HHsearch alignment for GI: 254780707 and conserved domain: PRK11013

>PRK11013 DNA-binding transcriptional regulator LysR; Provisional.
Probab=93.68  E-value=0.44  Score=24.77  Aligned_cols=121  Identities=9%  Similarity=0.029  Sum_probs=69.4

Q ss_pred             CCCEEEEEECCHHH-HHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             37679998034258-99999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   24 ARNRIRIAGSSTLF-PYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        24 a~~~I~i~GSst~~-P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
T Consensus        92 ~~G~lri~~~~~~~~~~lp~~l~~f~~~~P~v~v~-i~~~~~~~~~~~l~~~~----~Dl~l~~~~~~~~~---------  157 (309)
T PRK11013         92 RQGQLSIACLPVFSQSLLPGLCQPFLARYPDVSLN-IVPQESPLLEEWLSAQR----HDLGLTETLHTPAG---------  157 (309)
T ss_pred             CCCCCCCCCCHHHHHHHCCHHHHHHHHHCCCCEEE-EEECCHHHHHHHHHCCC----CCEEEEECCCCCCC---------
T ss_conf             36765653006789886652315678438980799-99898599999997599----77899607889987---------


Q ss_pred             CCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHH
Q ss_conf             87246665215412554166654568888888764102555553236730232310011122450354488542357899
Q gi|254780707|r  103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL  182 (346)
Q Consensus       103 ~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F  182 (346)
T Consensus       158 --~~~~~l~~~~~~~v~~~~hpla~----------------------~~~i~~~dL~----~~~~i~--~~~~~~~r~~~  207 (309)
T PRK11013        158 --TERTELLTLDEVCVLPDGHPLAA----------------------KKVLTPDDFQ----GENFIS--LSRTDSYRQLL  207 (309)
T ss_pred             --CEEEEEEEEEEEEECCCCCCCCC----------------------CCCCCHHHHC----CCCEEE--CCCCCCHHHHH
T ss_conf             --57888642014675478980004----------------------9999999973----898696--38999499999


Q ss_pred             HHHHCC
Q ss_conf             988513
Q gi|254780707|r  183 EKKVLQ  188 (346)
Q Consensus       183 ~~~v~~  188 (346)
T Consensus       208 ~~~~~~  213 (309)
T PRK11013        208 DQLFAE  213 (309)
T ss_pred             HHHHHH
T ss_conf             999997