HHsearch alignment for GI: 254780707 and conserved domain: PRK11151

>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional.
Probab=97.27  E-value=0.011  Score=33.72  Aligned_cols=200  Identities=12%  Similarity=0.055  Sum_probs=112.5

Q ss_pred             CCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             376799980342589-9999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   24 ARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        24 a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
T Consensus        89 ~~G~lrig~~~~~~~~llp~~l~~f~~~~P~v~i~-l~~~~~~~l~~~l~~g~----~D~~i~~~~~~~~----------  153 (305)
T PRK11151         89 MSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMY-LHEAQTHQLLAQLDSGK----LDCAILALVKESE----------  153 (305)
T ss_pred             CCCEEEEEEHHHHHHHCCCHHHHHHHHCCCCCEEE-EEECCCHHHHHHHHCCC----CCEEEEECCCCCC----------
T ss_conf             76414311022233323827799986238983799-99887577787865788----5379984588998----------


Q ss_pred             CCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHH
Q ss_conf             87246665215412554166654568888888764102555553236730232310011122450354488542357899
Q gi|254780707|r  103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL  182 (346)
Q Consensus       103 ~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F  182 (346)
T Consensus       154 -~~~~~~l~~e~l~lv~~~~hpla~~----------------------~~i~l~~L~----~~~~--i~~~~~~~~r~~~  204 (305)
T PRK11151        154 -AFIEVPLFDEPMLLAVYEDHPWANR----------------------DRVPMSDLA----GEKL--LMLEDGHCLRDQA  204 (305)
T ss_pred             -CCEEEEECCCCEEEEEECCCCCCCC----------------------CCCCHHHHC----CCCE--EEECCCCCHHHHH
T ss_conf             -7268762046279999589843369----------------------998999976----9988--9968998599999


Q ss_pred             HHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHC--CCCC
Q ss_conf             98851345556541011111013660001344431024664021166236777631015321001332001100--1110
Q gi|254780707|r  183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN--ADVL  260 (346)
Q Consensus       183 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~--~~~~  260 (346)
T Consensus       205 ~~~~~~~g~~~~~-----------------------------~~~~~~~~~i~~lV~-~G~Gv~ilp~~~v~~~~~~~~l  254 (305)
T PRK11151        205 MGFCFEAGADEDT-----------------------------HFRATSLETLRNMVA-AGSGITLLPALAVPNERKRDGV  254 (305)
T ss_pred             HHHHHHCCCCCCE-----------------------------EEEEECHHHHHHHHH-HCCCEEECCHHHHHHHCCCCCE
T ss_conf             9999977999873-----------------------------899944799999999-2996898359998622126988


Q ss_pred             CCCCCCCCCCCHHHHCCCCCC-CEEEEEEEEECCCCCCCHHHHHHHHHHHCH
Q ss_conf             013445767895560279875-036789997078856688999999997498
Q gi|254780707|r  261 KLVPIDGIVPSMGTIVSGLYP-ISRPLLFYVKRQHFNSVLGLREYVSFSVSD  311 (346)
Q Consensus       261 ~~~~~~~v~p~~~~i~~g~YP-l~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~  311 (346)
T Consensus       255 ~~~pl-------------~~~~~~r~i~lv~r~-~~~ls~~~~~~~e~ir~~  292 (305)
T PRK11151        255 CYLPC-------------IKPEPRRTIGLVYRP-GSPLRSRYEQLAEAIRAR  292 (305)
T ss_pred             EEEEC-------------CCCCCEEEEEEEEEC-CCCCCHHHHHHHHHHHHH
T ss_conf             99988-------------899973699999989-098789999999999998