HHsearch results for GI: 254780707 and protein with PDBid: 3gzg_A

>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A
Probab=99.21  E-value=1.3e-09  Score=70.98  Aligned_cols=238  Identities=14%  Similarity=0.067  Sum_probs=118.7

Q ss_pred             HHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHH
Q ss_conf             98314201376799980342589999999999987798079998157620578988521013353012133202476787
Q gi|254780707|r   16 VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELD   95 (346)
Q Consensus        16 ~~~~~~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~   95 (346)
                      .+...+....+.|++-.++++.+.+..+.+.|++++ +++|. +..+||+..++++.+|..   .|+-.+ ......+..
T Consensus        13 g~~~~~~~~~~~ltVy~a~s~~~~~~~i~~~Fe~~t-gi~V~-~~~~gs~~l~~~i~~g~~---~d~~~~-~~~~~~~~~   86 (253)
T 3gzg_A           13 GLVPRGSHMTAPVTVFAAASLKESMDEAATAYEKAT-GTPVR-VSYAASSALARQIEQGAP---ADVFLS-ADLEWMDYL   86 (253)
T ss_dssp             ---------CCCEEEEEEGGGHHHHHHHHHHHHHHH-SCCEE-EEEECHHHHHHHHHTTCC---CSEEEC-SSHHHHHHH
T ss_pred             CCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHCCCC---CEEEEE-CCHHHHHHH
T ss_conf             677666567877899981570999999999998842-97799-997875999999973999---659996-757678887


Q ss_pred             HHHHCCCCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCC
Q ss_conf             67624878724666521541255416665456888888876410255555323673023231001112245035448854
Q gi|254780707|r   96 ECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK  175 (346)
Q Consensus        96 ~~~~~~~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~  175 (346)
                       ....................++++..+...                    ....+...|.++..  |+..|.+..|...
T Consensus        87 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------~~~~~~~~~~~~~~--~~~~i~~~~p~~~  143 (253)
T 3gzg_A           87 -QQHGLVLPAQRHNLLGNTLVLVAPASSKLR--------------------VDPRAPGAIAKALG--ENGRLAVGQTASV  143 (253)
T ss_dssp             -HHTTSSCGGGEEEEEEECEEEEEETTCCCC--------------------CCTTSTTHHHHHTT--TTCCEEEECTTTS
T ss_pred             -HHCCCCCCCCCCCCCCCCEEEEEECCCCCC--------------------CCCCCCHHHHHCCC--CCCEEEEECCCCC
T ss_conf             -515752224300001463002442133234--------------------58654032886158--8875999689888


Q ss_pred             CCHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             23578999885134555654101111101366000134443102466402116623677763101532100133200110
Q gi|254780707|r  176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN  255 (346)
Q Consensus       176 SGT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~  255 (346)
                      +..+..+.. +...+ ...    ..           ..          ..............+......+|.....+...
T Consensus       144 ~~g~~~~~~-l~~~g-~~~----~~-----------~~----------~~~~~~~~~~~~~~~~~g~~~~g~~~~~~~~~  196 (253)
T 3gzg_A          144 PAGSYAAAA-LRKLG-QWD----SV-----------SN----------RLAESESVRAALMLVSRGEAPLGIVYGSDARA  196 (253)
T ss_dssp             HHHHHHHHH-HHHTT-CHH----HH-----------TT----------SEEEESSHHHHHHHHHTTSSSEEEEEHHHHHH
T ss_pred             CHHHHHHHH-HHHHC-HHH----HH-----------CC----------CCCCCCCCCCEEEEECCCCCCEEEEHHHHHHH
T ss_conf             359999999-99957-244----41-----------33----------21104555400354214655377504348988


Q ss_pred             CCCCCCCCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCC
Q ss_conf             0111001344576789556027987503678999707885668899999999749874052202775596
Q gi|254780707|r  256 NADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGL  325 (346)
Q Consensus       256 ~~~~~~~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~Gy  325 (346)
                      +.    ......+.|.     ++..++..+. .++++.+  . ++.++|++|++|+++|.   ++++.||
T Consensus       197 ~~----~~~~~~~~P~-----eg~~~~~~~~-avvk~a~--~-~~A~~FidfllS~e~Q~---ila~~Gf  250 (253)
T 3gzg_A          197 DA----KVRVVATFPD-----DSHDAIVYPV-AALKNSN--N-PATAAFVSWLGSKPAKA---IFARRGF  250 (253)
T ss_dssp             CT----TEEEEEECCG-----GGSCCEEEEE-EECTTCC--C-TTHHHHHHHTTSHHHHH---HHHHTTC
T ss_pred             HC----CCCEEEEECC-----CCCEEEEEEE-EEECCCC--C-HHHHHHHHHHCCHHHHH---HHHHCCC
T ss_conf             46----8865999689-----8845778769-9988999--9-99999999978999999---9998296