HHsearch alignment for GI: 254780707 and conserved domain: PRK04168

>PRK04168 hypothetical protein; Provisional.
Probab=99.24  E-value=1e-08  Score=67.29  Aligned_cols=117  Identities=16%  Similarity=0.181  Sum_probs=71.8

Q ss_pred             CCHHHHHHHHHHHHHHHHCCC---CCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCC
Q ss_conf             924899999999999983142---01376799980342589999999999987798079998157620578988521013
Q gi|254780707|r    1 MRFFFVVLMCFVVLEVYCGTG---TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD   77 (346)
Q Consensus         1 Mk~~~~~~~~~~~l~~~~~~~---~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~   77 (346)
T Consensus         5 ~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~l~Vf~AGSL~~pf~ei~~~Fe~~~p~v~v-~~e~~GS~~~ar~Ite~g--   81 (336)
T PRK04168          5 RRKIVIVILLLLALVFLGCVNTSEAEPPGKLKIFHAGSLSVPFEEYEKEFEAYYPNVDV-QREAGGSVACVRKITELG--   81 (336)
T ss_pred             CEEHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCEE-EEEECCHHHHHHHHHHCC--
T ss_conf             32203799999999970555777778861599997552589999999999987899659-998473899999999579--


Q ss_pred             CCCCEEECCCCCCHHHHHHHHHCCCCCCEEEEEECCCCEEEECCCCC
Q ss_conf             35301213320247678767624878724666521541255416665
Q gi|254780707|r   78 DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV  124 (346)
Q Consensus        78 ~~~dig~ssr~l~~~E~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~~  124 (346)
T Consensus        82 ~~aDVfaSAD~-~~--i~~ll~p~-~adw~v~FA~N~lViayt~~Sk  124 (336)
T PRK04168         82 KPADILASADY-TL--IPKMMIPE-YADWYVMFATNEIVLAYTDKSK  124 (336)
T ss_pred             CCCCEEEECCH-HH--HHHHHCCC-CCCCEEEECCCEEEEEECCCCC
T ss_conf             99888998985-78--78874644-3341012115538999768882