BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780703|ref|YP_003065116.1| putative phosphate transport system protein [Candidatus Liberibacter asiaticus str. psy62] (229 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780703|ref|YP_003065116.1| putative phosphate transport system protein [Candidatus Liberibacter asiaticus str. psy62] Length = 229 Score = 470 bits (1210), Expect = e-135, Method: Compositional matrix adjust. Identities = 229/229 (100%), Positives = 229/229 (100%) Query: 1 MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLE 60 MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLE Sbjct: 1 MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLE 60 Query: 61 RDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKL 120 RDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKL Sbjct: 61 RDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKL 120 Query: 121 VWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPR 180 VWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPR Sbjct: 121 VWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPR 180 Query: 181 NITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKEDCE 229 NITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKEDCE Sbjct: 181 NITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKEDCE 229 >gi|254780364|ref|YP_003064777.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 224 Score = 26.6 bits (57), Expect = 0.37, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Query: 10 DEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQL 59 D++L+F S + V + + ++ GDT+L HK D++LD L Sbjct: 69 DDKLEFCSIK------VDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSL 112 >gi|254780363|ref|YP_003064776.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 26.6 bits (57), Expect = 0.42, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 6/52 (11%) Query: 8 AYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQL 59 +D++L+F S + VE G ++ + ++ GDT+L HK +VLD L Sbjct: 67 CWDDKLEFFSIK-VEQGPLT-----THLQNIQPGDTILLHKKSTGTLVLDAL 112 >gi|254780600|ref|YP_003065013.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 200 Score = 24.6 bits (52), Expect = 1.3, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 67 AIITIAKRQPMASDLREIVGSIKIAADLERIG 98 A ITI R+ + S LRE + +K++ + RI Sbjct: 105 AAITILCREILVSGLREYLAELKVSVPVTRIA 136 >gi|254780286|ref|YP_003064699.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Candidatus Liberibacter asiaticus str. psy62] Length = 410 Score = 24.3 bits (51), Expect = 2.0, Method: Compositional matrix adjust. Identities = 14/63 (22%), Positives = 27/63 (42%), Gaps = 9/63 (14%) Query: 165 TSLFRELLTYMMEDPRNITLCTHLLF-----CSKNIERIGDHVTNIAETI----HYMTTG 215 ++ R L + M DPR + C L + S +GD++ + ++ H++ G Sbjct: 338 ANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFG 397 Query: 216 VQP 218 P Sbjct: 398 YIP 400 >gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Score = 23.5 bits (49), Expect = 3.5, Method: Compositional matrix adjust. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 30 MVDSSVRA-FIEGDTVLAHKVIDNDVVLDQLERD 62 + D+ V A + GD+ K + N+V +DQL +D Sbjct: 287 IFDAMVHAGYSNGDSAKIAKALKNEVRVDQLTKD 320 >gi|254780436|ref|YP_003064849.1| hypothetical protein CLIBASIA_01605 [Candidatus Liberibacter asiaticus str. psy62] Length = 298 Score = 23.5 bits (49), Expect = 3.6, Method: Compositional matrix adjust. Identities = 26/94 (27%), Positives = 40/94 (42%), Gaps = 25/94 (26%) Query: 76 PMASDLREIVGSIKIAADL-------------ERIGDLAKNTAKRVLALQM--------F 114 PMA +R+ ++KI D ER DL K A A+Q+ + Sbjct: 120 PMA--IRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWY 177 Query: 115 GVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTE 148 G R LV+ + E S+E S+ + +Y S S + Sbjct: 178 G--RALVYQMRGEYEKSIEDFSQAISLYSSISPD 209 >gi|254780480|ref|YP_003064893.1| 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 23.5 bits (49), Expect = 3.6, Method: Compositional matrix adjust. Identities = 13/58 (22%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Query: 59 LERDIGDKAIITIAKRQPMASDLREIVGSIK---IAADLERIGDLAKNTAKRVLALQM 113 L +++G KA++ + P + +I+G +K + + ER+ A+ + + AL++ Sbjct: 302 LPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKL 359 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 22.3 bits (46), Expect = 8.0, Method: Compositional matrix adjust. Identities = 6/22 (27%), Positives = 13/22 (59%) Query: 189 LFCSKNIERIGDHVTNIAETIH 210 FCS + ++ +HV +++ H Sbjct: 516 FFCSSQLSQLEEHVNSLSRITH 537 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 21.9 bits (45), Expect = 8.8, Method: Compositional matrix adjust. Identities = 12/41 (29%), Positives = 19/41 (46%) Query: 124 IEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMH 164 IE E+SL++L+ I+ YG E + + L H Sbjct: 143 IEKKIEISLQKLTSIIQNYGYADIEDLERAIKENKPLKPPH 183 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.136 0.383 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 135,892 Number of Sequences: 1233 Number of extensions: 5119 Number of successful extensions: 26 Number of sequences better than 100.0: 15 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 16 length of query: 229 length of database: 328,796 effective HSP length: 71 effective length of query: 158 effective length of database: 241,253 effective search space: 38117974 effective search space used: 38117974 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 37 (18.9 bits)