HHsearch alignment for GI: 254780707 and conserved domain: PRK12681

>PRK12681 cysB transcriptional regulator CysB; Reviewed.
Probab=97.19  E-value=0.013  Score=33.28  Aligned_cols=124  Identities=13%  Similarity=0.103  Sum_probs=82.8

Q ss_pred             CCCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCC
Q ss_conf             1376799980342589-999999999987798079998157620578988521013353012133202476787676248
Q gi|254780707|r   23 FARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHG  101 (346)
Q Consensus        23 ~a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~  101 (346)
T Consensus        90 ~~~G~L~Ia~~~t~a~~~LP~~i~~F~~~~P~v~l~-l~~~~~~~i~~~l~~g~----~DlaI~~e~~~~----------  154 (324)
T PRK12681         90 PDKGSLYIATTHTQARYALPPVIKGFIKRYPRVSLH-MHQGSPTQIAEAAAKGE----ADFAIATEALHL----------  154 (324)
T ss_pred             CCCCEEEEEECHHHHHHHHHHHHHHHHHHCCCCCEE-EEECCHHHHHHHHHCCC----CCCCCCCCCCCC----------
T ss_conf             876349998535888877259999999878998446-53178799999998799----872312466666----------


Q ss_pred             CCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHH
Q ss_conf             78724666521541255416665456888888876410255555323673023231001112245035448854235789
Q gi|254780707|r  102 VSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV  181 (346)
Q Consensus       102 ~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~  181 (346)
T Consensus       155 ~~dl~~~P~~~~~~~vvvp~~HPLa~~~----------------------~itl~dL----~~~plI~~--~~g~~~R~~  206 (324)
T PRK12681        155 YDDLIMLPCYHWNRSVVVPPDHPLAKKK----------------------KLTIEEL----AQYPLVTY--VFGFTGRSE  206 (324)
T ss_pred             CCCCEEEEEEECCCCCCCCCCCCCCCCC----------------------CCCHHHH----CCCCEEEE--CCCCCHHHH
T ss_conf             8874686400032224579999655799----------------------9999998----69985961--499829999


Q ss_pred             HHHHHCCC
Q ss_conf             99885134
Q gi|254780707|r  182 LEKKVLQE  189 (346)
Q Consensus       182 F~~~v~~~  189 (346)
T Consensus       207 id~~f~~~  214 (324)
T PRK12681        207 LDTAFNRA  214 (324)
T ss_pred             HHHHHHHC
T ss_conf             99999988