HHsearch alignment for GI: 254780707 and conserved domain: PRK09495

>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed.
Probab=96.77  E-value=0.014  Score=33.12  Aligned_cols=109  Identities=12%  Similarity=0.161  Sum_probs=62.1

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHH-----------HHHHHHHHHHCCCCEEEEEECCCCHHHHH
Q ss_conf             9248999999999999831420137679998034258999-----------99999999877980799981576205789
Q gi|254780707|r    1 MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYS-----------KIIAENFSEYFPEFKTPFVESGGSSVGLK   69 (346)
Q Consensus         1 Mk~~~~~~~~~~~l~~~~~~~~~a~~~I~i~GSst~~P~~-----------~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~   69 (346)
T Consensus         1 mk~~~~~~~~~~~~~~~~~~~a-~~~~l~Vg~~~~~pPf~f~~~g~~~GfdvDl~~~ia~~l-g~~~e-~~~~~~~~~i~   77 (247)
T PRK09495          1 MKSVLKVSLAALTLAFAVSSHA-ADKELVVATDTAFVPFEFKQGDKYVGFDVDLWAAIAKEL-KLDYT-LKPMDFSGIIP   77 (247)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHH-CCCEEEEEECCCCCCEEECCCCEEEEEHHHHHHHHHHHH-CCCEE-EEECCHHHHHH
T ss_conf             9779999999999999876651-499499998998798057679927882999999999996-99469-99778899999


Q ss_pred             HHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCCEEEEEECCCCEEEECCCC
Q ss_conf             885210133530121332024767876762487872466652154125541666
Q gi|254780707|r   70 EFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus        70 ~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~  123 (346)
T Consensus        78 ~l~~g----~~D~~~~~~~~T~eR~~~~~------FS-~py~~~~~~i~v~~~~  120 (247)
T PRK09495         78 ALQTK----NIDLALAGITITDERKKAID------FS-DGYYKSGLLVMVKANN  120 (247)
T ss_pred             HHHCC----CCCEEECCCCCCHHHHHHCC------CC-CCCEEEEEEEEEECCC
T ss_conf             99769----95636466014789984333------47-7707724699998999