HHsearch alignment for GI: 254780707 and conserved domain: TIGR03261

>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transport system, 1-aminoethylphosphonate-binding protein component. This ABC transporter extracellular solute-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=99.04  E-value=5.2e-08  Score=63.34  Aligned_cols=261  Identities=13%  Similarity=0.043  Sum_probs=120.2

Q ss_pred             HHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHH
Q ss_conf             99983142013767999803425899999999999877980799981576205789885210133530121332024767
Q gi|254780707|r   14 LEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNE   93 (346)
Q Consensus        14 l~~~~~~~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E   93 (346)
T Consensus        10 ~~~~~a~aa~~~~~l~VYss~-~~~~~~~i~~~Fek~~tgIkV~-~v~~~tgel~~rl~aEk~~p~aDV~~g~~~~~~~~   87 (334)
T TIGR03261        10 SLFFSACNSKANTELTVYTAI-EDELIAKYKDAFEKVNPDIKIN-WVRDSTGIITAKLLAEKNNPQADVVWGLAASSLAL   87 (334)
T ss_pred             HHHHHHHHHCCCCEEEEEECC-CHHHHHHHHHHHHHHCCCCEEE-EEECCHHHHHHHHHHCCCCCCCEEEEECCHHHHHH
T ss_conf             999983103029959999699-8889999999999777994899-99897299999999645799865998456578999


Q ss_pred             H--------------HHHHHCCCC---CCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHH
Q ss_conf             8--------------767624878---72466652154125541666545688888887641025555532367302323
Q gi|254780707|r   94 L--------------DECKKHGVS---DIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWS  156 (346)
Q Consensus        94 ~--------------~~~~~~~~~---~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~  156 (346)
T Consensus        88 ~~~~gll~~y~~~~~~~l~~~~~d~~~~~~~~g~~~~~~~i~yN~~~~~~--------------------~~~p~P~sw~  147 (334)
T TIGR03261        88 LDKEGMLKPYKPKGLDALNPKFRDAKNPPHWVGMDAWMAAICFNTVEAKK--------------------KGLPKPTSWE  147 (334)
T ss_pred             HHHCCCCCCCCCCCHHHCCHHHCCCCCCCEEEEEEEEEEEEEEEHHHCCC--------------------CCCCCCCCHH
T ss_conf             88604315777530544788652978885168875246789974444042--------------------5899999999


Q ss_pred             HCCCCCCCCCCEEECC-CCCCCHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHH
Q ss_conf             1001112245035448-854235789998851345556541011111013660001344431024664021166236777
Q gi|254780707|r  157 EIRPDFPEVRIAIYVP-SGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL  235 (346)
Q Consensus       157 ~~~~~lp~~~I~~~~r-~~~SGT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~  235 (346)
T Consensus       148 DL~d--p~ykg~i~~~~p~~sg~~~~~l~~~~~~~G~d----~g~~~l~~--l~~N------------~~~~~~~~~~~~  207 (334)
T TIGR03261       148 DLTK--PEYKGHIVMPNPASSGTGFLDVSAWLQMMGED----KGWDYMDK--LHKN------------IAVYTHSGSKPC  207 (334)
T ss_pred             HHCC--HHHCCEEECCCCCCCHHHHHHHHHHHHHHCHH----HHHHHHHH--HHHH------------HCCCCCCCCHHH
T ss_conf             9709--47489587348886338999999999973528----89999999--9863------------241677763888


Q ss_pred             HHHCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCC
Q ss_conf             63101532100133200110011100134457678955602798750367899970788566889999999974987405
Q gi|254780707|r  236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA  315 (346)
Q Consensus       236 ~~v~~~~~~igy~~~~~~~~~~~~~~~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~  315 (346)
T Consensus       208 ~~v~~Ge~~ig~~~~~~~~--~~~~~g~pv~~v~P~-----eG~~~~~~~~~-Ivk~a--~n~~~Ak~FidfllS~e~Q~  277 (334)
T TIGR03261       208 KLAGMGEFPIGISMAYRAL--KEKKKGAPIDVVFPK-----EGLGWDIEATA-IIKGS--KNNDAAKKLVDWSISDEAME  277 (334)
T ss_pred             HHHHCCCEEEEEEECCHHH--HHHHCCCCEEEEECC-----CCCEEEEEEEE-EECCC--CCHHHHHHHHHHHCCHHHHH
T ss_conf             9986598579997354578--876438973389458-----98478773588-88799--89899999999976999999


Q ss_pred             CCCHHHHCCCCCCC
Q ss_conf             22027755963489
Q gi|254780707|r  316 PDSQLFQYGLIPIS  329 (346)
Q Consensus       316 ~~~~~~~~GyvPLp  329 (346)
T Consensus       278 ---~~a~~~~~p~~  288 (334)
T TIGR03261       278 ---LYAKNYAVVAT  288 (334)
T ss_pred             ---HHHHCCEECCC
T ss_conf             ---99964903468