RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780703|ref|YP_003065116.1| putative phosphate transport system protein [Candidatus Liberibacter asiaticus str. psy62] (229 letters) >gnl|CDD|31048 COG0704, PhoU, Phosphate uptake regulator [Inorganic ion transport and metabolism]. Length = 240 Score = 165 bits (419), Expect = 8e-42 Identities = 91/224 (40%), Positives = 130/224 (58%) Query: 4 HILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDI 63 S Y L L R++ MG ++ ++ A + LA +VI+ D +D LE +I Sbjct: 8 TGRSTYIVSLPKLWVRLLGMGAGVEVQLEDALEALLISPKELAEEVIELDEKIDDLEAEI 67 Query: 64 GDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWT 123 ++AI IA +QP+ASDLR I+ IKI+ADLERIGD A AK + LQ K++ Sbjct: 68 EEEAIRLIALQQPVASDLRLIISIIKISADLERIGDEAVEIAKNAIVLQSDEPDLKILEE 127 Query: 124 IEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNIT 183 + + E++L L + LD +R E + I RD E+D ++ L R+LLTYMMEDPRNI Sbjct: 128 LRRMGEIALSMLKDALDALANRDPELARDIIERDDEVDRLYFLLLRQLLTYMMEDPRNIR 187 Query: 184 LCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKED 227 LL ++N+ERIGDH NIAE + Y+ TG + E + +ED Sbjct: 188 DLVGLLLIARNLERIGDHAVNIAERVIYLVTGERAALEVLDEED 231 >gnl|CDD|145194 pfam01895, PhoU, PhoU domain. This family contains phosphate regulatory proteins including PhoU. PhoU proteins are known to play a role in the regulation of phosphate uptake. The PhoU domain is composed of a three helix bundle. The PhoU protein contains two copies of this domain. The domain binds to an iron cluster via its conserved E/DXXXD motif. Length = 87 Score = 76.3 bits (188), Expect = 7e-15 Identities = 34/89 (38%), Positives = 56/89 (62%), Gaps = 2/89 (2%) Query: 20 IVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMAS 79 ++ MG + +M+D ++ A D LA +VI+ D +D+L R+I ++ + +A +QP+ Sbjct: 1 LLRMGELVEEMLDDALEALENRDVELAREVIELDDEIDRLYREIEEELLELLALQQPL-- 58 Query: 80 DLREIVGSIKIAADLERIGDLAKNTAKRV 108 DLR ++ + IA DLERIGD A N A+ V Sbjct: 59 DLRLVISLLLIARDLERIGDHAVNIAEAV 87 Score = 64.7 bits (158), Expect = 2e-11 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 1/87 (1%) Query: 124 IEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMED-PRNI 182 + + EL E L + L+ +R E + + D E+D ++ + ELL + P ++ Sbjct: 1 LLRMGELVEEMLDDALEALENRDVELAREVIELDDEIDRLYREIEEELLELLALQQPLDL 60 Query: 183 TLCTHLLFCSKNIERIGDHVTNIAETI 209 L LL ++++ERIGDH NIAE + Sbjct: 61 RLVISLLLIARDLERIGDHAVNIAEAV 87 >gnl|CDD|31474 COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism]. Length = 533 Score = 40.2 bits (94), Expect = 5e-04 Identities = 34/196 (17%), Positives = 80/196 (40%), Gaps = 4/196 (2%) Query: 16 LSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQ 75 +R ++ +G +M++ + +IEGD ++ + +D+L +I + ++K Sbjct: 336 AAREVLRLGDSIEQMLER-LYEYIEGDAKKVKEIRKLEDAVDRLYEEI-KLYLARLSKEG 393 Query: 76 PMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLV-WT-IEPLAELSLE 133 + R I A +LE IGD+ + + G ++ L L+LE Sbjct: 394 LSEEESRRWAEIIDAAINLEHIGDIIERLLELADKKIANGRAFSEDGLEELDALFALTLE 453 Query: 134 QLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLFCSK 193 L + V + E + + R + + + L + + ++ + L + Sbjct: 454 NLRLAISVLVTGDLELARRLVERKKRVRRLERRSSKRHLDRLRDGAASVETSSLHLDILR 513 Query: 194 NIERIGDHVTNIAETI 209 +++RI H+ ++A + Sbjct: 514 DLKRINSHIASVAYPV 529 Score = 29.8 bits (67), Expect = 0.73 Identities = 20/95 (21%), Positives = 37/95 (38%), Gaps = 21/95 (22%) Query: 29 KMVDSSVR----AFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREI 84 + ++R + GD LA ++++ + +LER + + R LR+ Sbjct: 449 ALTLENLRLAISVLVTGDLELARRLVERKKRVRRLERRSSKRHL----DR------LRDG 498 Query: 85 VGSIK-------IAADLERIGDLAKNTAKRVLALQ 112 S++ I DL+RI + A VL Sbjct: 499 AASVETSSLHLDILRDLKRINSHIASVAYPVLEES 533 Score = 29.4 bits (66), Expect = 0.89 Identities = 18/102 (17%), Positives = 36/102 (35%), Gaps = 6/102 (5%) Query: 127 LAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMED--PRNITL 184 E LE+L E + +K + I + +D ++ + L E Sbjct: 346 SIEQMLERLYEYI----EGDAKKVKEIRKLEDAVDRLYEEIKLYLARLSKEGLSEEESRR 401 Query: 185 CTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKE 226 ++ + N+E IGD + + E + + E +E Sbjct: 402 WAEIIDAAINLEHIGDIIERLLELADKKIANGRAFSEDGLEE 443 >gnl|CDD|33084 COG3273, COG3273, Uncharacterized conserved protein [Function unknown]. Length = 204 Score = 34.1 bits (78), Expect = 0.029 Identities = 23/90 (25%), Positives = 46/90 (51%), Gaps = 4/90 (4%) Query: 20 IVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMAS 79 ++EM S MVD + + + G +A +V++ + +D+L K ++ +A R Sbjct: 15 LIEMKDTSELMVDLAYSSVLFGSEEIAEEVLELEERVDELNYQA--KMLLLLAARSV--E 70 Query: 80 DLREIVGSIKIAADLERIGDLAKNTAKRVL 109 + ++ +++A E+I D A + AK VL Sbjct: 71 EAESLLSILEVANANEKISDAAGDIAKLVL 100 >gnl|CDD|35053 COG5494, COG5494, Predicted thioredoxin/glutaredoxin [Posttranslational modification, protein turnover, chaperones]. Length = 265 Score = 33.1 bits (75), Expect = 0.073 Identities = 21/105 (20%), Positives = 41/105 (39%), Gaps = 4/105 (3%) Query: 18 RRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPM 77 I+ + + V S V + G ++ + L++ D+ ++A R + Sbjct: 81 ESILSGQVTKQIDVASLVEKLMLG--IVDSFAATAWLYLNRSLDPFLDQKDFSMAVRGKL 138 Query: 78 ASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVW 122 S L E G + + R G+L + R+L G R++ W Sbjct: 139 -SGLDEREGDY-LRNVMVREGELLEEWKPRLLRNLSSGFVREIFW 181 >gnl|CDD|38209 KOG2999, KOG2999, KOG2999, Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms]. Length = 713 Score = 27.6 bits (61), Expect = 2.9 Identities = 35/167 (20%), Positives = 59/167 (35%), Gaps = 24/167 (14%) Query: 49 VIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVG----------SIKIAADLER-I 97 + + +V +E D +I + P+AS + E+ ++++ AD R I Sbjct: 2 SLPSHIVKGAVEIDKEFAQLIPSDQLHPLASTINELCQGWSMNLHEDYALQLMADKNRYI 61 Query: 98 GDLAKNTAKRVLALQMFGVPRKLVWTI-EPLAELSLEQLSEILDVYGSRSTEKT--QSIC 154 + +N K LQ+ P I E L E + E L S S + T + Sbjct: 62 TEKNRNEIKNGFILQLCASPSHYAKRIMEILTEGNNISKMEALKELDSLSLDPTFAEEFI 121 Query: 155 NRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDH 201 G ELL ++ED R L + + +H Sbjct: 122 RCSG----------LELLFSLIEDGRVCMSSELLSTSLRAFSELMEH 158 >gnl|CDD|48114 cd03187, GST_C_Phi, GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Phi GST subfamily has experience extensive gene duplication. The Arabidopsis and Oryza genomes contain 13 and 16 Tau GSTs, respectively. They are primarily responsible for herbicide detoxification together with class Tau GSTs, showing class specificity in substrate preference. Phi enzymes are highly reactive toward chloroacetanilide and thiocarbamate herbicides. Some Phi GSTs have other functions including transport of flavonoid pigments to the vacuole, shoot regeneration and GSH peroxidase activity.. Length = 118 Score = 27.1 bits (60), Expect = 4.2 Identities = 13/40 (32%), Positives = 24/40 (60%) Query: 109 LALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTE 148 LA ++ P + T E + E + E+L ++LDVY +R ++ Sbjct: 24 LAFELVFKPMLGLPTDEAVVEENEEKLKKVLDVYEARLSK 63 >gnl|CDD|113294 pfam04518, DUF582, Protein of unknown function, DUF582. This family contains several uncharacterized chlamydial proteins. Length = 380 Score = 26.9 bits (60), Expect = 4.3 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 24/79 (30%) Query: 89 KIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTE 148 +I D++R AK VL KL+ I+ A+L+ EQ SE+LD Sbjct: 212 QIRRDIKRC-----ERAKAVLN--------KLLARIKADAKLTSEQKSELLD-------- 250 Query: 149 KTQSICNRDGELDAMHTSL 167 ++ N L+A+ L Sbjct: 251 ---TLNNYTDNLNAISNQL 266 >gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase kinase from the Raf family. ERK1/2 have numerous substrates, many of which are nuclear and participate in transcriptional regulation of many cellular processes. They regulate cell growth, cell proliferation, and cell cycle progression from G1 to S phase. Although the distinct roles of ERK1 and ERK2 have not been fully determined, it is known that ERK2 can maintain most functions in the absence of ERK1, and that the deletion of ERK2 is embryonically lethal. The MAPK, Fus3, regulates yeast mating processes including mating-specific gene expression, G1 arrest, mating projection, and cell fusion. Length = 336 Score = 26.5 bits (59), Expect = 5.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Query: 132 LEQLSEILDVYGSRSTEKTQSICNR 156 L QL+ IL V G+ S E I + Sbjct: 216 LHQLNLILGVLGTPSQEDLNCIISL 240 >gnl|CDD|29985 cd00984, DnaB_C, DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.. Length = 242 Score = 26.7 bits (59), Expect = 5.7 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 6/41 (14%) Query: 54 VVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADL 94 + L QL R + +A KR PM SDLRE GSI+ AD+ Sbjct: 167 IALSQLSRGVESRA----DKR-PMLSDLRE-SGSIEQDADV 201 >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.. Length = 362 Score = 26.4 bits (59), Expect = 6.8 Identities = 10/46 (21%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Query: 178 DPRNI--TLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKE 221 P NI LCTH+++ + + NI + + Y+ Sbjct: 19 VPENIDPFLCTHIIYAFAGL----NPDGNIIILDEWNDIDLGLYER 60 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0732 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,673,553 Number of extensions: 135828 Number of successful extensions: 354 Number of sequences better than 10.0: 1 Number of HSP's gapped: 347 Number of HSP's successfully gapped: 24 Length of query: 229 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 138 Effective length of database: 4,297,318 Effective search space: 593029884 Effective search space used: 593029884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.3 bits)