gene regulation; and nine gene products (PhnG, PhnH, PhnI, PhnJ, PhnK, PhnL, PhnM, PhnN, and PhnP) probably comprise a membrane-associated C-P lyase enzyme complex. Length = 356 Score = 24.9 bits (55), Expect = 4.7 Identities = 6/11 (54%), Positives = 8/11 (72%) Query: 60 RAWRTSKPRTY 70 RA+RT+ PR Sbjct: 79 RAYRTTLPRLG 89 >gnl|CDD|148772 pfam07352, Phage_Mu_Gam, Bacteriophage Mu Gam like protein. This family consists of bacterial and phage Gam proteins. The gam gene of bacteriophage Mu encodes a protein which protects linear double stranded DNA from exonuclease degradation in vitro and in vivo. Length = 147 Score = 24.9 bits (55), Expect = 5.0 Identities = 9/46 (19%), Positives = 18/46 (39%) Query: 5 NQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEF 50 N + I + RE I++ A + I+ A + +K + Sbjct: 6 NWALRKIGELKREIEEIETEANDEIARIKEWYAPELEPLKDEIEYL 51 >gnl|CDD|114764 pfam06060, Mesothelin, Pre-pro-megakaryocyte potentiating factor precursor (Mesothelin). This family consists of several mammalian pre-pro-megakaryocyte potentiating factor precursor (MPF) or mesothelin proteins. Mesothelin is a glycosylphosphatidylinositol-linked glycoprotein highly expressed in mesothelial cells, mesotheliomas, and ovarian cancer, but the biological function of the protein is not known. Length = 625 Score = 24.9 bits (54), Expect = 5.1 Identities = 8/26 (30%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Query: 43 IKSITKEFMEYWIAHSSR--AWRTSK 66 ++SI K+ + W+ SR + SK Sbjct: 262 VRSIPKDVVAEWLQRISRDPSRLGSK 287 >gnl|CDD|162066 TIGR00845, caca, sodium/calcium exchanger 1. This model is specific for the eukaryotic sodium ion/calcium ion exchangers of the Caca family. Length = 928 Score = 24.8 bits (54), Expect = 5.9 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 6 QFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTK 41 + I ILKE ++ + K L QL+ +A VL+ + K Sbjct: 318 EMIR-ILKELKQKHPDKDLEQLEEMANYQVLSRQQK 352 >gnl|CDD|163484 TIGR03772, anch_rpt_subst, anchored repeat ABC transporter, substrate-binding protein. Members of this protein family are ABC transporter permease subunits as identified by pfam00950, but additionally contain the Actinobacterial insert domain described by TIGR03769. Some homologs (lacking the insert) have been described as transporters of manganese or of chelated iron. Members of this family typically are found along with an ATP-binding cassette protein, a permease, and an LPXTG-anchored protein with two or three copies of the TIGR03769 insert that occurs just once in this protein family. Length = 479 Score = 24.4 bits (53), Expect = 6.5 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Query: 56 AHSSRAWRTSKPRTYLNLHIASQ 78 AH+ +W SKP Y L A+Q Sbjct: 171 AHTHMSWAFSKPGIY-RLSFAAQ 192 >gnl|CDD|168927 PRK07374, dnaE, DNA polymerase III subunit alpha; Validated. Length = 1170 Score = 24.3 bits (53), Expect = 6.9 Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Query: 8 IENILKEDREDNNIKSLAQL-QRIAIRTVLANR 39 I NI+ D KSLA L R+ + NR Sbjct: 848 IRNIIAARDSDGPFKSLADLCDRLPSNVL--NR 878 >gnl|CDD|161979 TIGR00653, GlnA, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. Length = 460 Score = 24.2 bits (53), Expect = 7.0 Identities = 9/50 (18%), Positives = 19/50 (38%) Query: 13 KEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSRAW 62 E+ + I L A+ + ++ +EF+E +I + W Sbjct: 394 PEELREKGIPQLPGSLEEALDELESDHLVEGGVFGEEFIEAFIELKRKEW 443 >gnl|CDD|184560 PRK14190, PRK14190, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional. Length = 284 Score = 24.2 bits (53), Expect = 7.9 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Query: 22 KSLAQL--QRIAIRTVLANRTKNIKSITK 48 K + QL A T ++TKN+ +TK Sbjct: 172 KPVGQLLLNENATVTYCHSKTKNLAELTK 200 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.131 0.367 Gapped Lambda K H 0.267 0.0615 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,474,812 Number of extensions: 72840 Number of successful extensions: 204 Number of sequences better than 10.0: 1 Number of HSP's gapped: 204 Number of HSP's successfully gapped: 24 Length of query: 97 Length of database: 5,994,473 Length adjustment: 65 Effective length of query: 32 Effective length of database: 4,589,953 Effective search space: 146878496 Effective search space used: 146878496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.3 bits)