HHsearch alignment for GI: 254780707 and conserved domain: PRK10677

>PRK10677 modA molybdate transporter periplasmic protein; Provisional.
Probab=99.27  E-value=1.7e-09  Score=71.66  Aligned_cols=251  Identities=15%  Similarity=0.182  Sum_probs=130.7

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCC
Q ss_conf             24899999999999983142013767999803425899999999999877980799981576205789885210133530
Q gi|254780707|r    2 RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID   81 (346)
Q Consensus         2 k~~~~~~~~~~~l~~~~~~~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~d   81 (346)
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~a~~~~l~V~aAAsL~~~~~ei~~~Fek~~-g~~v-~~~fgsSg~L~~QI~~GA---p~D   77 (257)
T PRK10677          3 RKWLNLFAGAALSFAVAGNALADEGKITVFAAASLTNAMQDIATQYKKEK-GVDV-VSSFASSSTLARQIEAGA---PAD   77 (257)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHH-CCEE-EEEECCHHHHHHHHHCCC---CCC
T ss_conf             28999999999987235533256885999992576899999999998841-9849-999664899999998289---965


Q ss_pred             EE-ECCCCCCHHHHHHHHHCCCCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             12-13320247678767624878724666521541255416665456888888876410255555323673023231001
Q gi|254780707|r   82 IV-NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRP  160 (346)
Q Consensus        82 ig-~ssr~l~~~E~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~  160 (346)
T Consensus        78 vF~sAd~~~~~-~l~~--~~~i~~~~~~~~a~n~lvli~pk~~~~~~~~i-------------------~~~~d~~~ll-  134 (257)
T PRK10677         78 LFISADQKWMD-YAVD--KKAIDTATRQTLLGNSLVVVAPKASEQKDFTI-------------------DKKTDWTSLL-  134 (257)
T ss_pred             EEEECCHHHHH-HHHH--CCCCCCCCEEEEECCEEEEEEECCCCCCCCCC-------------------CCCCCHHHHC-
T ss_conf             89978757789-9986--77856776456214749999846877786443-------------------4332377742-


Q ss_pred             CCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCC
Q ss_conf             11224503544885423578999885134555654101111101366000134443102466402116623677763101
Q gi|254780707|r  161 DFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV  240 (346)
Q Consensus       161 ~lp~~~I~~~~r~~~SGT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~  240 (346)
T Consensus       135 --~~~riaia~P~--~aP~G~ya~~~L~~~gl~~~l~-------------------------~klv~~~nV~~~l~~v~~  185 (257)
T PRK10677        135 --NGGRLAVGDPD--HVPAGIYAKEALQKLGAWDTLS-------------------------PKLAPAEDVRGALALVER  185 (257)
T ss_pred             --CCCCEEEECCC--CCCCHHHHHHHHHHCCCHHHHC-------------------------CCEEECCCHHHHHHHHHC
T ss_conf             --58808985888--8865799999999767665506-------------------------541325769999999982


Q ss_pred             CCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCHHHHCCCCC-CCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCH
Q ss_conf             5321001332001100111001344576789556027987-503678999707885668899999999749874052202
Q gi|254780707|r  241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ  319 (346)
Q Consensus       241 ~~~~igy~~~~~~~~~~~~~~~~~~~~v~p~~~~i~~g~Y-Pl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~  319 (346)
T Consensus       186 G~adaG~Vy~Sda~~~-~~~~~~---~~~p~~------~~~pi~y~~ai-~~~~---~~~~a~~F~~fl~S~~a~~---I  248 (257)
T PRK10677        186 NEAPLGIVYGSDAVAS-KGVKVV---ATFPED------SHKKVEYPMAI-VEGH---NNATVSAFYDYLKGPQAAE---I  248 (257)
T ss_pred             CCCCEEEEECCHHHCC-CCCEEE---EECCHH------HCCCCEEEEEE-ECCC---CCHHHHHHHHHHCCHHHHH---H
T ss_conf             9987899970002226-886499---987745------38961455899-7599---9999999999977999999---9


Q ss_pred             HHHCCCC
Q ss_conf             7755963
Q gi|254780707|r  320 LFQYGLI  326 (346)
Q Consensus       320 ~~~~Gyv  326 (346)
T Consensus       249 l~~~GFt  255 (257)
T PRK10677        249 FKRYGFT  255 (257)
T ss_pred             HHHHCCC
T ss_conf             9982983