HHsearch results for GI: 254780707 and protein with PDBid: 1al3_A

>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1
Probab=97.48  E-value=0.0036  Score=35.17  Aligned_cols=203  Identities=9%  Similarity=0.018  Sum_probs=115.8

Q ss_pred             CCCCEEEEEECCHHH-HHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCC
Q ss_conf             137679998034258-9999999999987798079998157620578988521013353012133202476787676248
Q gi|254780707|r   23 FARNRIRIAGSSTLF-PYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHG  101 (346)
Q Consensus        23 ~a~~~I~i~GSst~~-P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~  101 (346)
                      ....+|+|+.+.+.. .++..+...|.+.+|++.+. +....+..-+..+.+|.    +||+.+..+....         
T Consensus        90 ~~~g~l~i~~~~~~~~~~l~~~l~~~~~~~P~i~i~-l~~~~~~~~~~~l~~~~----~D~~i~~~~~~~~---------  155 (324)
T 1al3_A           90 PDKGSLYVATTHTQARYALPGVIKGFIERYPRVSLH-MHQGSPTQIAEAVSKGN----ADFAIATEALHLY---------  155 (324)
T ss_dssp             CCEEEEEEEECHHHHHHTSHHHHHHHHHHCTEEEEE-EEECCHHHHHHHHHTTC----CSEEEESSCCCTT---------
T ss_pred             CCCCCEEEEECHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCHHHHHHHHHCCC----EEEEEECCCCCCC---------
T ss_conf             566750675336878878999999999758982899-99798799986674798----2588630676776---------


Q ss_pred             CCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHH
Q ss_conf             78724666521541255416665456888888876410255555323673023231001112245035448854235789
Q gi|254780707|r  102 VSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV  181 (346)
Q Consensus       102 ~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~  181 (346)
                       ......++..+.++++++++.+....                      +...|.|+    .+.|..  .++++++++..
T Consensus       156 -~~~~~~~l~~~~~~~~~~~~~~l~~~----------------------~~i~~~dL----~~~~~i--~~~~~~~~~~~  206 (324)
T 1al3_A          156 -DDLVMLPCYHWNRSIVVTPEHPLATK----------------------GSVSIEEL----AQYPLV--TYTFGFTGRSE  206 (324)
T ss_dssp             -SCEEEEEEEEECEEEEECTTSTTTTT----------------------SCCCHHHH----HTSEEE--EECTTSTTHHH
T ss_pred             -CCEEEEEEEEEEEEEEECCCCHHCCC----------------------CCCCHHHH----HHCCCE--ECCCCCCHHHH
T ss_conf             -65058986530057997465221039----------------------99999999----628772--04899848999


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCC
Q ss_conf             99885134555654101111101366000134443102466402116623677763101532100133200110011100
Q gi|254780707|r  182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK  261 (346)
Q Consensus       182 F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~  261 (346)
                      +.+.........                             ..+-..++...+.+.+... .++++++...+...     
T Consensus       207 ~~~~~~~~~~~~-----------------------------~~~~~~~~~~~~~~~v~~g-~gi~~lp~~~~~~~-----  251 (324)
T 1al3_A          207 LDTAFNRAGLTP-----------------------------RIVFTATDADVIKTYVRLG-LGVGVIASMAVDPV-----  251 (324)
T ss_dssp             HHHHHHHHTCCC-----------------------------EEEEEESSHHHHHHHHHHT-SCEEEEEGGGCCTT-----
T ss_pred             HHHHHHHCCCCC-----------------------------CEEEEECCHHHHHHHHHHC-CEEEECHHHHHHHH-----
T ss_conf             999999769987-----------------------------5699999999999999939-97997259897387-----


Q ss_pred             CCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             1344576789556027987503678999707885668899999999749
Q gi|254780707|r  262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS  310 (346)
Q Consensus       262 ~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls  310 (346)
                            ..+..-.+.-...+..|++|+..+++ ....+.+++|+.++-.
T Consensus       252 ------~~~~lv~~~~~~~~~~~~~~l~~r~~-~~~s~~~~~fi~~~~~  293 (324)
T 1al3_A          252 ------SDPDLVKLDANGIFSHSTTKIGFRRS-TFLRSYMYDFIQRFAP  293 (324)
T ss_dssp             ------TCTTSEEEECBTTBCCEEEEEEEETT-CCCCHHHHHHHHHHCT
T ss_pred             ------HCCCEEEEECCCCCCCCEEEEEEECC-CCCCHHHHHHHHHHHH
T ss_conf             ------48998999587888655799999696-8569999999999998