>TIGR02037 degP_htrA_DO protease Do; InterPro: IPR011782 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases . Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , . Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. This family consists serine peptidases belonging to MEROPS peptidase family S1, subfamily S1C (protease Do, clan PA(S)). They are variously designated DegP, DegQ, heat shock protein HtrA, MucD and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in Escherichia coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens . The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures .; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis.

Probab=100.00 E-value=0 Score=996.30 Aligned_cols=440 Identities=35% Similarity=0.589 Sum_probs=391.2 Q ss_pred CCHHHHHHHHCCCEEEEEEEEEEEECCCCCCCCC-CCCCCCCCCCHHHH-----HHHHCC-CCCCCCC-----CCCC--- Q ss_conf 8988999984895089999999872255555544-55678887700254-----455301-3577666-----6754--- Q gi|254780700|r 38 VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY-GFGNLPEDHPLKNY-----FRKDFH-KFFSGEE-----PILS--- 102 (489) Q Consensus 38 ~~~~~~~~~~~paVV~i~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~-----~~~~~~-~~~~~~~-----~~~~--- 102 (489) T Consensus 1 ~sfa~~ve~~~PaVVnI~~~~~~~~~~~~~~~~~D~~p~~~~g~~fddf~Fd~~F~~FFg~~~~p~~~~~~~~~~~~~~g 80 (484) T TIGR02037 1 PSFAPLVEKVAPAVVNISTEGTVKRRNGPGFDPLDRMPENPGGSPFDDFEFDEFFDQFFGDDEMPNQPGGREFPQPEFVG 80 (484) T ss_pred CCHHHHHHHHCCCEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCC T ss_conf 97579899846972899988998514678887656788777778555666874105664888788888888888520037 Q ss_pred -CCCCCCCCEEEEEECCC-C--EEEECHHCCCCCCEEEEECCCCEEEEECCCCCCCCCCEEEEEEECC-CCCCCCCCCCC Q ss_conf -45552234027897599-6--2985101047871437962898067401112334443289996067-66765565567 Q gi|254780700|r 103 -DTVERLMFGSGFFITDD-G--YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD-RKFIPVEFEDA 177 (489) Q Consensus 103 -~~~~~~~~GsG~ii~~~-G--~ilTn~hvv~~a~~i~V~~~dg~~~~a~vvg~D~~~DlAvlki~~~-~~~~~~~lg~s 177 (489) T Consensus 81 ~~~~~~~~LGSGvIi~~d~Gk~YilTNnHVv~gA~~I~V~L~DgrefkAklvG~D~~~D~AvlKi~~~D~~Lp~~~~GDS 160 (484) T TIGR02037 81 ERERKVRGLGSGVIISADKGKFYILTNNHVVDGADEITVTLSDGREFKAKLVGKDPRTDIAVLKIEAKDKKLPVVKLGDS 160 (484) T ss_pred CCCEEEEECCCCEEEECCCCEEEEEECCEEECCCCEEEEEECCCCEEEEEEECCCCCEEEEEEEEECCCCCCCEEEECCC T ss_conf 64037764144189847898699987543636853799994599485568866677213899998278897456773485 Q ss_pred CCCCCCCEEEEECCCCC-CCCCCCCCCCCCCCCC-CC-CCCCCEEEEEEEEECCCCCCEEEECCCEEEEEECCCCCCCCC Q ss_conf 31112414675236655-3111125874431122-33-443420233233201347703540343035551234455322 Q gi|254780700|r 178 NNIRVGEAVFTIGNPFR-LRGTVSAGIVSALDRD-IP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254 (489) Q Consensus 178 ~~~~~G~~v~aiG~P~g-~~~tvt~GiiSa~~R~-~~-~~~~~~iqtDa~InpGnSGGpl~n~~G~viGint~i~~~~g~ 254 (489) T Consensus 161 D~LrVGd~V~AIGNPFGNlg~TVT~GIVSAlgRs~~~~~~y~~FIQTDAAINpGNSGGPLvN~~GEvIGINTaI~S~sGG 240 (484) T TIGR02037 161 DKLRVGDWVLAIGNPFGNLGQTVTSGIVSALGRSGLGIGDYENFIQTDAAINPGNSGGPLVNLRGEVIGINTAIYSPSGG 240 (484) T ss_pred CCCEECCEEEEEECCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCC T ss_conf 55224349999327742458425788998321688887774765022423374788775356785388888887617888 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHH Q ss_conf 2222321123321100100002333333433200-034216676441764444113201111121134671167888752 Q gi|254780700|r 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM-TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333 (489) Q Consensus 255 ~~GigfaIP~~~~~~i~~~l~~~g~v~rg~lGv~-~~~v~~~la~~lgl~~~~GvlV~~V~~~sPA~~AGLk~GDvI~~i 333 (489) T Consensus 241 ~~GIGFAIP~n~a~~v~~ql~~~G~V~RG~LGV~~~q~~~~d~A~~lGl~~~~GALV~~V~~gSPA~kAGlk~GDvI~~~ 320 (484) T TIGR02037 241 NVGIGFAIPSNMAKNVVDQLIEGGKVQRGWLGVTQIQEITSDLAKSLGLEKQEGALVAQVLPGSPAEKAGLKAGDVILSV 320 (484) T ss_pred EECCHHHHHHHHHHHHHHHHHHCCEEEECEEEEEECCCCCHHHHHHHCCCCCCCEEEEEECCCCCHHCCCCCCCCEEEEE T ss_conf 10101021268899999999838928702151010775797999970888536558885448970100675326689985 Q ss_pred CCCCCCCCCCEEEEECCCCCCCCEEEEECCCCCEEEECCCCC--------CCCCCCCCCC----CCCCCCCCCCEEEEEC Q ss_conf 431478743101222035667520101204781665125565--------5876310000----1246545254698728 Q gi|254780700|r 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG--------SSPTAKNDMH----LEVGDKELLGMVLQDI 401 (489) Q Consensus 334 ng~~I~~~~~l~~~i~~~~~G~~v~l~v~R~g~~~~~~V~l~--------~~p~~~~~~~----~~~~~~~~lGl~v~~l 401 (489) T Consensus 321 nGk~i~~~~~L~~~i~~~~pG~~~~L~i~R~Gk~~~~~V~l~~Ld~~~a~~~~~~~~~~~~~~~~~~~~~~~~Gl~v~~L 400 (484) T TIGR02037 321 NGKKIKSFADLRRAIGTLKPGKKVTLTILRKGKEKTITVTLGELDEKTASAAPEEKASSERSTEPGVGRLGFPGLSVANL 400 (484) T ss_pred CCEEECCHHHHHHHHHCCCCCCEEEEEEEECCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCC T ss_conf 88640587999898740589877999999788688899998107850025664555555432265345532250162379 Q ss_pred CHHHCCE--------EEEEEEEECCCCHHHHCCCCCCCEEEEECCEECCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCC Q ss_conf 9657152--------00799960688978982999888999889999389999999999886259956999997177643 Q gi|254780700|r 402 NDGNKKL--------VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473 (489) Q Consensus 402 ~~~~~~~--------~gi~vv~v~~~s~Aa~~GL~~GDiIl~VNg~~V~s~~dl~~iL~~~k~~~~~~VLL~V~r~~~~~ 473 (489) T Consensus 401 ~~~~~~~l~~~~~~~~Gv~V~~v~~~s~Aa~~Gl~~GDvI~~vN~~~V~s~~e~~~~l~~~~k~~~k~~~L~i~Rg~~-- 478 (484) T TIGR02037 401 TPEIAKKLLNLAGVSKGVVVTKVVSGSPAARAGLQPGDVILSVNQQPVSSVAELNKVLARAKKGGRKKVALLIERGGA-- 478 (484) T ss_pred CHHHHHHHCCCCCCCCCEEEEEECCCCHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEEEEEEECCE-- T ss_conf 989999871322677748999733888899717876618995088014678999999997328870479999998780-- Q ss_pred CCCCCCEEEEEE Q ss_conf 346884368887 Q gi|254780700|r 474 SGNDNMSRFVSL 485 (489) Q Consensus 474 ~~~~~~~rFVal 485 (489) T Consensus 479 ------~~~~~~ 484 (484) T TIGR02037 479 ------TIFVTL 484 (484) T ss_pred ------EEEEEC T ss_conf ------689769

HHsearch alignment for GI: 254780700 and conserved domain: TIGR02037