RPSBLAST alignment for GI: 254780701 and conserved domain: PRK10364

>gnl|CDD|182411 PRK10364, PRK10364, sensor protein ZraS; Provisional. Length = 457
 Score = 96.8 bits (241), Expect = 1e-20
 Identities = 79/318 (24%), Positives = 146/318 (45%), Gaps = 44/318 (13%)

Query: 160 PYAVFLSF--FPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSC 217
           P A+F++F    +V A + +   ++ +L      +LA+ L+FF Y  Y            
Sbjct: 170 PQAIFIAFDASNLVSAQAREQRNTLIILFALATVLLASLLAFFWYRRY------------ 217

Query: 218 QAEKDDLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVI-EL 276
                     L   + L DE +++  E+ +A     A ++HE+R PL++I G ++   E 
Sbjct: 218 ----------LRSRQLLQDEMKRK--EKLVALGHLAAGVAHEIRNPLSSIKGLAKYFAER 265

Query: 277 ETMGPLNNETYKEYIGDIHRSGQHLLN-LINEILDLSRIEAGRYELSESAISLIDIVREC 335
              G   ++  +    +  R     LN +++E+L+L +       L+  A+ L D++   
Sbjct: 266 APAGGEAHQLAQVMAKEADR-----LNRVVSELLELVKPT----HLALQAVDLNDLINHS 316

Query: 336 IIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGW 395
           + ++   A  + I++    + +L  + AD   + QV+LNL  NA++     G + VT   
Sbjct: 317 LQLVSQDANSREIQLRFTANDTLPEIQADPDRLTQVLLNLYLNAIQAIGQHGVISVTASE 376

Query: 396 TSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQ 455
            SG G  IS+ D+G GIA  ++  + T +        +  +G GLGL +  +I+  HGG 
Sbjct: 377 -SGAGVKISVTDSGKGIAADQLEAIFTPY------FTTKAEGTGLGLAVVHNIVEQHGGT 429

Query: 456 FLIRSKLREGVEVIAILP 473
             + S+  +G      LP
Sbjct: 430 IQVASQEGKGATFTLWLP 447