HHsearch results for GI: 254780707 and protein with PDBid: 1urs_A

>1urs_A Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius} SCOP: c.94.1.1 PDB: 1urg_A* 1urd_A*
Probab=96.03  E-value=0.056  Score=28.56  Aligned_cols=51  Identities=12%  Similarity=0.053  Sum_probs=34.8

Q ss_pred             CCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHHH
Q ss_conf             750367899970788566889999999974987405220277559634899999
Q gi|254780707|r  280 YPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER  333 (346)
Q Consensus       280 YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~  333 (346)
                      .++.....+.+++.. ....+.++|++|+++++.|.  .+....|++|.-.+..
T Consensus       282 ~~~~~~~~~~i~~~s-~~~~~A~~fl~~l~s~e~q~--~~~~~~~~~P~~~~~~  332 (402)
T 1urs_A          282 TPFLGVITAFVNKES-KTQAADWSLVQALTSAQAQQ--MYFRDSQQIPALLSVQ  332 (402)
T ss_dssp             CCEEEEEEEEEBTTC-SCHHHHHHHHHHHTSHHHHH--HHHHHHCCEESSHHHH
T ss_pred             CCCCCCCCCCCCCCC-CCHHHHHHHHHHHCCHHHHH--HHHHHHCCCCCCHHHH
T ss_conf             110466554355568-78999999999976999999--9999819888737777