HHsearch alignment for GI: 254780707 and conserved domain: COG0226

>COG0226 PstS ABC-type phosphate transport system, periplasmic component [Inorganic ion transport and metabolism].
Probab=100.00  E-value=0  Score=381.03  Aligned_cols=268  Identities=23%  Similarity=0.365  Sum_probs=227.6

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             37679998034258999999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   24 ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        24 a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
T Consensus        41 ~~~~l~~~GSttv~p~~~~~a~~~~~~~~~~~v-~~q~~GSg~G~~~~~~~~----vDig~ss~p~~~~e~~~~~~~-~~  114 (318)
T COG0226          41 ASGSLTIAGSTTVAPLMEAWAEEFQKAYPNVKV-NVQAGGSGAGIKQALAGG----VDIGASSRPLKDSEKEADAKA-GK  114 (318)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHCCCEEE-EEECCCCHHHHHHHHCCC----CCCCCCCCCCCCCHHHHHHHC-CC
T ss_conf             543599836573899999999999987899478-763686618899875267----703135766663267998740-79


Q ss_pred             CCEEEEEECCCCEEEECCCCC-CCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHH
Q ss_conf             724666521541255416665-4568888888764102555553236730232310011122450354488542357899
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRDMV-SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL  182 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~~~-~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F  182 (346)
T Consensus       115 ~l~~~pva~d~i~vi~N~~~~~~~~Lt~~~l~~If-----------~G~it~W~d~~~~~~n~~I~vv~R~~~SGT~~~F  183 (318)
T COG0226         115 KLVEFPVAIDAIVVIVNLPNPDVLNLTKDQLADIF-----------SGKITNWNDVGGQLLNPGITVVGRSDGSGTTETF  183 (318)
T ss_pred             CCEEEEEEEEEEEEEECCCCCCCCCCCHHHHHHHH-----------HCCCCCCCCCCCCCCCCCCEEEECCCCCCHHHHH
T ss_conf             86697788777999975898541347999999997-----------0888755566865589985688478777769999


Q ss_pred             HHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCC
Q ss_conf             98851345556541011111013660001344431024664021166236777631015321001332001100111001
Q gi|254780707|r  183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL  262 (346)
Q Consensus       183 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~  262 (346)
T Consensus       184 ~~~l~~-~~~~------------------~~~g~~~~~~~--~~~~~~n~~v~~~v~~tp~aIGYv~~~y~~~n~~~~~~  242 (318)
T COG0226         184 TEYLLG-WKKK------------------VGAGKTVDWPA--AVGGKGNEGVVAAVSQTPGAIGYVGYAYAVQNNLKLAA  242 (318)
T ss_pred             HHHHHH-HHHC------------------CCCCCCCCCCC--EECCCCCHHHHHHHHCCCCCEEEEEEHHHHHCCCHHHH
T ss_conf             999876-5320------------------34566544564--00368857889888539984599986796524305666


Q ss_pred             CCCC------CCCCCHHHHCCCCC-CCEEEEEEEEECCCC-CCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHH
Q ss_conf             3445------76789556027987-503678999707885-6688999999997498740522027755963489999
Q gi|254780707|r  263 VPID------GIVPSMGTIVSGLY-PISRPLLFYVKRQHF-NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEE  332 (346)
Q Consensus       263 ~~~~------~v~p~~~~i~~g~Y-Pl~r~ly~yv~~~~~-~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~  332 (346)
T Consensus       243 ~~~~~~~~~~~v~p~~~~i~~~~y~Pi~~~~~~~v~~~~~~~~~~~~~~Fi~~~~~~~~~~---~~~~~Gyvplp~~~  317 (318)
T COG0226         243 LANKAGGVGPTVEPTAENIANGKYSPIVRPLFIYVNKNPKDTKAPAVKAFLDWALSPGGQQ---IVEEVGYVPLPDAV  317 (318)
T ss_pred             HHHCCCCCCCCCCCHHHHHHCCCCCCCEEEEEEEEECCCCCCCCHHHHHHHHHHHCCCCCE---EHHHCCEECCCCCC
T ss_conf             4201577666656457775337735512578999827766665889999999996787600---15208816187244