>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.

Probab=99.73 E-value=3.9e-19 Score=140.62 Aligned_cols=90 Identities=40% Similarity=0.671 Sum_probs=87.0 Q ss_pred CCCCCCCCCCHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCEEEEEC Q ss_conf 43320003421667644176444411320111112113467116788875243147874310122203566752010120 Q gi|254780700|r 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362 (489) Q Consensus 283 g~lGv~~~~v~~~la~~lgl~~~~GvlV~~V~~~sPA~~AGLk~GDvI~~ing~~I~~~~~l~~~i~~~~~G~~v~l~v~ 362 (489) T Consensus 1 p~lGi~~~~l~~~~~~~~~~~~~~Gv~V~~V~~~spA~~aGl~~GDiI~~ing~~i~~~~~~~~~l~~~~~g~~v~~~v~ 80 (90) T cd00987 1 PWLGVTVQDLTPDLAEELGLKDTKGVLVASVDPGSPAAKAGLKPGDVILAVNGKPVKSVADLRRALAELKPGDKVTLTVL 80 (90) T ss_pred CCCCEEEEECCHHHHHHCCCCCCCEEEEEEECCCCHHHHCCCCCCCEEEEECCEECCCHHHHHHHHHHCCCCCEEEEEEE T ss_conf 94117987699999998498999779999989999599829999989999999993899999999982699987999999 Q ss_pred CCCCEEEECC Q ss_conf 4781665125 Q gi|254780700|r 363 KEGSKHSVAV 372 (489) Q Consensus 363 R~g~~~~~~V 372 (489) T Consensus 81 R~g~~~~~~v 90 (90) T cd00987 81 RGGKELTVTV 90 (90) T ss_pred ECCEEEEEEC T ss_conf 9999999789

HHsearch alignment for GI: 254780700 and conserved domain: cd00987