HHsearch results for GI: 254780707 and protein with PDBid: 3ho7_A

>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis}
Probab=97.21  E-value=0.0078  Score=33.31  Aligned_cols=86  Identities=16%  Similarity=0.121  Sum_probs=66.0

Q ss_pred             CCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             76799980342589-99999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   25 RNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        25 ~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
                      .++|+|+-+.++.+ ++..+...|.+++|++++. +....+..-++.+.+|.    +|++....+..+.+          
T Consensus        10 ~G~l~ig~~~s~~~~~lp~~l~~f~~~~P~v~l~-l~~~~~~~~~~~L~~g~----iD~~i~~~~~~~~~----------   74 (232)
T 3ho7_A           10 TGRLNIAVLPTIAPYLLPRVFPIWKKELAGLEIH-VSEMQTSRCLASLLSGE----IDMAIIASKAETEG----------   74 (232)
T ss_dssp             CEEEEEEECTTTHHHHHHHHHHHHHHHSTTEEEE-EEECCHHHHHHHHHHTS----CSEEEESSCCCCTT----------
T ss_pred             EEEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCCHHHHHHHHCCC----EEEEEEECCCCCCC----------
T ss_conf             2799999437789999999999999988896899-99898289999997798----42898634765543----------


Q ss_pred             CCEEEEEECCCCEEEECCCCCCC
Q ss_conf             72466652154125541666545
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRDMVSV  126 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~~~~~  126 (346)
                       +...++..+.+++++..+.+..
T Consensus        75 -l~~~~l~~~~~~lv~~~~h~l~   96 (232)
T 3ho7_A           75 -LEDDLLYYEEFLGYVSRCEPLF   96 (232)
T ss_dssp             -EEEEEEEEEEEEEEECTTSGGG
T ss_pred             -CEEEEECCHHHHHHHCCCCCCC
T ss_conf             -0034200010222111345433