RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780699|ref|YP_003065112.1| hypothetical protein CLIBASIA_02930 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >2rij_A Putative 2,3,4,5-tetrahydropyridine-2- carboxylate N- succinyltransferase; NP_282733.1, structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Length = 387 Score = 28.0 bits (62), Expect = 0.50 Identities = 15/88 (17%), Positives = 29/88 (32%), Gaps = 2/88 (2%) Query: 4 DNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSRAWR 63 ++F++ + ED + L+ + + + K EF + Sbjct: 78 ASEFVQTLKLEDIDFALSCFKPFLEEDGHQNIDLLKIIKDKFKDDEFSFVCLFEDKE--P 135 Query: 64 TSKPRTYLNLHIASQSKKIPVSIYIGNI 91 S YL L++ S K SI + Sbjct: 136 LSVESIYLKLYLLSTKKVPLRSINLNGA 163 >2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} Length = 549 Score = 24.9 bits (54), Expect = 4.3 Identities = 11/59 (18%), Positives = 18/59 (30%), Gaps = 11/59 (18%) Query: 1 MLFDNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSS 59 + QF E L D +I + IR + E ++ IA+ Sbjct: 349 AMVYPQFYEYRLS----DRDIAGM-------IRVDKVPILDEFYNFANELIDICIANKD 396 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.319 0.131 0.367 Gapped Lambda K H 0.267 0.0518 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 777,547 Number of extensions: 28014 Number of successful extensions: 102 Number of sequences better than 10.0: 1 Number of HSP's gapped: 102 Number of HSP's successfully gapped: 7 Length of query: 97 Length of database: 5,693,230 Length adjustment: 63 Effective length of query: 34 Effective length of database: 4,165,858 Effective search space: 141639172 Effective search space used: 141639172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.5 bits)