HHsearch alignment for GI: 254780707 and conserved domain: PRK09501

>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed.
Probab=98.03  E-value=0.00075  Score=40.21  Aligned_cols=281  Identities=14%  Similarity=0.128  Sum_probs=124.1

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCC-CCCEEEEEE-CCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHH-HHHHHHHCCC
Q ss_conf             92489999999999998314201-376799980-34258999999999998779807999815762057-8988521013
Q gi|254780707|r    1 MRFFFVVLMCFVVLEVYCGTGTF-ARNRIRIAG-SSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVG-LKEFCRGIGD   77 (346)
Q Consensus         1 Mk~~~~~~~~~~~l~~~~~~~~~-a~~~I~i~G-Sst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~G-i~~~~~G~~~   77 (346)
T Consensus         1 ~~~~~~~ll~~~a~~l~~~~~~a~~~~~L~i~~W~~Yi---~~~~i~~Fe~et-GikV-~~~~~~s~ee~~akL~a~~-~   74 (348)
T PRK09501          1 MKKWSRHLLAAGALALGMSAAHADDNNTLYFYNWTEYV---PPGLLEQFTKET-GIKV-IYSTYESNETMYAKLKTYK-D   74 (348)
T ss_pred             CHHHHHHHHHHHHHHHHCCHHHHCCCCEEEEECCCCCC---CHHHHHHHHHHH-CCEE-EEEECCCHHHHHHHHHCCC-C
T ss_conf             93689999999999973503354338979998710018---978999999998-9889-9995499999999997179-9


Q ss_pred             CCCCEEECCCCCC-------------HHHHHHHH-------HCCC--CCCEEEEEECCCCEEEECCCCCCCCCCHHHHHH
Q ss_conf             3530121332024-------------76787676-------2487--872466652154125541666545688888887
Q gi|254780707|r   78 DTIDIVNSSRKIT-------------QNELDECK-------KHGV--SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK  135 (346)
Q Consensus        78 ~~~dig~ssr~l~-------------~~E~~~~~-------~~~~--~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~  135 (346)
T Consensus        75 ~~yDvv~ps~~~v~~l~~~gll~~LD~s~ipN~~nl~p~~~~~~~dp~~~y~vPy~wGt~Gi~yn~d~v~----------  144 (348)
T PRK09501         75 GAYDLVVPSTYYVDKMRKEGMIQKIDKSKLTNFSNLDPDMLNKPFDPNNDYSIPYIWGATAIGVNGDAVD----------  144 (348)
T ss_pred             CCCEEEEECHHHHHHHHHCCCCCCCCHHHCCCHHHCCHHHHCCCCCCCCCEEEEEEEECCEEEEEECCCC----------
T ss_conf             9828999796899999977984547842284812269767447748998489889975115998501147----------


Q ss_pred             HHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHHHHCCCCC-CCCCCHHHHHHCCCCCCHHCCCC
Q ss_conf             64102555553236730232310011122450354488542357899988513455-56541011111013660001344
Q gi|254780707|r  136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGC-VRSRNFSKMRDMFKYNVQQLSVA  214 (346)
Q Consensus       136 ~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~~~v~~~~~-~~~~~~~~~~~~~~~~~~~~~~~  214 (346)
T Consensus       145 -------------~~~~~SW~dL~d--p~~kGki~~~d~~---~~~~~~al~~lG~~~n~~d~~~l~-~a~~~L~~~~--  203 (348)
T PRK09501        145 -------------PKSVTSWADLWK--PEYKGSLLLTDDA---REVFQMALRKLGYSGNTTDPKEIE-AAYNELKKLM--  203 (348)
T ss_pred             -------------CCCCCCHHHHCC--HHHCCEEEECCCH---HHHHHHHHHHHCCCCCCCCHHHHH-HHHHHHHHHH--
T ss_conf             -------------888887898549--6647907971667---899999999827998889999999-9999999851--


Q ss_pred             CCCCCCCCCCEECCCCHHHHHHHHCCCCC--CCCCCCCCHHHHCCCCCCCCCCCCCCCCHHHHCCCCCCCEEEEEEEEEC
Q ss_conf             43102466402116623677763101532--1001332001100111001344576789556027987503678999707
Q gi|254780707|r  215 CTSVRQDGIAIEVDGDYTETLARIEVNKD--VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKR  292 (346)
Q Consensus       215 ~~~~~~~~~~i~~~~~~~~~~~~v~~~~~--~igy~~~~~~~~~~~~~~~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~  292 (346)
T Consensus       204 -------~~i~~~~sd--~~~~~l~~Gev~ia~~wsgda~~~~----~~~~~i~~v~Pk-----EG~~~w-~D~~~Ipk~  264 (348)
T PRK09501        204 -------PNVAAFNSD--NPANPYMEGEVNLGMIWNGSAFVAR----QAGTPIDVVWPK-----EGGIFW-MDSLAIPAN  264 (348)
T ss_pred             -------CCEEEEECC--CHHHHHHCCCCEEEEEECHHHHHHH----HCCCCCCEEECC-----CCCEEE-EEEEEEECC
T ss_conf             -------105898177--0546987388329987405899999----708997189757-----886699-899889899


Q ss_pred             CCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             8856688999999997498740522027755963489999999999996
Q gi|254780707|r  293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA  341 (346)
Q Consensus       293 ~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~~~~~~~~~  341 (346)
T Consensus       265 --A~n~e~A~~FInf~l~Pevaa~--~a~~~~y~t~n~~A~~~l~~e~~  309 (348)
T PRK09501        265 --AKNKEGALKLINFLLRPDVAKQ--VAETIGYPTPNLAARKLLSPEVA  309 (348)
T ss_pred             --CCCHHHHHHHHHHHHCHHHHHH--HHHHHCCCCHHHHHHHHCCHHHH
T ss_conf             --9898999999998619799999--99974889830888861899886