HHsearch alignment for GI: 254780701 and conserved domain: PRK09470

>PRK09470 cpxA two-component sensor protein; Provisional.
Probab=100.00  E-value=1.3e-44  Score=401.59  Aligned_cols=239  Identities=22%  Similarity=0.333  Sum_probs=210.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999998899999776420138999999999850336878937899999999999999999999
Q gi|254780701|r  227 ELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLIN  306 (495)
Q Consensus       227 ~l~~~~~~~~~a~~~ae~a~~~Ks~FlA~~SHELRTPL~aI~g~~elL~~~~~~~~~~~~~~~~l~~i~~s~~~L~~Li~  306 (495)
T Consensus       221 Ei~~La~~fN~M~~~L~~~~~~q~~f~advSHELRTPLt~i~~~~~ll~~~~~----~~---~~l~~i~~e~~rl~~li~  293 (461)
T PRK09470        221 EFRAAGASFNQMVTALERMMSSQQRLLSDISHELRTPLTRLQLATALLRRRQG----ES---KELERIETEAQRLDSMIN  293 (461)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCC----CH---HHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999986455532789999999998640447----85---999999999999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCHHCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99999874220015653101199999999999999997311221000367610104798999988777655688606798
Q gi|254780701|r  307 EILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIG  386 (495)
Q Consensus       307 ~lLdlsrleag~~~l~~~~v~L~~li~~~~~~~~~~A~~~~~~l~~~~~~~~~~v~~D~~~L~qvl~NLi~NAiK~T~~g  386 (495)
T Consensus       294 ~lL~lsr~~~~~-~~~~e~~~l~~l~~~v~~~~~~~a~~~~~~l~~~~~~~~~~v~~d~~~l~~vl~NLl~NAikys~~-  371 (461)
T PRK09470        294 DLLVLSRNQVKN-HLVRETIKANSLWSEVLEDAAFEAEQMGKSLTVNQPPGPWPINGNPNALESALENIVRNALRYSHT-  371 (461)
T ss_pred             HHHHHHHHCCCC-CCCCCEECHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEECHHHHHHHHHHHHHHHHHHCCC-
T ss_conf             999997620546-555651539999999999999999975976999727875489978999999999999999974899-


Q ss_pred             CEEEEEEEEECCCEEEEEEEECCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCE
Q ss_conf             87999999976985999998789978987854422652315777678999888058999999996198599997989952
Q gi|254780701|r  387 GRVHVTVGWTSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGV  466 (495)
Q Consensus       387 G~V~v~~~~~~~~~~~i~V~DtG~GI~~e~~~~iF~~F~r~~~~~~~~~~GtGLGLaIvk~lve~hgG~i~v~S~~G~Gt  466 (495)
T Consensus       372 -~i~v~~~~-~~~~~~i~V~D~G~GI~~e~l~~iFepFyR~d~sr~~~~gG~GLGLaIv~~iv~~hgG~i~~~~~~~~G~  449 (461)
T PRK09470        372 -KIEVGFSV-DKDGLTITVDDDGPGVPEEEREQIFRPFYRVDEARDRESGGTGLGLAIVENAIQQHRGWVKAEDSPLGGL  449 (461)
T ss_pred             -CEEEEEEE-ECCEEEEEEEECCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCEE
T ss_conf             -58999999-9999999999779998999998762797228988889999713889999999998299899997799856


Q ss_pred             EEEEEECHHH
Q ss_conf             9889847247
Q gi|254780701|r  467 EVIAILPNTR  476 (495)
Q Consensus       467 ~f~v~LP~~~  476 (495)
T Consensus       450 ~~~i~LPl~~  459 (461)
T PRK09470        450 RLTIWLPLYK  459 (461)
T ss_pred             EEEEEEECCC
T ss_conf             9999965889