>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.

Probab=99.13 E-value=5.1e-10 Score=82.49 Aligned_cols=80 Identities=20% Similarity=0.305 Sum_probs=68.2 Q ss_pred CCCCEEEEECCHHHCC------EEEEEEEEECCCCHHHHCCCCCCCEEEEECCEECCCHHHHHHHHHHHHHCCCCEEEEE Q ss_conf 5254698728965715------2007999606889789829998889998899993899999999998862599569999 Q gi|254780700|r 392 ELLGMVLQDINDGNKK------LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465 (489) Q Consensus 392 ~~lGl~v~~l~~~~~~------~~gi~vv~v~~~s~Aa~~GL~~GDiIl~VNg~~V~s~~dl~~iL~~~k~~~~~~VLL~ 465 (489) T Consensus 1 p~lGi~~~~l~~~~~~~~~~~~~~Gv~V~~V~~~spA~~aGl~~GDiI~~ing~~i~~~~~~~~~l~~~~~--g~~v~~~ 78 (90) T cd00987 1 PWLGVTVQDLTPDLAEELGLKDTKGVLVASVDPGSPAAKAGLKPGDVILAVNGKPVKSVADLRRALAELKP--GDKVTLT 78 (90) T ss_pred CCCCEEEEECCHHHHHHCCCCCCCEEEEEEECCCCHHHHCCCCCCCEEEEECCEECCCHHHHHHHHHHCCC--CCEEEEE T ss_conf 94117987699999998498999779999989999599829999989999999993899999999982699--9879999 Q ss_pred EEECCCCC Q ss_conf 97177643 Q gi|254780700|r 466 IKYDPDMQ 473 (489) Q Consensus 466 V~r~~~~~ 473 (489) T Consensus 79 v~R~g~~~ 86 (90) T cd00987 79 VLRGGKEL 86 (90) T ss_pred EEECCEEE T ss_conf 99999999

HHsearch alignment for GI: 254780700 and conserved domain: cd00987