HHsearch alignment for GI: 254780707 and conserved domain: TIGR00975

>TIGR00975 3a0107s03 phosphate ABC transporter, phosphate-binding protein PstS; InterPro: IPR005673 This family represents a sub-group of the phosphate-binding periplasmic proteins, one of the bacterial proteins required for binding-protein-mediated phosphate transport. The accumulation of protein is enhanced under phosphate starvation. ; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport.
Probab=99.21  E-value=1.6e-11  Score=82.82  Aligned_cols=272  Identities=18%  Similarity=0.215  Sum_probs=175.4

Q ss_pred             EEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCCEEE
Q ss_conf             99803425899999999999877980799981576205789885210133530121332024767876762487872466
Q gi|254780707|r   29 RIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV  108 (346)
Q Consensus        29 ~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~~~~  108 (346)
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~-~~~~~~~~~--~~~~~   74 (324)
T TIGR00975         2 TGAGSTFPAPLYSKWFADYSKSNPAKVTVNYQGIGSGAGIAQFLAGT----VDFGASDAPLSE-EAAALASAG--GLLQL   74 (324)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCC----CCCCCCCHHHHH-HHHHHHHCC--CCCCC
T ss_conf             65421012233332222222101232110112233200122222000----001111002234-455542011--10001


Q ss_pred             EEECCCCEEEECCCCCCC---CCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHC-------CCC-CCCCCCEEECCCCCCC
Q ss_conf             652154125541666545---68888888764102555553236730232310-------011-1224503544885423
Q gi|254780707|r  109 TIGHDGILLVSDRDMVSV---SLTVEDLYKALASYLIVDDKVVFNPLKKWSEI-------RPD-FPEVRIAIYVPSGKHG  177 (346)
Q Consensus       109 ~v~~d~i~i~~n~~~~~~---~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~-------~~~-lp~~~I~~~~r~~~SG  177 (346)
T Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  143 (324)
T TIGR00975        75 PTVIGAVVVAYNLPGVSKGELKLDGAVLA-----------KIFLGKIKTWNDPAIAALNPGVKDLPGTAITVVHRSDGSG  143 (324)
T ss_pred             CCCCCCHHCCCCCCCCCCCCCCCCCCHHH-----------HHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCEEECCCCCC
T ss_conf             00000000000112222110122320010-----------0100110012311233210110112321110000111223


Q ss_pred             HHHHHHHHHCCCCCCCC---CCHHHHHHCCC---CCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             57899988513455565---41011111013---6600013444310246640211662367776310153210013320
Q gi|254780707|r  178 TREVLEKKVLQEGCVRS---RNFSKMRDMFK---YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLS  251 (346)
Q Consensus       178 T~~~F~~~v~~~~~~~~---~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~  251 (346)
T Consensus       144 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------~~~~~~~~~~~~~~~~  203 (324)
T TIGR00975       144 TTFVFTNYLSKVSPEWKSKVGAGKTVNWPAGDGAVGGKGNDGVS--------------------AAVKQTPGAIGYVELS  203 (324)
T ss_pred             CCCCCCHHHHHCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCE--------------------EECCCCCCCCCHHHHH
T ss_conf             20000001100010000112233212233322111223333210--------------------0000122210000112


Q ss_pred             HHHHCCCCCCCCC----------------------------CCCCCCCHHHHCCCCCCCEEEEEEEEEC--CC--CCCCH
Q ss_conf             0110011100134----------------------------4576789556027987503678999707--88--56688
Q gi|254780707|r  252 FYKNNADVLKLVP----------------------------IDGIVPSMGTIVSGLYPISRPLLFYVKR--QH--FNSVL  299 (346)
Q Consensus       252 ~~~~~~~~~~~~~----------------------------~~~v~p~~~~i~~g~YPl~r~ly~yv~~--~~--~~~~~  299 (346)
T Consensus       204 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  283 (324)
T TIGR00975       204 YAKLNKLSFAALKNSAGKFVLPDAESIAAAAAGAKISGPELKNDLLSLTDAPGAGAYPIVAATYLIVYKKQKDLRPAKAK  283 (324)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             23332111222100023211111002234443321100011111000012334321100012333322101220134455


Q ss_pred             HHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHHHHHHHHHHHC
Q ss_conf             9999999974987405220277559634899999999999960
Q gi|254780707|r  300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV  342 (346)
Q Consensus       300 ~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~~~~~~~~~~  342 (346)
T Consensus       284 ~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~  322 (324)
T TIGR00975       284 ALKAFLTWALTNGQK----GADDLGYIPLPPSVVKRVRTAVNT  322 (324)
T ss_pred             HHHHHHHHHHCCCCH----HHCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             555443321101000----100112111211233332212100