HHsearch results for GI: 254780707 and protein with PDBid: 3i3v_A

>3i3v_A Probable secreted solute-binding lipoprotein; transporter, PSI-II, structural genomics, protein structure initiative; 2.30A {Streptomyces coelicolor}
Probab=96.04  E-value=0.056  Score=28.57  Aligned_cols=39  Identities=15%  Similarity=0.158  Sum_probs=28.1

Q ss_pred             CEEEEE----ECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCH
Q ss_conf             679998----0342589999999999987798079998157620
Q gi|254780707|r   26 NRIRIA----GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS   65 (346)
Q Consensus        26 ~~I~i~----GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg   65 (346)
                      .+|++.    +++.-.+.+.+..++|+++||+++|. +...++.
T Consensus         8 ~tl~~~~~~~~~~~~~~~~~~~v~~F~~~~p~i~V~-~~~~~~~   50 (405)
T 3i3v_A            8 DTLVVHTQLGTTAPGSPTYLAAVDRFREENPGVKIK-NLVNGDD   50 (405)
T ss_dssp             CSEEEEESCSSSSTTHHHHHHHHHHHHHHSTTCCEE-EEECSTT
T ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEE-EECCCCC
T ss_conf             869999707888866799999999999888294999-9727861