Query         gi|254780707|ref|YP_003065120.1| putative phosphate-binding periplasmic protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 346
No_of_seqs    141 out of 1801
Neff          9.3 
Searched_HMMs 23785
Date          Tue May 31 16:14:36 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780707.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1ixh_A Phosphate-binding prote 100.0       0       0  351.5  21.2  282   25-343     1-311 (321)
  2 1pc3_A Phosphate-binding prote 100.0       0       0  349.6  21.7  298   17-344    18-349 (350)
  3 3g63_A Pfluding; subatomic res 100.0       0       0  343.0  17.7  286   27-342     2-351 (381)
  4 1twy_A ABC transporter, peripl 100.0       0       0  313.4  20.3  277    1-331     3-279 (290)
  5 3cvg_A Putative metal binding  100.0 1.2E-33 5.1E-38  204.8   9.7  255   23-330    17-284 (294)
  6 2hxw_A Major antigenic peptide  99.6 2.4E-14   1E-18   97.4  13.5  228   27-326     2-230 (237)
  7 1atg_A MODA, periplasmic molyb  99.3 1.2E-10 5.1E-15   76.8  16.2  229   27-327     1-229 (231)
  8 3gzg_A Molybdate-binding perip  99.2 1.3E-09 5.6E-14   71.0  16.0  238   16-325    13-250 (253)
  9 1amf_A Molybdate transport pro  99.2 2.1E-09 8.8E-14   69.9  16.8  227   25-325     2-230 (233)
 10 3lr1_A Tungstate ABC transport  99.0 4.4E-08 1.9E-12   62.5  16.7   94   22-125     1-96  (236)
 11 3kn3_A Putative periplasmic pr  99.0 5.3E-09 2.2E-13   67.7  11.7   89   25-123     4-94  (242)
 12 3c9h_A ABC transporter, substr  99.0 1.6E-08 6.6E-13   65.0  12.8  123    1-125     1-147 (355)
 13 3muq_A Uncharacterized conserv  98.9 1.6E-07 6.6E-12   59.5  16.6   93   23-125     2-96  (237)
 14 1sbp_A Sulfate-binding protein  98.9 3.7E-09 1.5E-13   68.5   7.2  241   39-336    16-271 (310)
 15 3cfx_A UPF0100 protein MA_0280  98.8 2.7E-08 1.1E-12   63.8   9.0   66   25-93      4-69  (296)
 16 3k6v_A Solute-binding protein   98.7 6.4E-06 2.7E-10   50.5  19.3   58   25-85     42-99  (354)
 17 3cij_A UPF0100 protein AF_0094  98.6 4.6E-06 1.9E-10   51.3  16.4   58   26-86      5-62  (295)
 18 2fyi_A HTH-type transcriptiona  98.2 0.00024   1E-08   41.7  16.5  203   23-310    11-214 (228)
 19 2qry_A Thiamine-binding peripl  98.0 0.00048   2E-08   40.1  15.5   68   17-85     14-84  (330)
 20 1nnf_A Iron-utilization peripl  98.0 0.00027 1.1E-08   41.5  13.3   52   33-86      6-57  (309)
 21 2hxr_A HTH-type transcriptiona  97.9 0.00045 1.9E-08   40.2  13.7  201   24-312    28-229 (238)
 22 1us5_A Putative GLUR0 ligand b  97.9 0.00031 1.3E-08   41.1  12.5   78    1-89      1-81  (314)
 23 1xvx_A YFUA; periplasmic iron   97.8 0.00083 3.5E-08   38.7  13.2  126   25-177     4-144 (312)
 24 3cg1_A UPF0100 protein PF0080;  97.8  0.0012   5E-08   37.9  14.4   93   24-124     3-101 (296)
 25 2voz_A FUTA2, periplasmic iron  97.8 7.1E-05   3E-09   44.7   7.6   61  268-333   248-314 (346)
 26 2pt1_A Iron transport protein;  97.6   0.001 4.3E-08   38.2  11.5   63   21-86     14-76  (334)
 27 1ixc_A CBNR, LYSR-type regulat  97.6  0.0027 1.1E-07   35.9  15.1  200   24-309    89-289 (294)
 28 2h9b_A HTH-type transcriptiona  97.5  0.0033 1.4E-07   35.4  17.2  203   24-310    88-291 (312)
 29 1al3_A Cys regulon transcripti  97.5  0.0036 1.5E-07   35.2  13.8  203   23-310    90-293 (324)
 30 3e13_X Putative iron-uptake AB  97.4  0.0051 2.2E-07   34.3  12.5  132   26-184     2-149 (322)
 31 2ql3_A Probable transcriptiona  97.3  0.0068 2.9E-07   33.6  15.5  200   25-310     4-207 (209)
 32 3cfz_A UPF0100 protein MJ1186;  97.3  0.0069 2.9E-07   33.6  14.8   59   25-86      4-62  (292)
 33 3jv9_A OXYR, transcriptional r  97.2  0.0039 1.7E-07   35.0  10.4   86   25-126     3-89  (219)
 34 3k01_A Acarbose/maltose bindin  97.2  0.0056 2.4E-07   34.1  11.2   95   26-123    28-151 (412)
 35 1pot_A POTD, spermidine/putres  97.2  0.0019 8.1E-08   36.7   8.6   81   41-124    17-120 (325)
 36 1y9u_A Putative iron binding p  97.2  0.0072   3E-07   33.5  11.5   62   24-89      4-65  (323)
 37 3ho7_A OXYR; beta-alpha-barrel  97.2  0.0078 3.3E-07   33.3  14.9   86   25-126    10-96  (232)
 38 2v84_A Spermidine/putrescine A  97.1   0.011 4.5E-07   32.6  14.8  100   18-123    17-140 (343)
 39 2h98_A HTH-type transcriptiona  96.8   0.018 7.5E-07   31.3  16.4  203   23-309    87-290 (313)
 40 3fxq_A LYSR type regulator of   96.7   0.022 9.4E-07   30.8  16.2  200   24-310    90-293 (305)
 41 1i6a_A OXYR, hydrogen peroxide  96.5    0.03 1.3E-06   30.0  11.4   86   25-126     4-90  (219)
 42 1eu8_A Trehalose/maltose bindi  96.5   0.031 1.3E-06   30.0  15.1   48  281-331   289-336 (409)
 43 1q35_A Iron binding protein FB  96.2   0.043 1.8E-06   29.2   9.3   94   26-123     2-111 (320)
 44 3i3v_A Probable secreted solut  96.0   0.056 2.3E-06   28.6   9.6   39   26-65      8-50  (405)
 45 1urs_A Maltose-binding protein  96.0   0.056 2.4E-06   28.6  10.4   51  280-333   282-332 (402)
 46 2heu_A Sugar ABC transporter,   95.8    0.07 2.9E-06   28.0  10.0   42  286-330   294-335 (401)
 47 1elj_A Maltodextrin-binding pr  95.7   0.079 3.3E-06   27.7  13.7  107   26-136     6-140 (381)
 48 1a99_A POTF, putrescine-bindin  95.3   0.044 1.8E-06   29.1   6.4   42  287-331   253-294 (344)
 49 3oxn_A Putative transcriptiona  94.8    0.15 6.2E-06   26.2   8.8   90   21-126    14-104 (241)
 50 2zyo_A Solute-binding protein;  94.4    0.19 8.1E-06   25.6  15.2   53  279-334   275-327 (397)
 51 2z8f_A Galacto-N-biose/lacto-N  93.7    0.26 1.1E-05   24.8  10.3   96   23-123    11-140 (412)
 52 3fzv_A Probable transcriptiona  93.4     0.3 1.3E-05   24.5  15.1   86   24-125    93-180 (306)
 53 2xd3_A MALX, maltose/maltodext  93.3    0.32 1.3E-05   24.4  14.4  105   27-136    36-165 (416)
 54 2hzl_A Trap-T family sorbitol/  93.2    0.14 5.9E-06   26.3   5.2   64   27-91     33-102 (365)
 55 3thi_A Protein (thiaminase I);  91.1     0.6 2.5E-05   22.8   8.9   79   36-124    14-116 (371)
 56 3f5f_A Maltose-binding peripla  89.8    0.78 3.3E-05   22.2  11.7   92   26-124     5-122 (658)
 57 2uvj_A TOGB, ABC type periplas  89.5    0.82 3.4E-05   22.1  15.9   57   26-86      6-68  (408)
 58 3kos_A HTH-type transcriptiona  88.4    0.98 4.1E-05   21.6  12.1   80   24-122    10-90  (219)
 59 3hhf_B Transcriptional regulat  84.8     1.6 6.6E-05   20.5  10.6   80   25-123     6-86  (213)
 60 3fd3_A Chromosome replication   84.3     1.7 6.9E-05   20.4  12.0  198   25-312     1-200 (208)
 61 2zzv_A ABC transporter, solute  84.0     1.7 7.1E-05   20.3   5.7   58   26-88     34-100 (361)
 62 2gh9_A Maltose/maltodextrin-bi  83.9     1.7 7.2E-05   20.3  16.3   52  281-335   264-315 (386)
 63 3ksx_A Nitrate transport prote  80.3     2.4 9.9E-05   19.5   9.2   68   17-88     18-88  (324)
 64 2esn_A Probable transcriptiona  78.6     2.7 0.00011   19.2   8.3   89   25-126   100-189 (310)
 65 2v25_A Major cell-binding fact  75.0     3.4 0.00014   18.6   5.1   59   53-123    80-138 (259)
 66 3mz1_A Putative transcriptiona  73.6     3.7 0.00016   18.4   7.2   79   25-122    87-166 (300)
 67 2nvu_B Maltose binding protein  73.3     3.8 0.00016   18.4  12.9   51  281-334   261-312 (805)
 68 2w7y_A FCSSBP, probable sugar   70.6     1.8 7.4E-05   20.2   2.0   37  294-332   318-354 (430)
 69 1uth_A LYSR-type regulatory pr  69.8     4.5 0.00019   17.9  10.2   85   26-126   105-190 (315)
 70 1p99_A Hypothetical protein PG  61.0     6.8 0.00029   17.0  15.6   55   25-85     38-92  (295)
 71 2b3f_A Glucose-binding protein  60.8     4.1 0.00017   18.1   2.4   38  289-329   281-318 (400)
 72 2gha_A Maltose ABC transporter  53.9       9 0.00038   16.3  19.2   92   26-124     3-120 (382)
 73 3n5l_A Binding protein compone  52.4     9.6  0.0004   16.1  10.5   57   26-87      4-65  (310)
 74 2x26_A Periplasmic aliphatic s  46.5      12  0.0005   15.6  11.0   60   25-88      2-62  (308)
 75 3omb_A Extracellular solute-bi  45.0     5.1 0.00022   17.6   0.7   35  279-314   345-379 (535)
 76 3hhg_A Transcriptional regulat  41.0      15 0.00062   15.1  12.9   81   25-124    92-173 (306)
 77 1y4c_A Maltose binding protein  34.6      19 0.00078   14.5  13.3   92   26-124     5-122 (494)
 78 2ozz_A Hypothetical protein YH  33.1      20 0.00083   14.4   5.1   48   39-90     29-76  (231)
 79 2f5x_A BUGD; periplasmic bindi  32.0      21 0.00087   14.3  15.7  109   23-135    14-131 (312)
 80 3kjt_A Maltose-binding peripla  26.7      26  0.0011   13.7  13.4   95   23-124     4-124 (372)
 81 1xt8_A Putative amino-acid tra  25.0      28  0.0012   13.6   6.3   71   39-123    73-143 (292)
 82 2de3_A Dibenzothiophene desulf  21.3      33  0.0014   13.1   5.9   56   26-86     20-75  (365)
 83 2kmf_A Photosystem II 11 kDa p  21.2      33  0.0014   13.1   2.8   23  320-342    84-106 (115)
 84 3ix1_A N-formyl-4-amino-5-amin  21.2      33  0.0014   13.1   8.0   46   37-87     18-63  (302)

No 1  
>1ixh_A Phosphate-binding protein; phosphate transport, ultra high resolution, phosphate bindin protein; 0.98A {Escherichia coli} SCOP: c.94.1.1 PDB: 2abh_A 1a54_A* 1a55_A 1ixi_A 1quk_A 1ixg_A 1oib_A 1pbp_A 1qul_A 1qui_A 1quj_A 1a40_A 2z22_X
Probab=100.00  E-value=0  Score=351.47  Aligned_cols=282  Identities=13%  Similarity=0.098  Sum_probs=226.0

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCC
Q ss_conf             76799980342589999999999987798079998157620578988521013353012133202476787676248787
Q gi|254780707|r   25 RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD  104 (346)
Q Consensus        25 ~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~  104 (346)
                      +.+|+++|||+++|+|+.|+++|++.|+ +++ +|+++|||+|+++||+|.    +|||++||+|+++|.+.+.      
T Consensus         1 ~~~i~g~GSs~v~p~~~~~a~~f~~~~~-~~v-~~~~~GSg~G~~~~~~G~----~dia~ssr~l~~~e~~~~~------   68 (321)
T 1ixh_A            1 EASLTGAGATFPAPVYAKWADTYQKETG-NKV-NYQGIGSSGGVKQIIANT----VDFGASDAPLSDEKLAQEG------   68 (321)
T ss_dssp             CCEEEEEECSTTHHHHHHHHHHHHHHHC-CEE-EEEECCHHHHHHHHHTTC----SSEEEESSCCCHHHHHHHT------
T ss_pred             CCEEEEECHHHHHHHHHHHHHHHHHHCC-CEE-EEECCCCHHHHHHHHCCC----CCEEECCHHHCHHHHHHCC------
T ss_conf             9508997171799999999999998589-868-997478699999997499----8389828425899997769------


Q ss_pred             CEEEEEECCCCEEEECCCCC---CCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHH
Q ss_conf             24666521541255416665---456888888876410255555323673023231001112245035448854235789
Q gi|254780707|r  105 IQEVTIGHDGILLVSDRDMV---SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV  181 (346)
Q Consensus       105 ~~~~~v~~d~i~i~~n~~~~---~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~  181 (346)
                      +.+++++.++++++++..++   ..+++.++|.+||.+++..|.+    ....|.++++.+||.||++++|+++|||++.
T Consensus        69 ~~~~~~~~~~~~~~v~~~~~~~~~~~ls~~~l~~If~g~it~W~~----~~~~~~~~~~~~pd~~I~v~~R~~~SGT~~~  144 (321)
T 1ixh_A           69 LFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDD----EAIAKLNPGLKLPSQNIAVVRRADGSGTSFV  144 (321)
T ss_dssp             EEEEEEEEEEEEEEECCTTCCTTCCEECHHHHHHHHTTCCCBTTC----HHHHHHCTTCCCCCCBCEEEEESSCCHHHHH
T ss_pred             CCEEEEEEEEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCC----CCCCCCCCCCCCCCCEEEEEECCCCCCCHHH
T ss_conf             921378876589999546666422311466788987361543457----4100136687788854799707988760688


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCC-
Q ss_conf             9988513455565410111110136600013444310246640211662367776310153210013320011001110-
Q gi|254780707|r  182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL-  260 (346)
Q Consensus       182 F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~-  260 (346)
                      |+++++...+.+......                 ............+.+..+.+.+..++++|||++++++..+.... 
T Consensus       145 f~~~l~~~~~~~~~~~~~-----------------~~~~~~~~~~~~~~~~~v~~~v~~~~~aiGy~~~~~~~~~~~~~~  207 (321)
T 1ixh_A          145 FTSYLAKVNEEWKNNVGT-----------------GSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYT  207 (321)
T ss_dssp             HHHHHHHHCHHHHHHTCC-----------------CSSCCCSSCEEESHHHHHHHHHHHSTTEEEEEEHHHHHTTTCEEC
T ss_pred             HHHHHHHCCHHHHHCCCC-----------------CCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECHHHCCCCCEE
T ss_conf             999886307344422466-----------------654456753125775376777406877248997414431784036


Q ss_pred             --CCCCCCCCCCCHHHHCC---------------------CCCCCEEEEEEEEECCC--CCCCHHHHHHHHHHHCHHHCC
Q ss_conf             --01344576789556027---------------------98750367899970788--566889999999974987405
Q gi|254780707|r  261 --KLVPIDGIVPSMGTIVS---------------------GLYPISRPLLFYVKRQH--FNSVLGLREYVSFSVSDEMMA  315 (346)
Q Consensus       261 --~~~~~~~v~p~~~~i~~---------------------g~YPl~r~ly~yv~~~~--~~~~~~~~~Fl~~~ls~~~~~  315 (346)
                        .....+++.|+.+++.+                     |+|||+|+||+|++++.  .+..+.+++||+|++|+ +|+
T Consensus       208 ~i~~~~~~~v~Pt~~~i~~~~~~~~~~~~~~~~~~~~~~~g~YPi~r~ly~~v~~~~~~~~~~~~v~~Fl~~~ls~-gq~  286 (321)
T 1ixh_A          208 KLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKT-GAK  286 (321)
T ss_dssp             EEECTTSCEECCCHHHHHHHTTTCCTTTCSCCCCBSCCSTTCCSBEEEEEEEEESBCSSHHHHHHHHHHHHHHHHH-CHH
T ss_pred             EEECCCCCEECCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHH-HHH
T ss_conf             7762789721677778754311345466643114678888962010168999976789867789999999999872-778


Q ss_pred             CCCHHHHCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             2202775596348999999999999607
Q gi|254780707|r  316 PDSQLFQYGLIPISNEERKSVRDSIAVG  343 (346)
Q Consensus       316 ~~~~~~~~GyvPLp~~~~~~~~~~~~~~  343 (346)
                         ++.++||+|||+++++++++++++.
T Consensus       287 ---~~~~~GyvPLp~~~~~~~~~~~~~~  311 (321)
T 1ixh_A          287 ---QANDLDYASLPDSVVEQVRAAWKTN  311 (321)
T ss_dssp             ---HHHHTTCEECCHHHHHHHHHHHHHH
T ss_pred             ---HHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             ---8987898009999999999999974


No 2  
>1pc3_A Phosphate-binding protein 1; phosphate transport receptor, immonodominant antigen, ION-dipole interactions, electrostatics; 2.16A {Mycobacterium tuberculosis H37RV} SCOP: c.94.1.1
Probab=100.00  E-value=0  Score=349.62  Aligned_cols=298  Identities=15%  Similarity=0.158  Sum_probs=229.2

Q ss_pred             HHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHH
Q ss_conf             83142013767999803425899999999999877980799981576205789885210133530121332024767876
Q gi|254780707|r   17 YCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDE   96 (346)
Q Consensus        17 ~~~~~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~   96 (346)
                      ....++.+..+|+++||++++|++++|+++|++.||++++ +|+++|||+|+++||+|.    +|||++||+|+++|+++
T Consensus        18 ~~~~~~~~~~~i~~~GSst~~p~~~~~a~~f~~~~p~v~v-~~~~~GSg~G~~~~~~G~----~di~~ssr~l~~~e~~~   92 (350)
T 1pc3_A           18 VATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTI-TAQGTGSGAGIAQAAAGT----VNIGASDAYLSEGDMAA   92 (350)
T ss_dssp             CCCSCCSSCEEEEEEECTTTHHHHHHHHHHHHHHSTTEEE-ECCBCCHHHHHHHHHTTS----CSEEEESSCCCHHHHHH
T ss_pred             CCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHCCCCEE-EEECCCCHHHHHHHHCCC----CCEEECCHHHHHHHHHH
T ss_conf             0246556676699975076999999999999988889169-993677689999997399----97535687676677787


Q ss_pred             HHHCCCCCCEEEEEECCCCEEEECCCCC--CCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCC
Q ss_conf             7624878724666521541255416665--45688888887641025555532367302323100111224503544885
Q gi|254780707|r   97 CKKHGVSDIQEVTIGHDGILLVSDRDMV--SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG  174 (346)
Q Consensus        97 ~~~~~~~~~~~~~v~~d~i~i~~n~~~~--~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~  174 (346)
                      +.     .+.+++++.|++++++|.++.  ..+++.++|.+||.+++..|.+    ....|.+++..+|+.+|++++|++
T Consensus        93 ~~-----~~~~~~v~~~~i~v~~~~~~~~~~~~lt~~~l~~If~G~it~W~~----~~~~~~n~~~~~p~~~I~v~~r~~  163 (350)
T 1pc3_A           93 HK-----GLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDD----PQIAALNPGVNLPGTAVVPLHRSD  163 (350)
T ss_dssp             ST-----TEEEEEEEEEEEEEEECCTTCCSCCEECHHHHHHHHHTSCCBTTC----HHHHHHSTTCCCCCCBCEECEESS
T ss_pred             HC-----CCEEEEEEEEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCC----CHHHCCCCCCCCCCCEEEEEECCC
T ss_conf             44-----936543798756887525665201214788766655687430434----001113888899885468861688


Q ss_pred             CCCHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCC-CCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHH
Q ss_conf             4235789998851345556541011111013660001344431024-664021166236777631015321001332001
Q gi|254780707|r  175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQ-DGIAIEVDGDYTETLARIEVNKDVFGFVGLSFY  253 (346)
Q Consensus       175 ~SGT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~  253 (346)
                      +|||++.|++++....+..+.....              ......+ ........+.+..+.+.+..++++|||++++|+
T Consensus       164 ~Sgt~~~f~~~l~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~v~~~V~~~~~aIGy~~~~~~  229 (350)
T 1pc3_A          164 GSGDTFLFTQYLSKQDPEGWGKSPG--------------FGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFL  229 (350)
T ss_dssp             CCHHHHHHHHHHHHHCTTTTTTTTC--------------CSSSCCCCCCTTCCEECHHHHHHHHHHHSTTEEEEEEGGGH
T ss_pred             CCCHHHHHHHHHHHHCCCHHHHCCC--------------CCCCCCCCCCCCCEECCCCHHHHHHHHCCCCEEEEEEEEHH
T ss_conf             7534688999987517310332147--------------56532456666514416848889998569523775210377


Q ss_pred             HHCCC-C-----CCCCCCCCCCCCHHHHC-----------------------CCCCCCEEEEEEEEECCCCC--CCHHHH
Q ss_conf             10011-1-----00134457678955602-----------------------79875036789997078856--688999
Q gi|254780707|r  254 KNNAD-V-----LKLVPIDGIVPSMGTIV-----------------------SGLYPISRPLLFYVKRQHFN--SVLGLR  302 (346)
Q Consensus       254 ~~~~~-~-----~~~~~~~~v~p~~~~i~-----------------------~g~YPl~r~ly~yv~~~~~~--~~~~~~  302 (346)
                      ..+.. .     +.....+++.|+.+++.                       +++|||+|++|+|+++++.+  ..+.+|
T Consensus       230 ~~~~~~~~~~~~l~~~~g~~v~Pt~~~i~~a~~~~~~~~~~~~~~~~~~~~~~~~YPi~~~~y~~~~~~~~~~~~~~~~k  309 (350)
T 1pc3_A          230 DQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQ  309 (350)
T ss_dssp             HHHHHTTCEECEEECTTSCEECCSHHHHHHHHTTTTTCCCTTCCCCCTTCSCTTCCSCEEEEEEEEESBCSSHHHHHHHH
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEECCCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHH
T ss_conf             56532240004542267872478722345543112334567741121467789962102224456636789666689999


Q ss_pred             HHHHHHHCHHHCCCCCHHHHCCCCCCCHHHHHHHHHHHHCCC
Q ss_conf             999997498740522027755963489999999999996077
Q gi|254780707|r  303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK  344 (346)
Q Consensus       303 ~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~~~~~~~~~~~~  344 (346)
                      +||+|+||+++|  +.+++++||+|||+++++++++.++...
T Consensus       310 ~Fl~~~ls~~gq--~~i~~~~GyvPLp~~~~~~~~~~~~~i~  349 (350)
T 1pc3_A          310 AFLHWAITDGNK--ASFLDQVHFQPLPPAVVKLSDALIATIS  349 (350)
T ss_dssp             HHHHHHTTGGGS--HHHHHHHTCBCCCHHHHHHHHHHHTTCB
T ss_pred             HHHHHHHCCCCH--HHHHHHCCCEECCHHHHHHHHHHHHHHC
T ss_conf             999998584127--8788868976699999999999998604


No 3  
>3g63_A Pfluding; subatomic resolution, phosphate binding, DING protein, hydrogen ATOM, phosphate binding protein; 0.88A {Pseudomonas fluorescens SBW25} PDB: 3g62_A 2q9t_A 2v3q_A 2cap_A
Probab=100.00  E-value=0  Score=343.04  Aligned_cols=286  Identities=13%  Similarity=0.144  Sum_probs=222.2

Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHC--------CCCCCCEEECCCCCCHHHHHHHH
Q ss_conf             7999803425899999999999877980799981576205789885210--------13353012133202476787676
Q gi|254780707|r   27 RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI--------GDDTIDIVNSSRKITQNELDECK   98 (346)
Q Consensus        27 ~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~--------~~~~~dig~ssr~l~~~E~~~~~   98 (346)
                      .|+++|||+++|++++|.+     ++++.+ .|+++|||+|+++||.|.        .++++|||++||+|+++|++++.
T Consensus         2 ~i~GaGsT~~~pl~~~~~~-----~~~~~v-~y~~~GSG~Gi~~~~~g~~~~~~~~~~~g~vDfa~sd~~l~~~E~~~~~   75 (381)
T 3g63_A            2 DINGGGATLPQALYQTSGV-----LTAGFA-QYIGVGSGNGKAAFLNNDYTKFQAGVTNKNVHWAGSDSKLSATELSTYA   75 (381)
T ss_dssp             CBCEEECSTTHHHHTSTTT-----SCTTBC-CCEECCHHHHHHHHHHTCGGGTSTTCCSSCCCEEEESSCCCHHHHHHHH
T ss_pred             EEEEECHHHHHHHHHHHHH-----HCCCEE-EEECCCCHHHHHHHHCCCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHH
T ss_conf             5987747179999999987-----319778-9958887788998853665334445455765353358778999998876


Q ss_pred             HCC---CCCCEEEEEECCCCEEEECCCC-CCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCC
Q ss_conf             248---7872466652154125541666-545688888887641025555532367302323100111224503544885
Q gi|254780707|r   99 KHG---VSDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG  174 (346)
Q Consensus        99 ~~~---~~~~~~~~v~~d~i~i~~n~~~-~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~  174 (346)
                      ..+   ...++++|++.|+|++++|.++ ...+|+.++|.+||           .|+|++|+|++..+|+.||++++|++
T Consensus        76 ~~~~~~~~~~v~ipi~~~~iav~~N~~~~~~l~Lt~~~la~If-----------~G~It~W~d~~~~~~~~pI~vv~R~d  144 (381)
T 3g63_A           76 SAKQPTWGKLIQVPSVGTSVAIPFNKSGSAAVNLSVQELCGVF-----------SGRINTWDGISGSGRTGPIVVVYRSE  144 (381)
T ss_dssp             HHTHHHHCCEEEEEEEEEECBCBEECCCSSCCEECHHHHHHHH-----------HTSCCBGGGSTTCCCCSBCEEEEESS
T ss_pred             HHCCCCCCCEEEEEEEEEEEEEEECCCCCHHCCCCHHHHHHHH-----------CCCCEECCCCCCCCCCCCEEEEECCC
T ss_conf             4124667870881379888999962898500044899998763-----------58604645312347789847885789


Q ss_pred             CCCHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHH
Q ss_conf             42357899988513455565410111110136600013444310246640211662367776310153210013320011
Q gi|254780707|r  175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK  254 (346)
Q Consensus       175 ~SGT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~  254 (346)
                      +|||+++|+++++...+.++........         .+.......... ......+..+++.+..++++|||++++|+.
T Consensus       145 ~SGTt~~ft~~l~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~-~~~~~gn~~v~~~V~~~~gaIGY~~~~ya~  214 (381)
T 3g63_A          145 SSGTTELFTRFLNAKCNAETGNFAVTTT---------FGTSFSGGLPAG-AVAATGSQGVMTALAAGDGRITYMSPDFAA  214 (381)
T ss_dssp             CCHHHHHHHHHHHHHCCSSSSCBCCCSC---------GGGTBTTCCCTT-CEEECHHHHHHHHHHTSTTEECCBCTTTTS
T ss_pred             CCCCCHHHHHHHHHCCCCCCCCCCCCCC---------CCCCCCCCCCCC-CEECCCCHHHHHHHHCCCCEEEEEEHHHHH
T ss_conf             9861067999875205311356564455---------576765433786-354168578887750489838997689965


Q ss_pred             HCCCCCCCC------------CCCCCCCCHHHHC------------------------------------CCCCCCEEEE
Q ss_conf             001110013------------4457678955602------------------------------------7987503678
Q gi|254780707|r  255 NNADVLKLV------------PIDGIVPSMGTIV------------------------------------SGLYPISRPL  286 (346)
Q Consensus       255 ~~~~~~~~~------------~~~~v~p~~~~i~------------------------------------~g~YPl~r~l  286 (346)
                      .+...+...            ..+++.|+.+++.                                    +++|||+|++
T Consensus       215 ~~~~~l~~a~~~n~~g~~v~~~~~~v~pt~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YPI~~~~  294 (381)
T 3g63_A          215 PTLAGLDDATKVARVGKNVATNTQGVSPAAANVSAAIGAVPVPAAADRSNPDAWVPVFGPDNTAGVQPYPTSGYPILGFT  294 (381)
T ss_dssp             SSGGGGGCTTTBCEECCBTTTTBCCBCCCGGGTHHHHHTSCCCCGGGTTSGGGGSCCEESTTCTTSEECCSSSCCCEEEE
T ss_pred             HHHHCCHHHHHHCCCCCEECCCCCHHEHHHHHHHHHHCCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             43212113432124784324675300114677765422455653234445210002455431000368989964201386


Q ss_pred             EEEEECCCCC--CCHHHHHHHHHH--HCHHHCCCCCHHHHCCCCCCCHHHHHHHHHHHHC
Q ss_conf             9997078856--688999999997--4987405220277559634899999999999960
Q gi|254780707|r  287 LFYVKRQHFN--SVLGLREYVSFS--VSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV  342 (346)
Q Consensus       287 y~yv~~~~~~--~~~~~~~Fl~~~--ls~~~~~~~~~~~~~GyvPLp~~~~~~~~~~~~~  342 (346)
                      |+|++.+..+  ..+.+++||+|.  +++++|   .++.++||+|||+++++++++.+-.
T Consensus       295 y~iv~~~~~~~~~~~~v~~Fl~~~~~~s~~gq---~~~~~~GyvPLP~~~~~~i~~~~~~  351 (381)
T 3g63_A          295 NLIFSQCYADATQTTQVRDFFTKHYGASNNND---AAITANAFVPLPTAWKATVRASFLT  351 (381)
T ss_dssp             EEEEESCBSSHHHHHHHHHHHHHHTCSSSCSH---HHHHHTTCBCCCHHHHHHHHHHHTS
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHCCHHHH---HHHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             77730558998899999999998773283268---9899789714999999999999975


No 4  
>1twy_A ABC transporter, periplasmic substrate-binding protein; nysgxrc target, structural genomics, protein structure initiative; 1.65A {Vibrio cholerae o1 biovar eltor str} SCOP: c.94.1.1
Probab=100.00  E-value=0  Score=313.39  Aligned_cols=277  Identities=21%  Similarity=0.354  Sum_probs=223.0

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCC
Q ss_conf             92489999999999998314201376799980342589999999999987798079998157620578988521013353
Q gi|254780707|r    1 MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI   80 (346)
Q Consensus         1 Mk~~~~~~~~~~~l~~~~~~~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~   80 (346)
                      |+++.+.+++++++++.+.++....++|+|+||++++|+++.|+++|+++||++++ .++.+||+.|++++++|.    +
T Consensus         3 ~~~~~l~~~~a~~~~~~~~~~~a~~~~i~i~gs~s~~~l~~~l~~~f~~~~P~~~v-~~~~~gSg~~~~~l~~g~----~   77 (290)
T 1twy_A            3 LIRMALAAVCALLFSITTMTPFVQASEITISGSTSVARIMDVLAEKYNQQHPETYV-AVQGVGSTAGISLLKKGV----A   77 (290)
T ss_dssp             -------------------------CEEEEEECHHHHHHHHHHHHHHHHHCTTCEE-EEEESCHHHHHHHHHTTS----C
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEE-EEEECCCHHHHHHHHHCC----C
T ss_conf             68999999999999998354302488699996054999999999999988889579-997168679999998268----6


Q ss_pred             CEEECCCCCCHHHHHHHHHCCCCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             01213320247678767624878724666521541255416665456888888876410255555323673023231001
Q gi|254780707|r   81 DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRP  160 (346)
Q Consensus        81 dig~ssr~l~~~E~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~  160 (346)
                      ||+.++|+++++|.+.       .+...++++|++++++|++|+..++|.+||.++|           .|+|++|+|+++
T Consensus        78 di~~~s~~~~~~e~~~-------~~~~~~ia~~~~~ivv~~~n~~~~ls~~~L~~i~-----------~g~it~W~~~~~  139 (290)
T 1twy_A           78 DIAMTSRYLTESEAQN-------TLHTFTLAFDGLAIVVNQANPVTNLTREQLYGIY-----------KGQITNWKQVGG  139 (290)
T ss_dssp             SEEEESSCCCTTTCCT-------TCEEEEEEEEEEEEEECTTCCCCEECHHHHHHHH-----------HTSCCBGGGGTS
T ss_pred             CCCCCCCCCHHHHHHC-------CCEEEEEEECCEEEEECCCCCCCCCCHHHHHHHH-----------CCCCCCHHHCCC
T ss_conf             4122554001346634-------5056778860257640577852345898985644-----------287675310489


Q ss_pred             CCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCC
Q ss_conf             11224503544885423578999885134555654101111101366000134443102466402116623677763101
Q gi|254780707|r  161 DFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV  240 (346)
Q Consensus       161 ~lp~~~I~~~~r~~~SGT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~  240 (346)
                        |+.+|.++.|+++|||+..|.+.+............                     .........+.+..+.+.+..
T Consensus       140 --~~~~i~~~~r~~~Sgt~~~~~~~~~~~~~~~~~~~~---------------------~~~~~~~~~~~~~~v~~~v~~  196 (290)
T 1twy_A          140 --NDQKIAVVTREASSGTRYSFESLMGLTKTVKDREVS---------------------DVAPTALVVNSNSMMKTLVNH  196 (290)
T ss_dssp             --CSCBCEEEEECTTCHHHHHHHHHHTCEEEETTEEEE---------------------CSCTTSEEESSHHHHHHHHHH
T ss_pred             --CCCCEEEECCCCCCCHHHHHHHHHCCCCCCCCCCCC---------------------CCCCCEEEECCCHHHHHHHHC
T ss_conf             --988417852799972799999996104421212102---------------------357712794384899999964


Q ss_pred             CCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHH
Q ss_conf             53210013320011001110013445767895560279875036789997078856688999999997498740522027
Q gi|254780707|r  241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL  320 (346)
Q Consensus       241 ~~~~igy~~~~~~~~~~~~~~~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~  320 (346)
                      ++++|||+++++...   .++.+.++++.|+.++|.+|+|||+||+|+|++..+  ..+.+++|++|++|+++|.   ++
T Consensus       197 ~~~aig~~~~~~~~~---~vk~l~i~~v~Ps~~~i~~g~YPl~~~~~~i~~~~~--~~~~a~~Fi~fl~S~~gq~---ii  268 (290)
T 1twy_A          197 NTQAVGFISIGSVDK---SVKAIQFEKADPTSDNIAKHTYQLSRPFLILHYSDN--ADEQTKEFIAFLKSESAKK---LI  268 (290)
T ss_dssp             CTTEEEEEEGGGCCT---TSEECEETTBCCCHHHHHTTCSCCEEEEEEEECTTT--CCHHHHHHHHHHHSHHHHH---HH
T ss_pred             CCCCEEEEEEEECCC---CCCEEEECCCCCCHHHHHCCCCCCEEEEEEEEECCC--CCHHHHHHHHHHHCHHHHH---HH
T ss_conf             888517877520047---742655437689977885499871789999996899--9999999999980998899---99


Q ss_pred             HHCCCCCCCHH
Q ss_conf             75596348999
Q gi|254780707|r  321 FQYGLIPISNE  331 (346)
Q Consensus       321 ~~~GyvPLp~~  331 (346)
                      ++.||||+++.
T Consensus       269 ~~~Gfvp~~~~  279 (290)
T 1twy_A          269 VEYGYIMPSDV  279 (290)
T ss_dssp             HHTTCBCC---
T ss_pred             HHCCCCCCHHH
T ss_conf             98859977544


No 5  
>3cvg_A Putative metal binding protein; PSI-II, NYSGXRC, periplasmic, structural genomics, protein structure initiative; 1.97A {Coccidioides immitis RS}
Probab=100.00  E-value=1.2e-33  Score=204.80  Aligned_cols=255  Identities=12%  Similarity=0.035  Sum_probs=175.1

Q ss_pred             CCCCEEEE-EECCHHHHHHHHHHHHHHHHCC-----CCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHH
Q ss_conf             13767999-8034258999999999998779-----80799981576205789885210133530121332024767876
Q gi|254780707|r   23 FARNRIRI-AGSSTLFPYSKIIAENFSEYFP-----EFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDE   96 (346)
Q Consensus        23 ~a~~~I~i-~GSst~~P~~~~~a~~y~~~~~-----~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~   96 (346)
                      ...-+|+| .||+++.+++++|+++|.++||     +++| .+..+||+.|++++.+|.    +||++++|+.++.|...
T Consensus        17 ~~~~~l~i~~gs~~~~~l~~~la~aF~k~~~~~~~tgi~V-~~~~~GSg~~i~~l~~G~----~Di~~ss~~~~~~~~~~   91 (294)
T 3cvg_A           17 HSPVQLRIGNGGAGQSGLVKELADAFIKSKVDSGSAPFKV-AWYKSDTTVTINYLKDGI----VDVGITYSPVAERISIK   91 (294)
T ss_dssp             --CEEEEEEESHHHHHTHHHHHHHHHHHHHHSCC---CEE-EEEECCHHHHHHHHHTTS----CSEEEESCHHHHHHHHH
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCEEE-EEEECCCHHHHHHHHCCC----CCEEEECCCHHHHHHHH
T ss_conf             8877999934773268899999999997553236898389-999688299999986589----84686317023689997


Q ss_pred             HHHCCCCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCC
Q ss_conf             76248787246665215412554166654568888888764102555553236730232310011122450354488542
Q gi|254780707|r   97 CKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKH  176 (346)
Q Consensus        97 ~~~~~~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~S  176 (346)
                      ..  .  ......++.++..++++..++..+++..++...           +.+++++|.++++  |+.+|.++.|++.|
T Consensus        92 ~~--~--~~~~~~~~~~~~~viv~~~~~~~~~~~~~~~~~-----------~~~~~~~w~~~g~--~~~~i~~~~r~~~s  154 (294)
T 3cvg_A           92 HG--I--SESPSYYAFRDHFMLIGPPSNPAKLSGDSDIAD-----------MFSKMHDAAEAGN--TKPPVRFLSRYDKS  154 (294)
T ss_dssp             TT--S--BCSSCEEEEEEEEEEEECTTCTTCCCTTSCHHH-----------HHHHHHHHHHHCC--SSSCCCEEECCSSS
T ss_pred             CC--C--CCCCEEECCCCCEEEECCCCCHHHCCCHHHHHH-----------HHHHHHHHHHCCC--CCCCCEEEECCCCC
T ss_conf             38--7--865236325672999889886543233245667-----------7655323343147--65561355356666


Q ss_pred             CHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHC
Q ss_conf             35789998851345556541011111013660001344431024664021166236777631015321001332001100
Q gi|254780707|r  177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN  256 (346)
Q Consensus       177 GT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~  256 (346)
                      ||+..|.+.+............                      ......   ....+...+......+||........ 
T Consensus       155 gt~~~~~~~~~~~~~~~~~~~~----------------------~~~~~~---~~~~~~~~~~~~~~~~g~~~~~~~~~-  208 (294)
T 3cvg_A          155 ATNIKEAELWLSIGQVPWATAY----------------------STWYHQ---YITFPIQALTAAILLREYTITDYGTY-  208 (294)
T ss_dssp             HHHHHHHHHHHHTTCCTTSSSC----------------------CTTEEE---CCSCHHHHHHHHHHTTCEEEEEHHHH-
T ss_pred             CHHHHHHHHHHHCCCCCCCCCC----------------------CCCHHC---CCCCHHHHHHCCCCCCEEEEEEEEEH-
T ss_conf             3468899999861778643334----------------------422110---45411344320344404897421100-


Q ss_pred             CCCCCCCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHH-HCCCCCHHHHCC------CCCCC
Q ss_conf             11100134457678955602798750367899970788566889999999974987-405220277559------63489
Q gi|254780707|r  257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE-MMAPDSQLFQYG------LIPIS  329 (346)
Q Consensus       257 ~~~~~~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~-~~~~~~~~~~~G------yvPLp  329 (346)
                       ........+.+.++.+++..+.|||.||+++++.+... ..++.|+|++|++|+| ||.   ++++.|      |.|.|
T Consensus       209 -~~~~~~~~~~~~~~~~~~~~~~~~l~~p~~v~i~k~~k-n~~~Ak~FidfllS~E~GQ~---Ii~~yg~~g~~~f~P~~  283 (294)
T 3cvg_A          209 -LSIPRGLRDQMVIYKKGTNDADDPLLNPAHLLVGARAK-NAEMAKEFAKWLVSKEGGQK---VIEGFKKDGQQLYSPAP  283 (294)
T ss_dssp             -TTSCHHHHTTCEEEEECCSCTTCTTEEEEEEEEBSSCS-SHHHHHHHHHHHHSTTTHHH---HHHTCEETTEECSEECC
T ss_pred             -HHHHCCCCCCCEEEECCCCCCCCCCEEEEEEEEECCCC-CHHHHHHHHHHHCCCHHHHH---HHHHHCCCCEEEEEECC
T ss_conf             -13321356650132125567886402146899968988-94999999999849398999---99982518845465378


Q ss_pred             H
Q ss_conf             9
Q gi|254780707|r  330 N  330 (346)
Q Consensus       330 ~  330 (346)
                      -
T Consensus       284 ~  284 (294)
T 3cvg_A          284 Y  284 (294)
T ss_dssp             C
T ss_pred             C
T ss_conf             6


No 6  
>2hxw_A Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A*
Probab=99.60  E-value=2.4e-14  Score=97.42  Aligned_cols=228  Identities=11%  Similarity=0.106  Sum_probs=127.1

Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCCE
Q ss_conf             79998034258999999999998779807999815762057898852101335301213320247678767624878724
Q gi|254780707|r   27 RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ  106 (346)
Q Consensus        27 ~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~~  106 (346)
                      .|+|-|+.++.|.++.+++.|++++ +++| .+..+||+...+++..|     .|+..++.+....++..........-.
T Consensus         2 ei~v~~~~~~~~~~~~l~~~Fek~t-Gi~V-~~~~~~s~~l~~~i~~~-----aDv~~~~~~~~~~~~~~~~~~~~~~~~   74 (237)
T 2hxw_A            2 DVNLYGPGGPHTALKDIANKYSEKT-GVKV-NVNFGPQATWFEKAKKD-----ADILFGASDQSALAIASDFGKDFNVSK   74 (237)
T ss_dssp             CEEEEECSSTHHHHHHHHHHHHHHH-CCCE-EEEESSHHHHHHHHHHH-----CSEEEESSHHHHHHHHTTSGGGCCGGG
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHH-CCEE-EEEECCCHHHHHHHHCC-----CCEEEECCCHHHHHHHHHHCCCCCCCC
T ss_conf             7999947897899999999998801-9759-99977829999997659-----999998460478999886104677772


Q ss_pred             EEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCC-CCCCHHHHHHHH
Q ss_conf             6665215412554166654568888888764102555553236730232310011122450354488-542357899988
Q gi|254780707|r  107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPS-GKHGTREVLEKK  185 (346)
Q Consensus       107 ~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~-~~SGT~~~F~~~  185 (346)
                      ..+++...+++++++.++..                         +++|.|+..  |+..+.+..+. +.+++.......
T Consensus        75 ~~~~~~~~~vl~~~~~~~~~-------------------------~~~~~dl~~--~~~~~~~~~~~~~~~~~~~~~~~~  127 (237)
T 2hxw_A           75 IKPLYFREAIILTQKGNPLK-------------------------IKGLKDLAN--KKVRIVVPEGAGKSNTSGTGVWED  127 (237)
T ss_dssp             CEEEEEEEEEEEESTTCTTC-------------------------CCSHHHHHH--SCCCEEECCCTTSSCCTTTTHHHH
T ss_pred             EEEEEEEEEEEEEECCCCCC-------------------------CCCHHHHHH--CCCEEEEECCCCCCCHHHHHHHHH
T ss_conf             79999432999997999767-------------------------652356642--031066513688732227999999


Q ss_pred             HCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCCCC
Q ss_conf             51345556541011111013660001344431024664021166236777631015321001332001100111001344
Q gi|254780707|r  186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI  265 (346)
Q Consensus       186 v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~~~~  265 (346)
                      ........    ......     ..            ..+....+...+...+......+|..-..+...+..      .
T Consensus       128 ~~~~~~~~----~~~~~~-----~~------------~~~~~~~~~~~~~~~v~~g~~d~~i~~~~~a~~~~~------~  180 (237)
T 2hxw_A          128 MIGRTQDI----KTIQNF-----RN------------NIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPD------I  180 (237)
T ss_dssp             HHHTTCCH----HHHHHH-----HH------------TEEEECCCCTTC--CTTTTTCSEEEEEHHHHHHSTT------S
T ss_pred             HHHHHCCH----HHHHHH-----HC------------CCEEECCCHHHHHHHHHHCCCEEEEEEHHHHHCCCC------C
T ss_conf             86222208----899974-----35------------705865888999999970777099874454532666------0


Q ss_pred             CCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCC
Q ss_conf             5767895560279875036789997078856688999999997498740522027755963
Q gi|254780707|r  266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLI  326 (346)
Q Consensus       266 ~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~Gyv  326 (346)
                      ..+.|     .++.|++.+++.+..+.+   ..++.++|++|++|+++|.   ++++.||=
T Consensus       181 ~~~~~-----~~~~~~~~~~~~i~~~~~---~~~~A~~Fi~fl~S~e~q~---i~~~~Gf~  230 (237)
T 2hxw_A          181 GTAVA-----IEKDLVVYRTFNVIAKEG---ASKETQDFIAYLSSKEAKE---IFKKYGWR  230 (237)
T ss_dssp             SEEEE-----CCTTTCCEEEEEEEECTT---CCHHHHHHHHHTTSHHHHH---HHHHTTCB
T ss_pred             EEEEE-----CCCCCCEEEEEEEECCCC---CHHHHHHHHHHHCCHHHHH---HHHHCCCC
T ss_conf             28996-----699852587799995899---9499999999978999999---99985998


No 7  
>1atg_A MODA, periplasmic molybdate-binding protein; tungstate, ABC transporter; 1.20A {Azotobacter vinelandii} SCOP: c.94.1.1
Probab=99.33  E-value=1.2e-10  Score=76.78  Aligned_cols=229  Identities=12%  Similarity=0.081  Sum_probs=119.7

Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCCE
Q ss_conf             79998034258999999999998779807999815762057898852101335301213320247678767624878724
Q gi|254780707|r   27 RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ  106 (346)
Q Consensus        27 ~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~~  106 (346)
                      .|++.++++..+.++.+++.|++++ +++| .+..+|||..++++.+|.   ..|+..+..+....++...  .......
T Consensus         1 el~v~~~~~~~~~~~~l~~~Fek~t-Gi~V-~~~~g~sg~l~~~i~~g~---~~D~~~~~~~~~~~~~~~~--g~~~~~~   73 (231)
T 1atg_A            1 ELKVVTATNFLGTLEQLAGQFAKQT-GHAV-VISSGSSGPVYAQIVNGA---PYNVFFSADEKSPEKLDNQ--GFALPGS   73 (231)
T ss_dssp             CEEEEEEGGGHHHHHHHHHHHHHHH-CCCE-EEEEECHHHHHHHHHTTC---CCSEEECSSSHHHHHHHHT--TCBCTTC
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHHH-CCEE-EEEECCHHHHHHHHHCCC---CCCEEEECCHHHHHHHHHH--CCCCCCC
T ss_conf             9799995166999999999999852-9889-999888899999998499---9849996666667889861--4423464


Q ss_pred             EEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHHHH
Q ss_conf             66652154125541666545688888887641025555532367302323100111224503544885423578999885
Q gi|254780707|r  107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV  186 (346)
Q Consensus       107 ~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~~~v  186 (346)
                      ........+++....+++                          ....|.++..  |......+..+..++.-..+....
T Consensus        74 ~~~~~~~~~~~~~~~~~~--------------------------~~~~~~~l~~--~~~~~i~~~~p~~~~~g~~~~~~~  125 (231)
T 1atg_A           74 RFTYAIGKLVLWSAKPGL--------------------------VDNQGKVLAG--NGWRHIAISNPQIAPYGLAGTQVL  125 (231)
T ss_dssp             CEEEEECCEEEEESSTTT--------------------------SCTTSGGGGS--SSCSCEEEECTTTCHHHHHHHHHH
T ss_pred             EEEEECCEEEEEECCCCC--------------------------CCCCHHHHCC--CCCCEEEEECCCCCCCHHHHHHHH
T ss_conf             267630228986247777--------------------------8886888277--547879996898782068999999


Q ss_pred             CCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             13455565410111110136600013444310246640211662367776310153210013320011001110013445
Q gi|254780707|r  187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID  266 (346)
Q Consensus       187 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~~~~~  266 (346)
                      .......     ..        ...           ..+...+........+......+|++..+...........  ..
T Consensus       126 ~~~~~~~-----~~--------~~~-----------~~~~~~~~~~~~~~~v~~g~~~~~~~~~s~~~~~~~~~~~--~~  179 (231)
T 1atg_A          126 THLGLLD-----KL--------TAQ-----------ERIVEANSVGQAHSQTASGAADLGFVALAQIIQAAAKIPG--SH  179 (231)
T ss_dssp             HHTTCHH-----HH--------HHT-----------TCEEEESSHHHHHHHHHTTSSSEEEEEGGGTCCTTSCCSS--EE
T ss_pred             HHCCCHH-----HH--------HHH-----------HCEEECCCCHHHHHHHHCCCCCEEEEHHHHHHHHHHCCCC--EE
T ss_conf             8728225-----55--------543-----------1062102314788888707753451057788987643686--04


Q ss_pred             CCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCC
Q ss_conf             7678955602798750367899970788566889999999974987405220277559634
Q gi|254780707|r  267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIP  327 (346)
Q Consensus       267 ~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvP  327 (346)
                      .+.|     .++..|+.++.-+..+   ....++.++|++|++|+++|.   ++.+.||.+
T Consensus       180 ~~~~-----~~~~~~~~~~~~i~~~---a~n~~~A~~FidfL~S~e~Q~---i~~~~Gf~~  229 (231)
T 1atg_A          180 WFPP-----ANYYEPIVQQAVITKS---TAEKANAEQFMSWMKGPKAVA---IIKAAGYVL  229 (231)
T ss_dssp             ECCC-----GGGSCCCEEEEEEBTT---CSCHHHHHHHHHHTTSHHHHH---HHHHTTCBC
T ss_pred             EECC-----CCCCEEEEEEEEEECC---CCCHHHHHHHHHHHCCHHHHH---HHHHHCCCC
T ss_conf             4158-----6667055677999859---999799999999978999999---999848989


No 8  
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A
Probab=99.21  E-value=1.3e-09  Score=70.98  Aligned_cols=238  Identities=14%  Similarity=0.067  Sum_probs=118.7

Q ss_pred             HHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHH
Q ss_conf             98314201376799980342589999999999987798079998157620578988521013353012133202476787
Q gi|254780707|r   16 VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELD   95 (346)
Q Consensus        16 ~~~~~~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~   95 (346)
                      .+...+....+.|++-.++++.+.+..+.+.|++++ +++|. +..+||+..++++.+|..   .|+-.+ ......+..
T Consensus        13 g~~~~~~~~~~~ltVy~a~s~~~~~~~i~~~Fe~~t-gi~V~-~~~~gs~~l~~~i~~g~~---~d~~~~-~~~~~~~~~   86 (253)
T 3gzg_A           13 GLVPRGSHMTAPVTVFAAASLKESMDEAATAYEKAT-GTPVR-VSYAASSALARQIEQGAP---ADVFLS-ADLEWMDYL   86 (253)
T ss_dssp             ---------CCCEEEEEEGGGHHHHHHHHHHHHHHH-SCCEE-EEEECHHHHHHHHHTTCC---CSEEEC-SSHHHHHHH
T ss_pred             CCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHCCCC---CEEEEE-CCHHHHHHH
T ss_conf             677666567877899981570999999999998842-97799-997875999999973999---659996-757678887


Q ss_pred             HHHHCCCCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCC
Q ss_conf             67624878724666521541255416665456888888876410255555323673023231001112245035448854
Q gi|254780707|r   96 ECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK  175 (346)
Q Consensus        96 ~~~~~~~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~  175 (346)
                       ....................++++..+...                    ....+...|.++..  |+..|.+..|...
T Consensus        87 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------~~~~~~~~~~~~~~--~~~~i~~~~p~~~  143 (253)
T 3gzg_A           87 -QQHGLVLPAQRHNLLGNTLVLVAPASSKLR--------------------VDPRAPGAIAKALG--ENGRLAVGQTASV  143 (253)
T ss_dssp             -HHTTSSCGGGEEEEEEECEEEEEETTCCCC--------------------CCTTSTTHHHHHTT--TTCCEEEECTTTS
T ss_pred             -HHCCCCCCCCCCCCCCCCEEEEEECCCCCC--------------------CCCCCCHHHHHCCC--CCCEEEEECCCCC
T ss_conf             -515752224300001463002442133234--------------------58654032886158--8875999689888


Q ss_pred             CCHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             23578999885134555654101111101366000134443102466402116623677763101532100133200110
Q gi|254780707|r  176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN  255 (346)
Q Consensus       176 SGT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~  255 (346)
                      +..+..+.. +...+ ...    ..           ..          ..............+......+|.....+...
T Consensus       144 ~~g~~~~~~-l~~~g-~~~----~~-----------~~----------~~~~~~~~~~~~~~~~~g~~~~g~~~~~~~~~  196 (253)
T 3gzg_A          144 PAGSYAAAA-LRKLG-QWD----SV-----------SN----------RLAESESVRAALMLVSRGEAPLGIVYGSDARA  196 (253)
T ss_dssp             HHHHHHHHH-HHHTT-CHH----HH-----------TT----------SEEEESSHHHHHHHHHTTSSSEEEEEHHHHHH
T ss_pred             CHHHHHHHH-HHHHC-HHH----HH-----------CC----------CCCCCCCCCCEEEEECCCCCCEEEEHHHHHHH
T ss_conf             359999999-99957-244----41-----------33----------21104555400354214655377504348988


Q ss_pred             CCCCCCCCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCC
Q ss_conf             0111001344576789556027987503678999707885668899999999749874052202775596
Q gi|254780707|r  256 NADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGL  325 (346)
Q Consensus       256 ~~~~~~~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~Gy  325 (346)
                      +.    ......+.|.     ++..++..+. .++++.+  . ++.++|++|++|+++|.   ++++.||
T Consensus       197 ~~----~~~~~~~~P~-----eg~~~~~~~~-avvk~a~--~-~~A~~FidfllS~e~Q~---ila~~Gf  250 (253)
T 3gzg_A          197 DA----KVRVVATFPD-----DSHDAIVYPV-AALKNSN--N-PATAAFVSWLGSKPAKA---IFARRGF  250 (253)
T ss_dssp             CT----TEEEEEECCG-----GGSCCEEEEE-EECTTCC--C-TTHHHHHHHTTSHHHHH---HHHHTTC
T ss_pred             HC----CCCEEEEECC-----CCCEEEEEEE-EEECCCC--C-HHHHHHHHHHCCHHHHH---HHHHCCC
T ss_conf             46----8865999689-----8845778769-9988999--9-99999999978999999---9998296


No 9  
>1amf_A Molybdate transport protein MODA; periplasmic, binding protein; 1.75A {Escherichia coli} SCOP: c.94.1.1 PDB: 1wod_A
Probab=99.21  E-value=2.1e-09  Score=69.91  Aligned_cols=227  Identities=12%  Similarity=0.143  Sum_probs=112.6

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCC
Q ss_conf             76799980342589999999999987798079998157620578988521013353012133202476787676248787
Q gi|254780707|r   25 RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD  104 (346)
Q Consensus        25 ~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~  104 (346)
                      ..+|++-+++++.++++.++++|++++ +++| .+..+||+.+.+++.+|..   .|...+.........  ..+.....
T Consensus         2 ~g~l~v~~a~s~~~~~~~l~~~Fek~~-gi~V-~~~~g~s~~l~~~l~~g~~---~~~~~~~~~~~~~~~--~~~~~~~~   74 (233)
T 1amf_A            2 EGKITVFAAASLTNAMQDIATQFKKEK-GVDV-VSSFASSSTLARQIEAGAP---ADLFISADQKWMDYA--VDKKAIDT   74 (233)
T ss_dssp             -CEEEEEEEGGGHHHHHHHHHHHHHHH-CCEE-EEEEECHHHHHHHHHHTCC---CSEEECSSHHHHHHH--HHTTCBCG
T ss_pred             CCEEEEEEECCHHHHHHHHHHHHHHHH-CCEE-EEEECCHHHHHHHHHCCCC---CCEEEECCHHHHHHH--HHCCCCCC
T ss_conf             977999996263999999999998811-9779-9997775999999973999---868996645556777--75256566


Q ss_pred             CEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHH
Q ss_conf             24666521541255416665456888888876410255555323673023231001112245035448854235789998
Q gi|254780707|r  105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK  184 (346)
Q Consensus       105 ~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~~  184 (346)
                      ............+.++..++...                   .....+..|.++..  +..  ..+...+.+++...+..
T Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~~-------------------~~~~~~~~~~~~~~--~~~--~~i~~~~~~~~g~~~~~  131 (233)
T 1amf_A           75 ATRQTLLGNSLVVVAPKASVQKD-------------------FTIDSKTNWTSLLN--GGR--LAVGDPEHVPAGIYAKE  131 (233)
T ss_dssp             GGCEEEEEECEEEEEETTCCCCC-------------------CCCSTTCCHHHHHT--TCC--EEEECTTTCHHHHHHHH
T ss_pred             CCEEEECCCCEEEECCCCCCCCC-------------------CCCCCHHHHHHCCC--CCC--EEEECCCCCHHHHHHHH
T ss_conf             64245204412553034211454-------------------45542556986246--993--89989987518999999


Q ss_pred             HHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCC--CCCCCCCCHHHHCCCCCCC
Q ss_conf             85134555654101111101366000134443102466402116623677763101532--1001332001100111001
Q gi|254780707|r  185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD--VFGFVGLSFYKNNADVLKL  262 (346)
Q Consensus       185 ~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~--~igy~~~~~~~~~~~~~~~  262 (346)
                      .........     ....                     ..............+.....  .+.|.+......  .    
T Consensus       132 ~~~~~~~~~-----~~~~---------------------~~~~~~~~~~~~~~~~~g~~~~~~~~~s~~~~~~--~----  179 (233)
T 1amf_A          132 ALQKLGAWD-----TLSP---------------------KLAPAEDVRGALALVERNEAPLGIVYGSDAVASK--G----  179 (233)
T ss_dssp             HHHHTTCHH-----HHGG---------------------GEEEESSHHHHHHHHHTTSSSEEEEEHHHHHHCS--S----
T ss_pred             HHHHCCCHH-----HHCC---------------------CCCCCCCHHHHHHHHHHCCCCEEEHHHHHHHHHC--C----
T ss_conf             999727512-----3230---------------------1022555047788876246628744678898730--4----


Q ss_pred             CCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCC
Q ss_conf             344576789556027987503678999707885668899999999749874052202775596
Q gi|254780707|r  263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGL  325 (346)
Q Consensus       263 ~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~Gy  325 (346)
                      .....+.|.     ++.+++..+. .+++..+   .++.++|++|++|+++|.   ++.+.||
T Consensus       180 ~~~~~~~p~-----~~~~~~~~~~-~i~k~~~---~~~A~~FidfllS~e~Q~---i~~~~Gf  230 (233)
T 1amf_A          180 VKVVATFPE-----DSHKKVEYPV-AVVEGHN---NATVKAFYDYLKGPQAAE---IFKRYGF  230 (233)
T ss_dssp             EEEEEECCG-----GGSCCEEEEE-EEBTTCC---SHHHHHHHHHHTSHHHHH---HHHHTTC
T ss_pred             CCCEEEECC-----CCCEEEEEEE-EEECCCC---CHHHHHHHHHHCCHHHHH---HHHHCCC
T ss_conf             575398579-----8863767889-9987999---999999999978999999---9998392


No 10 
>3lr1_A Tungstate ABC transporter, periplasmic tungstate- binding protein; the tungstate ABC transporter, structural genomics, PSI, MCSG; 1.80A {Geobacter sulfurreducens}
Probab=99.02  E-value=4.4e-08  Score=62.53  Aligned_cols=94  Identities=14%  Similarity=0.173  Sum_probs=64.6

Q ss_pred             CCCCCEEEEEECCHHHH--HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHH
Q ss_conf             01376799980342589--9999999999877980799981576205789885210133530121332024767876762
Q gi|254780707|r   22 TFARNRIRIAGSSTLFP--YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK   99 (346)
Q Consensus        22 ~~a~~~I~i~GSst~~P--~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~   99 (346)
                      +.+++.|+|..+++...  ++..+++.|++++ +++|. +..+|||..+.++..+.    .|....+......+..... 
T Consensus         1 ~~a~~~l~i~~~~S~~~~gl~~~l~~~Fek~t-gi~V~-~~~g~sg~l~~~i~~~~----~~~~~~~~~~~~~~~~~~~-   73 (236)
T 3lr1_A            1 SNAEERLKMSTTTSTQDSGLLKVLLPPFEKKN-NVKVD-VIAVGTGQALKLGEAGD----VDVVFVHARKLEDKFVADG-   73 (236)
T ss_dssp             -CCSCEEEEEEEHHHHHHCHHHHHHHHHHHHH-TCEEE-EEEECHHHHHHHHHTTS----CSEEEECCHHHHHHHHHTT-
T ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHCCC----CCEEEECCCHHHHHHHHHC-
T ss_conf             99787699999768630113999999999984-98799-99888799999997699----8706602303566665302-


Q ss_pred             CCCCCCEEEEEECCCCEEEECCCCCC
Q ss_conf             48787246665215412554166654
Q gi|254780707|r  100 HGVSDIQEVTIGHDGILLVSDRDMVS  125 (346)
Q Consensus       100 ~~~~~~~~~~v~~d~i~i~~n~~~~~  125 (346)
                         .............++..+.....
T Consensus        74 ---~~~~~~~~~~~~~~~~~~~~~~~   96 (236)
T 3lr1_A           74 ---FGVNRKDVMYNDFVIVGPKNDPA   96 (236)
T ss_dssp             ---SEEEEEEEEECCEEEEECTTCTT
T ss_pred             ---CCCCCCEEEEEEEEEEECCCCCC
T ss_conf             ---55456301100024641133223


No 11 
>3kn3_A Putative periplasmic protein; alpha-beta structure, periplasmic binding protein fold, structural genomics, PSI-2; HET: GTT CIT; 2.41A {Wolinella succinogenes}
Probab=99.01  E-value=5.3e-09  Score=67.67  Aligned_cols=89  Identities=12%  Similarity=0.101  Sum_probs=59.2

Q ss_pred             CCEEEEEECCHH--HHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             767999803425--899999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   25 RNRIRIAGSSTL--FPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        25 ~~~I~i~GSst~--~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
                      +..++|..+++.  .+++..+++.|++++ ++++. +..+|||.+++++.+|.    .|+.+++......++.....   
T Consensus         4 a~~l~i~~~~S~~~~~l~~~l~~~Fe~~t-gikV~-~~~~~Sg~l~~~~~~g~----~~~~~~~~~~~~~~~~~~~~---   74 (242)
T 3kn3_A            4 AAELRMATTTSTDNTGLLDVLAPAYKKDT-GVDLK-WVAVGTGNALKLGENCD----VDVVFVHAPKVELEYVEKGF---   74 (242)
T ss_dssp             CCEEEEEEEHHHHHHTHHHHHHHHHHHHH-SCEEE-EEEECHHHHHHHHHTTC----CSEEEECCHHHHHHHHHHTS---
T ss_pred             CCEEEEEEECCCCCCCHHHHHHHHHHHHH-CCEEE-EEECCCHHHHHHHHCCC----CCEEEECCCHHHHHHHHHCC---
T ss_conf             75689999727752314999999999986-97799-99778499999886478----85543045054799987157---


Q ss_pred             CCCEEEEEECCCCEEEECCCC
Q ss_conf             872466652154125541666
Q gi|254780707|r  103 SDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus       103 ~~~~~~~v~~d~i~i~~n~~~  123 (346)
                       ...........++++++...
T Consensus        75 -~~~~~~~~~~~~~~~~~~~~   94 (242)
T 3kn3_A           75 -GIDRTPVMYNDFVIIGNPSF   94 (242)
T ss_dssp             -EEEEEEEECSCEEEEECTHH
T ss_pred             -CCCCCCHHHCCEEEEEECCC
T ss_conf             -74123110023037752477


No 12 
>3c9h_A ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str}
Probab=98.97  E-value=1.6e-08  Score=65.04  Aligned_cols=123  Identities=14%  Similarity=0.122  Sum_probs=67.4

Q ss_pred             CCHHHHHHHHHHHHHHHHCC--------CCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH
Q ss_conf             92489999999999998314--------2013767999803425899999999999877980799981576205789885
Q gi|254780707|r    1 MRFFFVVLMCFVVLEVYCGT--------GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFC   72 (346)
Q Consensus         1 Mk~~~~~~~~~~~l~~~~~~--------~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~   72 (346)
                      ||+.+.+++++.+.+..++.        +.....+|++-.++ -.++++.+.++|+++|||++|. ++..+++...+++.
T Consensus         1 ~~~~l~l~l~~~~a~~ala~~~~~~~~~~~~~~~~l~v~s~~-~~~~~~~li~~Fe~~~PgI~V~-~~~~~~~~~~~kl~   78 (355)
T 3c9h_A            1 MRICLFLCLCLCMASPALAQVAVFPALSGKTDAQTLVVYSSL-DEPLATPMIEGFQKANPDIAVH-YEDMLTGEIYDRIV   78 (355)
T ss_dssp             ---------------CEEEEEEEECCTTC----CEEEEEECS-CHHHHHHHHHHHHHHCTTCEEE-EEECCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECC-CHHHHHHHHHHHHHHCCCCEEE-EEECCCHHHHHHHH
T ss_conf             907999999999999999888642343567779979999798-8789999999999878893899-99688589999999


Q ss_pred             HHCC--CCCCCEEECCCCCCHHHHHHHHH--------------CCCCCCEEEEEECCCCEEEECCCCCC
Q ss_conf             2101--33530121332024767876762--------------48787246665215412554166654
Q gi|254780707|r   73 RGIG--DDTIDIVNSSRKITQNELDECKK--------------HGVSDIQEVTIGHDGILLVSDRDMVS  125 (346)
Q Consensus        73 ~G~~--~~~~dig~ssr~l~~~E~~~~~~--------------~~~~~~~~~~v~~d~i~i~~n~~~~~  125 (346)
                      ....  +...|+...+....-..+.....              .........+...++.++++|.....
T Consensus        79 ~~~~ag~~~~Dv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yn~~~~~  147 (355)
T 3c9h_A           79 KETDAGKKTADFAFSSAMDLQVKLSNDGYAQRSDLAMSARWPAWANWRNTAYALTFEPAVFVYHKPSFT  147 (355)
T ss_dssp             HHHHTTCCBCSEEEESCHHHHHHHHHTTCEECCCCTTTTTSCGGGEETTTEEECBCEEEEEEEEGGGCS
T ss_pred             HHHHCCCCCCCEEEECCHHHHHHHHHCCCCCCCCCHHHHCCCHHCCCCCCEEECCCEEEEEEEECCCCC
T ss_conf             875148986426761657899999966874457712220360220566855500120689999433333


No 13 
>3muq_A Uncharacterized conserved protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.05A {Vibrio parahaemolyticus}
Probab=98.92  E-value=1.6e-07  Score=59.45  Aligned_cols=93  Identities=15%  Similarity=0.159  Sum_probs=61.3

Q ss_pred             CCCCEEEEEECCHHHH--HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHC
Q ss_conf             1376799980342589--99999999998779807999815762057898852101335301213320247678767624
Q gi|254780707|r   23 FARNRIRIAGSSTLFP--YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKH  100 (346)
Q Consensus        23 ~a~~~I~i~GSst~~P--~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~  100 (346)
                      .+++.|++++++++.+  +++.++++|+++++ +++ .+..+|||..++++.++.    .|+..+..+....+.....  
T Consensus         2 ~~a~~~~~~~~~S~~~sgl~~~l~~~Fek~tG-i~V-~~~~g~sg~l~~~~~~~~----~d~~~~~~~~~~~~~~~~~--   73 (237)
T 3muq_A            2 NAAEHVRLATTTSTYHSGLLDYLLPQFEKDTG-YKV-DVIAAGTGKALKMGENGD----VDLVMTHAPKAEGTFVEKG--   73 (237)
T ss_dssp             ---CEEEEEEEHHHHHHTHHHHHHHHHHHHHC-CEE-EEEEECHHHHHHHHHTTS----SSEEEECCHHHHHHHHHTT--
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHHHHC-CEE-EEEECCCHHHHHHHHCCC----CCEEEECCHHHHHHHHHCC--
T ss_conf             97872799997587402279999999999859-879-999778499999986689----8758851717789887547--


Q ss_pred             CCCCCEEEEEECCCCEEEECCCCCC
Q ss_conf             8787246665215412554166654
Q gi|254780707|r  101 GVSDIQEVTIGHDGILLVSDRDMVS  125 (346)
Q Consensus       101 ~~~~~~~~~v~~d~i~i~~n~~~~~  125 (346)
                      ..  ...........++.+...++.
T Consensus        74 ~~--~~~~~~~~~~~~~~~~~~~~~   96 (237)
T 3muq_A           74 YG--VLPRKLMYNDFVIVGPKADPA   96 (237)
T ss_dssp             SE--EEEEEEEEEEEEEEECTTCTT
T ss_pred             CC--CCCCEEEEEEEEEEEECCCCC
T ss_conf             76--555234541002787614631


No 14 
>1sbp_A Sulfate-binding protein; 1.70A {Salmonella typhimurium} SCOP: c.94.1.1
Probab=98.89  E-value=3.7e-09  Score=68.55  Aligned_cols=241  Identities=13%  Similarity=0.060  Sum_probs=107.2

Q ss_pred             HHHHHHHHHHHH-----CCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCCE------E
Q ss_conf             999999999987-----79807999815762057898852101335301213320247678767624878724------6
Q gi|254780707|r   39 YSKIIAENFSEY-----FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ------E  107 (346)
Q Consensus        39 ~~~~~a~~y~~~-----~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~~------~  107 (346)
                      +++.+.+.|+++     +.++++ +...+||+...++..+|.   ..|+..+..+.....+++.  ..+.+..      .
T Consensus        16 ~~~~i~~aF~k~y~~~TG~~V~v-~~~~ggSg~~~~~i~~g~---~aDV~~~a~~~~~~~l~~~--gl~~~~~~~~~~~~   89 (310)
T 1sbp_A           16 LYEQYNKAFSAHWKQETGDNVVI-DQSHGGSGKQATSVINGI---EADTVTLALAYDVNAIAER--GRIDKNWIKRLPDD   89 (310)
T ss_dssp             HHHHHHHHHHHHHHHHHSCEEEE-EEEESCHHHHHHHHHTTC---CCSEEEESSHHHHHHHHHT--TSSCTTGGGGSHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEE-EECCCCHHHHHHHHHCCC---CCCEEEECCHHHHHHHHHC--CCCCCHHHHHCCCC
T ss_conf             99999999999987614997799-964786199999997499---9898985777889999977--99872033430357


Q ss_pred             EEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCC-CCCCHHHHHH--H
Q ss_conf             665215412554166654568888888764102555553236730232310011122450354488-5423578999--8
Q gi|254780707|r  108 VTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPS-GKHGTREVLE--K  184 (346)
Q Consensus       108 ~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~-~~SGT~~~F~--~  184 (346)
                      ..+.....+++++..++                         .+++.|.|+..  |...+....+. .++|.+..+.  .
T Consensus        90 ~~~~~~~~~~~v~~~~~-------------------------~~~~~w~DL~~--~~~k~~~~~p~~~~~g~~~~~~~~~  142 (310)
T 1sbp_A           90 SAPYTSTIVFLVRKGNP-------------------------KQIHDWNDLIK--PGVSVITPNPKSSGGARWNYLAAWG  142 (310)
T ss_dssp             HCSEEBCEEEEEETTCT-------------------------TCCCSGGGGGS--TTCCEECCCTTTCHHHHHHHHHHHH
T ss_pred             CEEEEEEEEEEEECCCC-------------------------CCCCCHHHHHC--CCCCEEECCCCCCCCHHHHHHHHHH
T ss_conf             40366125899707985-------------------------56665787612--2324254167766411699999999


Q ss_pred             HHCCCCCCCCC-CHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCC
Q ss_conf             85134555654-10111110136600013444310246640211662367776310153210013320011001110013
Q gi|254780707|r  185 KVLQEGCVRSR-NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV  263 (346)
Q Consensus       185 ~v~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~~  263 (346)
                      ........... ........     ..           ................+......+++................
T Consensus       143 ~~~~~~~~~~~~~~~~~~~l-----~~-----------n~~~~~~~~~~~~~~~v~~Ge~~~~i~~~~~~~~~~~~~~~~  206 (310)
T 1sbp_A          143 YALHHNNNDQAKAEDFVKAL-----FK-----------NVEVLDSGARGSTNTFVERGIGDVLIAWENEALLATNELGKD  206 (310)
T ss_dssp             HHHHHTTTCHHHHHHHHHHH-----HH-----------TEEECCSSHHHHHHHHHTSCCCSEEEEEHHHHHHHHHTTTTT
T ss_pred             HHHHHCCCCHHHHHHHHHHH-----HC-----------CCCEECCCCHHHHHHHHHCCCCCEEEEECCHHHHHHHHCCCC
T ss_conf             88640377589999999986-----31-----------573303576689999997598717988511899988632688


Q ss_pred             CCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHHHHHH
Q ss_conf             4457678955602798750367899970788566889999999974987405220277559634899999999
Q gi|254780707|r  264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSV  336 (346)
Q Consensus       264 ~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~~~~  336 (346)
                      .+..+.|......  .||++...-+ ++  +.....+.++|++|++|+++|.   ++.+.||.|..+++..+.
T Consensus       207 ~~~~v~P~~g~~~--~~~~~~~~~~-~k--~~~n~e~A~~FidfLlS~egQ~---i~~~~Gf~P~~~~v~~~~  271 (310)
T 1sbp_A          207 KFEIVTPSESILA--EPTVSVVDKV-VE--KKDTKAVAEAYLKYLYSPEGQE---IAAKNFYRPRDADVAKKY  271 (310)
T ss_dssp             TEEEECCSEEECB--CCEEEECHHH-HH--HHTCHHHHHHHHHGGGSHHHHH---HHHHTTCEESCHHHHHHT
T ss_pred             CEEEECCCCCCCC--CCCEEEEEHH-HC--CCCCHHHHHHHHHHHCCHHHHH---HHHHCCCEECCCCHHHHH
T ss_conf             5599768887766--7876998713-14--7999999999999961999999---999859960880020243


No 15 
>3cfx_A UPF0100 protein MA_0280; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Methanosarcina acetivorans}
Probab=98.79  E-value=2.7e-08  Score=63.76  Aligned_cols=66  Identities=12%  Similarity=0.122  Sum_probs=50.2

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHH
Q ss_conf             767999803425899999999999877980799981576205789885210133530121332024767
Q gi|254780707|r   25 RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNE   93 (346)
Q Consensus        25 ~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E   93 (346)
                      .++|+|-.+.+..+.++.++++|+++||+++| .++..+++..++++++|.  ...|+...+.......
T Consensus         4 ge~ltv~~~gs~~~~~~~l~~~Fe~~~P~i~V-~~~~~~~~~~~~~~~a~g--~~pDv~~~~~~~~~~~   69 (296)
T 3cfx_A            4 GEVLTVFHAGSLSVPFEELEAEFEAQHPGVDV-QREAAGSAQSVRKITELG--KKADVLASADYALIPS   69 (296)
T ss_dssp             CCEEEEEECGGGHHHHHHHHHHHHHHSTTCEE-EEEECCHHHHHHHHHTSC--CCCSEEEESSTTHHHH
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHCCCCEE-EEEECCHHHHHHHHHHCC--CCCCEEEECCHHHHHH
T ss_conf             88799997567199999999999988839389-999688199999999679--9999999863566699


No 16 
>3k6v_A Solute-binding protein MA_0280; MODA, molybdate, periplasmic binding protein, ABC transporter, transport protein, ligand; HET: CIT; 1.69A {Methanosarcina acetivorans} PDB: 3k6u_A* 3k6w_A 3k6x_A
Probab=98.72  E-value=6.4e-06  Score=50.50  Aligned_cols=58  Identities=14%  Similarity=0.173  Sum_probs=46.5

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEEC
Q ss_conf             7679998034258999999999998779807999815762057898852101335301213
Q gi|254780707|r   25 RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS   85 (346)
Q Consensus        25 ~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~s   85 (346)
                      .++|++-.+.+..+.++.++++|+++||+++| .++..||+..+++++.|.  ...|+..+
T Consensus        42 ~~~Ltv~~~gs~~~~~~~l~~~Fek~~P~IkV-~~~~~~~~~~~~~~~~~g--~~pDV~~~   99 (354)
T 3k6v_A           42 GEVLTVFHAGSLSVPFEELEAEFEAQHPGVDV-QREAAGSAQSVRKITELG--KKADVLAS   99 (354)
T ss_dssp             -CEEEEEEEGGGHHHHHHHHHHHHHHSTTCEE-EEEEECHHHHHHHHHTSC--CCCSEEEE
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHCCCEEE-EEEECCCHHHHHHHHHCC--CCCCEEEE
T ss_conf             97699998067389999999999998849289-999688199999999679--99878998


No 17 
>3cij_A UPF0100 protein AF_0094; archaeal periplasmic binding protein, unknown function, metal binding protein, transport protein; 1.07A {Archaeoglobus fulgidus} PDB: 2ons_A 2onk_E 2onr_A
Probab=98.63  E-value=4.6e-06  Score=51.31  Aligned_cols=58  Identities=16%  Similarity=0.279  Sum_probs=44.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECC
Q ss_conf             6799980342589999999999987798079998157620578988521013353012133
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS   86 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ss   86 (346)
                      -+|+|-.+++..+.++.++++|+++||+++| .++..|++..+++++++.  ...|+....
T Consensus         5 v~Ltv~~ags~~~~~~~~~~~Fe~~~P~I~V-~~~~~~~~~~~~~~~a~g--~~pDv~~~~   62 (295)
T 3cij_A            5 VKLKVFHAGSLTEPMKAFKRAFEEKHPNVEV-QTEAAGSAATIRKVTELG--RKADVIATA   62 (295)
T ss_dssp             CEEEEEEEGGGHHHHHHHHHHHHHHCTTCEE-EEEEECHHHHHHHHHTSC--CCCSEEEES
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHHCCCCEE-EEEECCCHHHHHHHHHCC--CCCCEEEEC
T ss_conf             0899998268599999999999988849089-999688099999999679--999889988


No 18 
>2fyi_A HTH-type transcriptional regulator CBL; Lys-R family, cofactor-binding domain, cysteine biosynthesis; 2.80A {Escherichia coli K12} SCOP: c.94.1.1
Probab=98.17  E-value=0.00024  Score=41.73  Aligned_cols=203  Identities=13%  Similarity=0.069  Sum_probs=119.6

Q ss_pred             CCCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCC
Q ss_conf             1376799980342589-999999999987798079998157620578988521013353012133202476787676248
Q gi|254780707|r   23 FARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHG  101 (346)
Q Consensus        23 ~a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~  101 (346)
                      ..+++|+|+-+.++.. ++..+..+|++.||++++. +....+..-.+.+.+|.    +|+|....++.+.         
T Consensus        11 ~~~G~lrIg~~~~~a~~~Lp~~l~~f~~~~P~i~l~-i~~~~~~~l~~~L~~g~----~D~ai~~~~~~~~---------   76 (228)
T 2fyi_A           11 DTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLE-LIQGTPQEIATLLQNGE----ADIGIASERLSND---------   76 (228)
T ss_dssp             TCCEEEEEEECHHHHHHTHHHHHHHHHHHCTTEEEE-EEECCHHHHHHHHHHTS----CSEEEESSSSTTC---------
T ss_pred             CCCCEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCCHHHHHHHHCCC----CCEEEEECCCCCC---------
T ss_conf             997179999758899999999999999988994899-99676599999986688----3323331123568---------


Q ss_pred             CCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHH
Q ss_conf             78724666521541255416665456888888876410255555323673023231001112245035448854235789
Q gi|254780707|r  102 VSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV  181 (346)
Q Consensus       102 ~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~  181 (346)
                       ..+...++..+.+++++.++.+....                      +...|.|+    .+.|+..+  +++++++..
T Consensus        77 -~~~~~~~l~~~~~~~v~~~~~~~~~~----------------------~~i~~~dL----~~~p~i~~--~~~~~~~~~  127 (228)
T 2fyi_A           77 -PQLVAFPWFRWHHSLLVPHDHPLTQI----------------------SPLTLESI----AKWPLITY--RQGITGRSR  127 (228)
T ss_dssp             -TTEEEEEEEEECEEEEEETTCGGGTS----------------------SSCCHHHH----TTSCEEEE--CTTSTTHHH
T ss_pred             -CCCEEEEEEECCCCEECCCCCCCCCC----------------------CCCCHHHH----HCCCCCCC--CCCCCHHHH
T ss_conf             -65336773203430113564200034----------------------44447887----25972126--899817888


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCC
Q ss_conf             99885134555654101111101366000134443102466402116623677763101532100133200110011100
Q gi|254780707|r  182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK  261 (346)
Q Consensus       182 F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~  261 (346)
                      +.+.....+...                             ...-..++...+...+ ....++++++....... ..-.
T Consensus       128 ~~~~~~~~~~~~-----------------------------~~~~~~~~~~~~~~~v-~~g~gi~~lp~~~~~~~-~~~~  176 (228)
T 2fyi_A          128 IDDAFARKGLLA-----------------------------DIVLSAQDSDVIKTYV-ALGLGIGLVAEQSSGEQ-EEEN  176 (228)
T ss_dssp             HHHHHHHTTCCC-----------------------------CEEEEESSHHHHHHHH-HHTSCEEEEEGGGGSTT-CCTT
T ss_pred             HHHHHHHCCCCC-----------------------------CEEEEECCHHHHHHHH-HCCCEEEECCHHHHHHH-HCCC
T ss_conf             998765038777-----------------------------5347847899999998-65999998639998565-4599


Q ss_pred             CCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             1344576789556027987503678999707885668899999999749
Q gi|254780707|r  262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS  310 (346)
Q Consensus       262 ~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls  310 (346)
                      .     +     .+....++..+.+|++.+++ ....+.++.|++++-.
T Consensus       177 l-----v-----~l~~~~~~~~~~~~l~~~~~-~~~~~~~~~Fi~~~~~  214 (228)
T 2fyi_A          177 L-----I-----RLDTRHLFDANTVWLGLKRG-QLQRNYVWRFLELCNA  214 (228)
T ss_dssp             E-----E-----EECCTTTSCCEEEEEEEETT-CCBCHHHHHHHHHHCS
T ss_pred             E-----E-----EEECCCCCCCEEEEEEEECC-CCCCHHHHHHHHHHHH
T ss_conf             8-----9-----99687777640899999896-8679999999999986


No 19 
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli}
Probab=98.02  E-value=0.00048  Score=40.06  Aligned_cols=68  Identities=9%  Similarity=0.092  Sum_probs=38.3

Q ss_pred             HHCCCCCCCCEEEEEECCHHHH---HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEEC
Q ss_conf             8314201376799980342589---99999999998779807999815762057898852101335301213
Q gi|254780707|r   17 YCGTGTFARNRIRIAGSSTLFP---YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS   85 (346)
Q Consensus        17 ~~~~~~~a~~~I~i~GSst~~P---~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~s   85 (346)
                      +..+++..+.++++--.++..+   -...+.+.|++++ +++|..+..+.++.-+.++.....+...|+-.+
T Consensus        14 ~~~~~~~~~~~l~Vy~~~~~~~~~~~~~~i~~~FE~~~-gi~V~~~~~~s~~~ll~kl~~e~~~~~~DVv~~   84 (330)
T 2qry_A           14 LVPRGSHMKPVLTVYTYDSFAADWGPGPVVKKAFEADC-NCELKLVALEDGVSLLNRLRMEGKNSKADVVLG   84 (330)
T ss_dssp             --------CCEEEEEECHHHHSTTSSHHHHHHHHHTTS-CSEEEEEECSCHHHHHHHHHHHGGGCCCSEEEE
T ss_pred             CCCCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHH-CCEEEEEECCCHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             66556567987999978765535577779999999987-978999958998999999997279998329997


No 20 
>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 1qvs_A 2o6a_A 2o68_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A
Probab=97.99  E-value=0.00027  Score=41.49  Aligned_cols=52  Identities=13%  Similarity=0.109  Sum_probs=37.0

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECC
Q ss_conf             342589999999999987798079998157620578988521013353012133
Q gi|254780707|r   33 SSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS   86 (346)
Q Consensus        33 Sst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ss   86 (346)
                      |+....+++.+++.|++++ |++|. +...+++.-+.++.+...+...|+-.+.
T Consensus         6 s~~~~~~~~~i~~~Fe~~t-GIkV~-~~~~~~~~~~~kl~aeg~~~~~DV~~~~   57 (309)
T 1nnf_A            6 NGQQKEAATAVAKAFEQET-GIKVT-LNSGKSEQLAGQLKEEGDKTPADVFYTE   57 (309)
T ss_dssp             ECSCHHHHHHHHHHHHHHS-CCCEE-EEECCHHHHHHHHHHHGGGCCCSEEEES
T ss_pred             ECCCHHHHHHHHHHHHHHH-CCEEE-EEECCCHHHHHHHHHCCCCCCCCEEEEC
T ss_conf             5989889999999998855-97799-9989709999999974689998789968


No 21 
>2hxr_A HTH-type transcriptional regulator CYNR; CYNR transcriptional regulator LYSR structural genomics, PSI-2, protein structure initiative; 2.05A {Escherichia coli K12} PDB: 3hfu_A
Probab=97.94  E-value=0.00045  Score=40.20  Aligned_cols=201  Identities=12%  Similarity=0.205  Sum_probs=116.8

Q ss_pred             CCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             376799980342589-9999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   24 ARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        24 a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
                      .+++|+|+-+.++.. ++..+..+|.+.||++.+. +....+..-++.+.+|.    +|+|....+..+.+         
T Consensus        28 ~~g~l~Ig~~~~~~~~~l~~~l~~f~~~~P~i~l~-i~~~~~~~l~~~l~~g~----~D~~i~~~~~~~~~---------   93 (238)
T 2hxr_A           28 TRGSLRIAVTPTFTSYFIGPLMADFYARYPSITLQ-LQEMSQEKIEDMLCRDE----LDVGIAFAPVHSPE---------   93 (238)
T ss_dssp             ---CEEEEECHHHHTTTHHHHHHHHHHHCTTSCEE-EEECCHHHHHHHHHTTS----CSEEEEESSCCCTT---------
T ss_pred             CCEEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-EECCCHHHHHHHHHCCC----CHHHHHCCCCCCCC---------
T ss_conf             84289999537899999999999999988998899-73288799999998698----30012025544310---------


Q ss_pred             CCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHH
Q ss_conf             87246665215412554166654568888888764102555553236730232310011122450354488542357899
Q gi|254780707|r  103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL  182 (346)
Q Consensus       103 ~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F  182 (346)
                        +...++..+.++++++++.+...                      .+...|.|+    .+.|...+  ++++++++.+
T Consensus        94 --~~~~~l~~~~~~~~~~~~hpla~----------------------~~~i~~~dL----~~~~~i~~--~~~~~~~~~~  143 (238)
T 2hxr_A           94 --LEAIPLLTESLALVVAQHHPLAV----------------------HEQVALSRL----HDEKLVLL--SAEFATREQI  143 (238)
T ss_dssp             --EEEEEEEEEEEEEEEETTSGGGG----------------------CSEECGGGG----GGCEEEEE--CTTSHHHHHH
T ss_pred             --HHHHHHHHHHHHHCCCCHHHHHH----------------------CCCCCHHHH----HCCCEEEE--CCCCCHHHHH
T ss_conf             --43333455422321320046654----------------------035879998----13968984--8998579999


Q ss_pred             HHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCC
Q ss_conf             98851345556541011111013660001344431024664021166236777631015321001332001100111001
Q gi|254780707|r  183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL  262 (346)
Q Consensus       183 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~  262 (346)
                      .+.+...+...                             ...-..++...+.+.+... .+++.++....... .....
T Consensus       144 ~~~~~~~~~~~-----------------------------~~~~~~~~~~~~~~~v~~g-~gi~~~p~~~~~~~-~~~~~  192 (238)
T 2hxr_A          144 DHYCEKAGLHP-----------------------------QVVIEANSISAVLELIRRT-SLSTLLPAAIATQH-DGLKA  192 (238)
T ss_dssp             HHHHHHTTCCC-----------------------------EEEEEESCHHHHHHHHHHS-SCBEEEETHHHHHC-TTEEE
T ss_pred             HHHHHHCCCCC-----------------------------CEEECCCCHHHHHHHHHHC-CEEEEEHHHHHHHC-CCCEE
T ss_conf             99999769987-----------------------------5212368779999999939-97997029986037-89339


Q ss_pred             CCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHH
Q ss_conf             34457678955602798750367899970788566889999999974987
Q gi|254780707|r  263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE  312 (346)
Q Consensus       263 ~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~  312 (346)
                      +++.            .-++.+++|++.++. ....++++.|++++...-
T Consensus       193 ~~~~------------~~~~~~~~~li~~~~-~~~s~~~~~fi~~~~e~~  229 (238)
T 2hxr_A          193 ISLA------------PPLLERTAVLLRRKN-SWQTAAAKAFLHMALDKC  229 (238)
T ss_dssp             EEES------------SCSCEEEEEEEEETT-SCCCHHHHHHHHHHHHHH
T ss_pred             EECC------------CCCCEEEEEEEEECC-CCCCHHHHHHHHHHHHHH
T ss_conf             9788------------998624999999895-978999999999999998


No 22 
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A*
Probab=97.91  E-value=0.00031  Score=41.08  Aligned_cols=78  Identities=18%  Similarity=0.229  Sum_probs=57.2

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEC---CHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCC
Q ss_conf             924899999999999983142013767999803---42589999999999987798079998157620578988521013
Q gi|254780707|r    1 MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGS---STLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD   77 (346)
Q Consensus         1 Mk~~~~~~~~~~~l~~~~~~~~~a~~~I~i~GS---st~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~   77 (346)
                      ||+.++..++       .++.+.++++|+++.+   ++-+++...+++..++..+++++.+....||..=+..+.+|.  
T Consensus         1 m~~~ila~l~-------~a~~a~A~~~l~i~tg~~gg~~~~~g~~ia~~~~~~~~gi~~~~~~t~Gs~~N~~~l~~g~--   71 (314)
T 1us5_A            1 MRKPILAALT-------LAGLGLAQEFITIGSGSTTGVYFPVATGIAKLVNDANVGIRANARSTGGSVANINAINAGE--   71 (314)
T ss_dssp             -----------------------CCEEEEEECCCTTSSHHHHHHHHHHHHHHHTSSEEEEEECCSCHHHHHHHHHTTS--
T ss_pred             CCHHHHHHHH-------HHCHHHHCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHCCC--
T ss_conf             9389999999-------7243423314899979999714999999999997358984899980788899999997699--


Q ss_pred             CCCCEEECCCCC
Q ss_conf             353012133202
Q gi|254780707|r   78 DTIDIVNSSRKI   89 (346)
Q Consensus        78 ~~~dig~ssr~l   89 (346)
                        +|+|.+.-..
T Consensus        72 --~d~a~~~~~~   81 (314)
T 1us5_A           72 --FEMALAQNDI   81 (314)
T ss_dssp             --CSEEEEEHHH
T ss_pred             --CCEEEECHHH
T ss_conf             --7199975089


No 23 
>1xvx_A YFUA; periplasmic iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A*
Probab=97.81  E-value=0.00083  Score=38.74  Aligned_cols=126  Identities=11%  Similarity=0.081  Sum_probs=62.7

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEEC-CCC-CCHHH---------
Q ss_conf             7679998034258999999999998779807999815762057898852101335301213-320-24767---------
Q gi|254780707|r   25 RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS-SRK-ITQNE---------   93 (346)
Q Consensus        25 ~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~s-sr~-l~~~E---------   93 (346)
                      .+.+.+-. +.-..+++.+++.|.+++ |++|. +...+|+.-+.++.+...+...|+..+ +.. +....         
T Consensus         4 ~~~lvVYs-~~~e~~~~~l~~~Feket-GIkV~-~~~~~~~~~~~ki~aeg~~~~~Dv~~~~~~~~~~~~~~~gl~~~~~   80 (312)
T 1xvx_A            4 DSGIVVYN-AQHENLVKSWVDGFTKDT-GIKVT-LRNGGDSELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLD   80 (312)
T ss_dssp             CSCEEEEE-CSCHHHHHHHHHHHHHHH-CCCEE-EEECCHHHHHHHHHHHGGGCCCSEEEESSSHHHHHHHHTTCBCCCC
T ss_pred             CCEEEEEE-CCCHHHHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHCCHHHHHH
T ss_conf             98499997-988779999999988865-98899-9989809999999963899996399988778988877515245431


Q ss_pred             ---HHHHHHCC-CCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEE
Q ss_conf             ---87676248-78724666521541255416665456888888876410255555323673023231001112245035
Q gi|254780707|r   94 ---LDECKKHG-VSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI  169 (346)
Q Consensus        94 ---~~~~~~~~-~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~  169 (346)
                         ........ ...-.-+++.....++++|.+.....                      +-.++|.++..  |..+.+.
T Consensus        81 ~~~~~~i~~~~~~~~~~~~~~~~~~~~~~yn~~~~~~~----------------------~~P~t~~dl~~--~~~~g~~  136 (312)
T 1xvx_A           81 AVTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEKISEA----------------------ELPKSIMDLAK--PEWKGRW  136 (312)
T ss_dssp             HHHHHHBCGGGSCSSSSCEEEEEEEEEEEECTTTSCGG----------------------GSCSSGGGGGS--GGGTTSE
T ss_pred             HCCHHHHHHHHCCCCCEEEEEEEEEEEEEECHHHCCCC----------------------CCCCCHHHHHC--CHHCCCC
T ss_conf             10022223652667980899986469999710014656----------------------69878998714--0212421


Q ss_pred             ECCCCCCC
Q ss_conf             44885423
Q gi|254780707|r  170 YVPSGKHG  177 (346)
Q Consensus       170 ~~r~~~SG  177 (346)
                      ..+...+.
T Consensus       137 ~~~~~~~~  144 (312)
T 1xvx_A          137 AASPSGAD  144 (312)
T ss_dssp             EECTTSHH
T ss_pred             CCCHHHHH
T ss_conf             01201456


No 24 
>3cg1_A UPF0100 protein PF0080; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Pyrococcus furiosus} PDB: 3cg3_A
Probab=97.81  E-value=0.0012  Score=37.87  Aligned_cols=93  Identities=13%  Similarity=0.119  Sum_probs=50.6

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHHHHHCCC---CEEE-EEECCCCHHHHHHHHHHCCCCCCCEEEC-CCCCCHHHHHHHH
Q ss_conf             376799980342589999999999987798---0799-9815762057898852101335301213-3202476787676
Q gi|254780707|r   24 ARNRIRIAGSSTLFPYSKIIAENFSEYFPE---FKTP-FVESGGSSVGLKEFCRGIGDDTIDIVNS-SRKITQNELDECK   98 (346)
Q Consensus        24 a~~~I~i~GSst~~P~~~~~a~~y~~~~~~---~~~~-~~~~~GSg~Gi~~~~~G~~~~~~dig~s-sr~l~~~E~~~~~   98 (346)
                      .+-+|++-.+.+..+-++.++++|+++||+   ++|. .....|+..-+++...+.  ...|+... +...    +....
T Consensus         3 ~evtl~v~~~gs~~~~~~~l~~~Fe~~~P~~tgi~V~~~~~~~~~~~~~~~~~~~g--~~~Dv~~~~~~~~----~~~~~   76 (296)
T 3cg1_A            3 MEVTLIVFHAGSLSVPFQEVEKEFSEYAERNLGIKVSFQDEASGSVMAVRKVTDLG--RKADVIGVADYTL----IPQLL   76 (296)
T ss_dssp             -CEEEEEEEEGGGHHHHHHHHHHHHHHHHHHHSCCEEEEEEEECHHHHHHHHHTSC--CCCSEEEESSTTH----HHHHT
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHCC--CCCCEEEECCHHH----HHHHH
T ss_conf             75189999764748999999999998678778669999957998999999999569--9998899778899----99999


Q ss_pred             HC-CCCCCEEEEEECCCCEEEECCCCC
Q ss_conf             24-878724666521541255416665
Q gi|254780707|r   99 KH-GVSDIQEVTIGHDGILLVSDRDMV  124 (346)
Q Consensus        99 ~~-~~~~~~~~~v~~d~i~i~~n~~~~  124 (346)
                      .. ...++  .++..+.+...++..+.
T Consensus        77 ~~g~l~~~--~~~~~~~~~~~~~~~~~  101 (296)
T 3cg1_A           77 IPNYTDFY--VLFATNEIVIAFTDKSR  101 (296)
T ss_dssp             TTTTCSCC--EEEEECCEEEEECTTST
T ss_pred             HCCCCCCC--CCCCCCCCCEECCCCCC
T ss_conf             77997877--31003555423025664


No 25 
>2voz_A FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A*
Probab=97.80  E-value=7.1e-05  Score=44.66  Aligned_cols=61  Identities=13%  Similarity=0.012  Sum_probs=34.9

Q ss_pred             CCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCC------CCHHHH
Q ss_conf             678955602798750367899970788566889999999974987405220277559634------899999
Q gi|254780707|r  268 IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIP------ISNEER  333 (346)
Q Consensus       268 v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvP------Lp~~~~  333 (346)
                      +.|....-..|.+-+...+. +++.  .....+.++|++|+||.++|.  .+.+..++.|      +|++..
T Consensus       248 ~~~~~~~p~eG~~~~~~~~~-i~k~--a~n~e~A~~Fi~fllspe~Q~--~~a~~~~~~Pv~~~~~~~~~~~  314 (346)
T 2voz_A          248 FFPNTGSGERGTHVNVSGAG-VLKN--APNRDAAIAFLEYLASDDAQR--YFAEGNNEYPVIPGVPIDPVLA  314 (346)
T ss_dssp             ECCSCSTTSCCBCEEEEEEE-EBTT--CTTHHHHHHHHHHHTSHHHHH--HHHHHTTCEESSTTSCCCHHHH
T ss_pred             ECCCCCCCCCCCEEEEEEEE-CCCC--CCCHHHHHHHHHHHCCHHHHH--HHHHHCCEEECCCCCCCCHHHC
T ss_conf             03454347888469887433-0269--999899999999976999999--9997274531789999980016


No 26 
>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, periplasmic binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A
Probab=97.64  E-value=0.001  Score=38.24  Aligned_cols=63  Identities=11%  Similarity=0.107  Sum_probs=43.2

Q ss_pred             CCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECC
Q ss_conf             201376799980342589999999999987798079998157620578988521013353012133
Q gi|254780707|r   21 GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS   86 (346)
Q Consensus        21 ~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ss   86 (346)
                      ...+.+.|+|--++. +.+.+.+.++|++++ |++|. +...+++.-+.++.....+...|+....
T Consensus        14 ~~~~~~~l~v~~~~~-~~~~~~l~~~Fek~t-GIkV~-~~~~~~~~~~~kl~a~~~~~~~Dvv~~~   76 (334)
T 2pt1_A           14 TPGEQQEINLYSSRH-YNTDNELYAKFTAET-GIKVN-LIEGKADELLERIKSEGANSPADVLLTV   76 (334)
T ss_dssp             ----CCEEEEEESCC-CTTHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHHHGGGCCCCEEEEE
T ss_pred             CCCCCCEEEEEECCC-CCCHHHHHHHHHHHH-CCEEE-EEECCCHHHHHHHHHCCCCCCCCEEEEC
T ss_conf             777689899997998-552599999999986-98799-9979849999999964899998589955


No 27 
>1ixc_A CBNR, LYSR-type regulatory protein; long alpha helix connecting DNA binding and regulatory domains, DNA binding protein; 2.20A {Cupriavidus necator} SCOP: a.4.5.37 c.94.1.1 PDB: 1iz1_A
Probab=97.58  E-value=0.0027  Score=35.90  Aligned_cols=200  Identities=13%  Similarity=0.085  Sum_probs=115.9

Q ss_pred             CCCEEEEEECCH-HHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             376799980342-5899999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   24 ARNRIRIAGSST-LFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        24 a~~~I~i~GSst-~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
                      ...++++.-..+ ..-++..+...|.+.||++.+. +....+..-++.+.+|.    +||+....+..+.          
T Consensus        89 ~~~~i~~~~~~~~~~~~l~~~~~~~~~~~p~v~~~-i~~~~~~~~~~~l~~g~----~Di~i~~~~~~~~----------  153 (294)
T 1ixc_A           89 DVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVS-LTHMTKDEQVEGLLAGT----IHVGFSRFFPRHP----------  153 (294)
T ss_dssp             CCEEEEEEECSGGGGTHHHHHHHHHHHHCTTEEEE-EEECCHHHHHHHHHHTS----CSEEEESCCCCCT----------
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCC-CEEECCHHCCCCCCCCC----EEEEEECCCCCCC----------
T ss_conf             65237873253079999999999975318764443-04520310032114796----4688851677787----------


Q ss_pred             CCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHH
Q ss_conf             87246665215412554166654568888888764102555553236730232310011122450354488542357899
Q gi|254780707|r  103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL  182 (346)
Q Consensus       103 ~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F  182 (346)
                       .+...++..+.++++++.+.+....                      +..++.|+    -+.+...+.....++....+
T Consensus       154 -~l~~~~l~~~~~~~~~~~~h~~~~~----------------------~~i~~~dl----~~~~~i~~~~~~~~~~~~~~  206 (294)
T 1ixc_A          154 -GIEIVNIAQEDLYLAVHRSQSGKFG----------------------KTCKLADL----RAVELTLFPRGGRPSFADEV  206 (294)
T ss_dssp             -TEEEEEEEEEEEEEEEEGGGGGGTC----------------------SEECGGGG----TTCEEEECCCSSSSCHHHHH
T ss_pred             -CCCCCCCCCCEEEEEEECCCHHHCC----------------------CCCCHHHH----HCCCEEEECCCCCCCHHHHH
T ss_conf             -5422201352079998273076539----------------------99999998----18997996387675146777


Q ss_pred             HHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCC
Q ss_conf             98851345556541011111013660001344431024664021166236777631015321001332001100111001
Q gi|254780707|r  183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL  262 (346)
Q Consensus       183 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~  262 (346)
                      .+.....+...                             ..+-..++...+.+.+.. ..+++.++..........+..
T Consensus       207 ~~~~~~~g~~~-----------------------------~~~~~~~~~~~~~~lv~~-g~gia~lp~~~~~~~~~~~~~  256 (294)
T 1ixc_A          207 IGLFKHAGIEP-----------------------------RIARVVEDATAALALTMA-GAASSIVPASVAAIRWPDIAF  256 (294)
T ss_dssp             HHHHHHTTCCC-----------------------------EEEEECSSHHHHHHHHHT-TSCBEEEEHHHHTSCCTTEEE
T ss_pred             HHHHHCCCCCC-----------------------------CEEEEECCHHHHHHHHHH-CCEEEECCHHHHHHHCCCEEE
T ss_conf             77653245477-----------------------------446886579999999994-997998108898552298599


Q ss_pred             CCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             34457678955602798750367899970788566889999999974
Q gi|254780707|r  263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSV  309 (346)
Q Consensus       263 ~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~l  309 (346)
                      ++            -...|+.+++|++.++..  ..+.++.|++++-
T Consensus       257 ~~------------l~~~~~~~~~~li~~~~~--~~p~~~~fi~~l~  289 (294)
T 1ixc_A          257 AR------------IVGTRVKVPISCIFRKEK--QPPILARFVEHVR  289 (294)
T ss_dssp             EE------------ECCTTCEEEEEEEEESSS--CCHHHHHHHHHHH
T ss_pred             EE------------CCCCCCEEEEEEEEECCC--CCHHHHHHHHHHH
T ss_conf             97------------789886038999997999--9989999999999


No 28 
>2h9b_A HTH-type transcriptional regulator BENM; LTTR, transcriptional activator, LYSR-type transcriptional regulator; 1.80A {Acinetobacter SP} PDB: 2h99_A 3k1m_A 3k1n_A 3k1p_A 2f7a_A* 2f6p_A 2f78_A 2f6g_A* 2f8d_A 2f97_A*
Probab=97.51  E-value=0.0033  Score=35.38  Aligned_cols=203  Identities=13%  Similarity=0.126  Sum_probs=119.5

Q ss_pred             CCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             376799980342589-9999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   24 ARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        24 a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
                      ....++|+...++.. ++..+...|.+.+|++.+. +....+...+..+.+|.    +||+.+..+..+.          
T Consensus        88 ~~~~l~i~~~~~~~~~~l~~~l~~~~~~~p~v~l~-~~~~~~~~l~~~l~~g~----~Dlai~~~~~~~~----------  152 (312)
T 2h9b_A           88 VEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIE-LYEMGTKAQTEALKEGR----IDAGFGRLKISDP----------  152 (312)
T ss_dssp             -CCEEEEEECGGGGGTTHHHHHHHHHHTCTTCEEE-EEECCHHHHHHHHHTTS----CSEEEESSCCCCT----------
T ss_pred             CCCEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-ECCCCCHHHHHHHHCCC----CCEEEEECCCCCC----------
T ss_conf             57459997535668999999999999978997785-31355077999997699----6479960688987----------


Q ss_pred             CCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHH
Q ss_conf             87246665215412554166654568888888764102555553236730232310011122450354488542357899
Q gi|254780707|r  103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL  182 (346)
Q Consensus       103 ~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F  182 (346)
                       .+...++..+..+++.+...+.....                    ....+|.|+    .+.|...+.+...++.+..+
T Consensus       153 -~~~~~~l~~~~~~~~~~~~~~l~~~~--------------------~~~~~~~dl----~~~~~i~~~~~~~~~~~~~~  207 (312)
T 2h9b_A          153 -AIKHSLLRNERLMVAVHASHPLNQMK--------------------DKGVHLNDL----IDEKILLYPSSPKPNFSTHV  207 (312)
T ss_dssp             -TEEEEEEEEEEEEEEEETTSGGGGGT--------------------TTCBCGGGS----TTSEEEECCCSSSSSHHHHH
T ss_pred             -CCEEEEECCCEEEEEECCCCHHHHCC--------------------CCCCHHHHH----CCCCEEEECCCCCCCHHHHH
T ss_conf             -61799811305999963788466533--------------------432025564----37977984287665124666


Q ss_pred             HHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCC
Q ss_conf             98851345556541011111013660001344431024664021166236777631015321001332001100111001
Q gi|254780707|r  183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL  262 (346)
Q Consensus       183 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~  262 (346)
                      .......+...                             ...-..++...+.+.+... .+++.++..........+..
T Consensus       208 ~~~~~~~~~~~-----------------------------~~~~~~~s~~~~~~~v~~g-~gi~ilP~~~~~~~~~~l~~  257 (312)
T 2h9b_A          208 MNIFSDHGLEP-----------------------------TKINEVREVQLALGLVAAG-EGISLVPASTQSIQLFNLSY  257 (312)
T ss_dssp             HHHHHTTTCCC-----------------------------SEEEECSSHHHHHHHHHTT-SCBEEEEGGGGGBCCTTEEE
T ss_pred             HHHHHHCCCCC-----------------------------CEEEECCCHHHHHHHHHCC-CEEEEECHHHHHHHHCCEEE
T ss_conf             66666507886-----------------------------1465316799999999839-95999209887453388799


Q ss_pred             CCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             344576789556027987503678999707885668899999999749
Q gi|254780707|r  263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS  310 (346)
Q Consensus       263 ~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls  310 (346)
                      +++          .+  =++.+++|++.++.  ...+.++.|++++-.
T Consensus       258 ~pl----------~~--~~~~~~~~l~~r~~--~~~~~~~~~~~~~~~  291 (312)
T 2h9b_A          258 VPL----------LD--PDAITPIYIAVRNM--EESTYIYSLYETIRQ  291 (312)
T ss_dssp             EEB----------CS--TTCEEEEEEEEETT--CCCHHHHHHHHHHHH
T ss_pred             EEC----------CC--CCCEEEEEEEEECC--CCCHHHHHHHHHHHH
T ss_conf             985----------79--88632899999799--999899999999999


No 29 
>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1
Probab=97.48  E-value=0.0036  Score=35.17  Aligned_cols=203  Identities=9%  Similarity=0.018  Sum_probs=115.8

Q ss_pred             CCCCEEEEEECCHHH-HHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCC
Q ss_conf             137679998034258-9999999999987798079998157620578988521013353012133202476787676248
Q gi|254780707|r   23 FARNRIRIAGSSTLF-PYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHG  101 (346)
Q Consensus        23 ~a~~~I~i~GSst~~-P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~  101 (346)
                      ....+|+|+.+.+.. .++..+...|.+.+|++.+. +....+..-+..+.+|.    +||+.+..+....         
T Consensus        90 ~~~g~l~i~~~~~~~~~~l~~~l~~~~~~~P~i~i~-l~~~~~~~~~~~l~~~~----~D~~i~~~~~~~~---------  155 (324)
T 1al3_A           90 PDKGSLYVATTHTQARYALPGVIKGFIERYPRVSLH-MHQGSPTQIAEAVSKGN----ADFAIATEALHLY---------  155 (324)
T ss_dssp             CCEEEEEEEECHHHHHHTSHHHHHHHHHHCTEEEEE-EEECCHHHHHHHHHTTC----CSEEEESSCCCTT---------
T ss_pred             CCCCCEEEEECHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCHHHHHHHHHCCC----EEEEEECCCCCCC---------
T ss_conf             566750675336878878999999999758982899-99798799986674798----2588630676776---------


Q ss_pred             CCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHH
Q ss_conf             78724666521541255416665456888888876410255555323673023231001112245035448854235789
Q gi|254780707|r  102 VSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV  181 (346)
Q Consensus       102 ~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~  181 (346)
                       ......++..+.++++++++.+....                      +...|.|+    .+.|..  .++++++++..
T Consensus       156 -~~~~~~~l~~~~~~~~~~~~~~l~~~----------------------~~i~~~dL----~~~~~i--~~~~~~~~~~~  206 (324)
T 1al3_A          156 -DDLVMLPCYHWNRSIVVTPEHPLATK----------------------GSVSIEEL----AQYPLV--TYTFGFTGRSE  206 (324)
T ss_dssp             -SCEEEEEEEEECEEEEECTTSTTTTT----------------------SCCCHHHH----HTSEEE--EECTTSTTHHH
T ss_pred             -CCEEEEEEEEEEEEEEECCCCHHCCC----------------------CCCCHHHH----HHCCCE--ECCCCCCHHHH
T ss_conf             -65058986530057997465221039----------------------99999999----628772--04899848999


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCC
Q ss_conf             99885134555654101111101366000134443102466402116623677763101532100133200110011100
Q gi|254780707|r  182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK  261 (346)
Q Consensus       182 F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~  261 (346)
                      +.+.........                             ..+-..++...+.+.+... .++++++...+...     
T Consensus       207 ~~~~~~~~~~~~-----------------------------~~~~~~~~~~~~~~~v~~g-~gi~~lp~~~~~~~-----  251 (324)
T 1al3_A          207 LDTAFNRAGLTP-----------------------------RIVFTATDADVIKTYVRLG-LGVGVIASMAVDPV-----  251 (324)
T ss_dssp             HHHHHHHHTCCC-----------------------------EEEEEESSHHHHHHHHHHT-SCEEEEEGGGCCTT-----
T ss_pred             HHHHHHHCCCCC-----------------------------CEEEEECCHHHHHHHHHHC-CEEEECHHHHHHHH-----
T ss_conf             999999769987-----------------------------5699999999999999939-97997259897387-----


Q ss_pred             CCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             1344576789556027987503678999707885668899999999749
Q gi|254780707|r  262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS  310 (346)
Q Consensus       262 ~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls  310 (346)
                            ..+..-.+.-...+..|++|+..+++ ....+.+++|+.++-.
T Consensus       252 ------~~~~lv~~~~~~~~~~~~~~l~~r~~-~~~s~~~~~fi~~~~~  293 (324)
T 1al3_A          252 ------SDPDLVKLDANGIFSHSTTKIGFRRS-TFLRSYMYDFIQRFAP  293 (324)
T ss_dssp             ------TCTTSEEEECBTTBCCEEEEEEEETT-CCCCHHHHHHHHHHCT
T ss_pred             ------HCCCEEEEECCCCCCCCEEEEEEECC-CCCCHHHHHHHHHHHH
T ss_conf             ------48998999587888655799999696-8569999999999998


No 30 
>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} PDB: 1y4t_A
Probab=97.37  E-value=0.0051  Score=34.33  Aligned_cols=132  Identities=13%  Similarity=0.103  Sum_probs=67.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHH---------
Q ss_conf             67999803425899999999999877980799981576205789885210133530121332024767876---------
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDE---------   96 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~---------   96 (346)
                      +.|+|--+..- -..+.+.++|++++ |++| ++...+|+.-+.++.+...+...|+..++-.....+...         
T Consensus         2 ~ev~vy~~~~~-~~~~~l~~~Fek~t-GIkV-~~~~~~s~~~~~kl~ae~~~~~~DVv~~~~~~~~~~~~~~~~~~~~~~   78 (322)
T 3e13_X            2 SELNIYSARHY-NADFEIIKKFEEKT-GIKV-NHTQAKASELIKRLSLEGSNSPADIFITADISNLTEAKNLGLLSPVSS   78 (322)
T ss_dssp             CEEEEEECCCC-THHHHHHHHHHHHH-CCEE-EEEECCHHHHHHHHHHHGGGCCCCEEEESCHHHHHHHHHTTCEECCCC
T ss_pred             CEEEEEECCCC-CCHHHHHHHHHHHH-CCEE-EEEECCCHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHCCCCCCCCC
T ss_conf             75899879885-52699999999976-9889-999898199999999647899963999586999999986566564566


Q ss_pred             -----HHH--CCCCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEE
Q ss_conf             -----762--4878724666521541255416665456888888876410255555323673023231001112245035
Q gi|254780707|r   97 -----CKK--HGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI  169 (346)
Q Consensus        97 -----~~~--~~~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~  169 (346)
                           ...  ..........+.....++++|.+..                      ....+.+.|.++-.  |..+-.+
T Consensus        79 ~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~n~~~~----------------------~~~~~p~tw~dL~~--~~~~~~~  134 (322)
T 3e13_X           79 KYLEEFIPAHLRDKDKEWFAITKRARIIAYNKNTN----------------------IDISKMKNYEDLAK--AEFKGEI  134 (322)
T ss_dssp             HHHHHHSCGGGBCTTSSCEEEEEEEEEEEEETTSC----------------------CCCTTCCSGGGGGS--GGGTTCE
T ss_pred             CCHHHCCCHHCCCCCCCEEEEECCEEEEEECCCCC----------------------CCCCCCCCHHHHHH--HHHCCCC
T ss_conf             21333152010377752465522305787513333----------------------45789999999841--8753871


Q ss_pred             ECCCCCCCHHHHHHH
Q ss_conf             448854235789998
Q gi|254780707|r  170 YVPSGKHGTREVLEK  184 (346)
Q Consensus       170 ~~r~~~SGT~~~F~~  184 (346)
                      ..+...++....+..
T Consensus       135 ~~~~~~~~~~~~~~~  149 (322)
T 3e13_X          135 VMRSATAPYSKTLLA  149 (322)
T ss_dssp             ECCCTTSHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             347720136788999


No 31 
>2ql3_A Probable transcriptional regulator, LYSR family protein; APC7314, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Rhodococcus SP}
Probab=97.26  E-value=0.0068  Score=33.65  Aligned_cols=200  Identities=10%  Similarity=0.052  Sum_probs=108.7

Q ss_pred             CCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             76799980342589-99999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   25 RNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        25 ~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
                      +++|+|+-+.++.. ++..+...|++.||++++. +....+..-.+.+.+|.    +|+|....+....           
T Consensus         4 ~G~lrIg~~~~~~~~~l~~~l~~f~~~~P~v~l~-i~~~~~~~l~~~l~~g~----~Dl~i~~~~~~~~-----------   67 (209)
T 2ql3_A            4 AGPIAVGCYPALGPTILPSMLYAFTAEYPRASVE-FREDTQNRLRTQLEGGE----LDVAIVYDLDLSP-----------   67 (209)
T ss_dssp             CEEEEEEECGGGTTTTHHHHHHHHHHHCTTEEEE-EEECCHHHHHHHHHTTS----CSEEEEESSSCCT-----------
T ss_pred             CEEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCHHHHHHHHHCCC----CEEEEEECCCCCC-----------
T ss_conf             2899999688999999999999999988793899-99898289998760798----3588530465420-----------


Q ss_pred             CCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHH
Q ss_conf             72466652154125541666545688888887641025555532367302323100111224503544885423578999
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE  183 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~  183 (346)
                      .+...++..+...+++..+.+....                     .....|.++    .+.|+..+  +..+... .+.
T Consensus        68 ~~~~~~~~~~~~~~v~~~~~~la~~---------------------~~~i~~~~l----~~~~~i~~--~~~~~~~-~~~  119 (209)
T 2ql3_A           68 EWQTVPLMTREPMVVLGAEHPLAGV---------------------DGPVRLADL----AEHPMVLL--DAPPSTN-HAM  119 (209)
T ss_dssp             TEEEEEEEEECCEEEEETTCGGGGC---------------------CSCBCGGGG----TTSCEEEE--CCTTHHH-HHH
T ss_pred             CHHEECCCCCCCCCCCCCCCHHHHC---------------------CCCCCHHHH----HCCCEEEC--CCCCHHH-HHH
T ss_conf             0000001211222224689834517---------------------996679988----33985632--8995188-999


Q ss_pred             HHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCC---CCC
Q ss_conf             88513455565410111110136600013444310246640211662367776310153210013320011001---110
Q gi|254780707|r  184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA---DVL  260 (346)
Q Consensus       184 ~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~---~~~  260 (346)
                      +.....+..                             ....-..++...+.+.+. ...++++++...+....   ..+
T Consensus       120 ~~~~~~~~~-----------------------------~~~~~~~~~~~~~~~lv~-~g~Gi~~lp~~~~~~~~~~~~~~  169 (209)
T 2ql3_A          120 DVCREAGFA-----------------------------PRVAYRTANFETARAFVG-RGLGWTLLLQRPRVDVTYEGLPV  169 (209)
T ss_dssp             HHHHHHTCC-----------------------------CCEEEEESCHHHHHHHHH-HTSCBEEESCCCSSCBCTTSCBE
T ss_pred             HHHHHCCCC-----------------------------CEEEEEECCHHHHHHHHH-CCCEEEEEEHHHHHHHHHCCCCE
T ss_conf             999974999-----------------------------506998263777899998-19959990268887786479978


Q ss_pred             CCCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             01344576789556027987503678999707885668899999999749
Q gi|254780707|r  261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS  310 (346)
Q Consensus       261 ~~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls  310 (346)
                      .      +.|-     ...-|+.+.++++.++ +....+.++.|++|+..
T Consensus       170 ~------~~pl-----~~~~~~~~~i~l~~~~-~~~~s~~~~~Fi~~l~a  207 (209)
T 2ql3_A          170 V------VKPI-----AEPKPASVAVVVAWHQ-EATLSRVARAFIRFVTA  207 (209)
T ss_dssp             E------EEEB-----CSSCCCCEEEEEEEET-TCCCCHHHHHHHHHHTC
T ss_pred             E------EEEC-----CCCCCCEEEEEEEECC-CCCCCHHHHHHHHHHHC
T ss_conf             9------9977-----8888744799999919-89779999999999864


No 32 
>3cfz_A UPF0100 protein MJ1186; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.70A {Methanocaldococcus jannaschii}
Probab=97.26  E-value=0.0069  Score=33.62  Aligned_cols=59  Identities=17%  Similarity=0.168  Sum_probs=43.5

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECC
Q ss_conf             76799980342589999999999987798079998157620578988521013353012133
Q gi|254780707|r   25 RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS   86 (346)
Q Consensus        25 ~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ss   86 (346)
                      ..+|++-...+..+.++.++++|+++||+++|. ++..+++.-.+++.++.  ...|+-...
T Consensus         4 kvtl~v~~ags~~~~~~~~~~~Fe~~~P~I~V~-~~~~~~~~~~~kl~a~g--~~pDv~~~~   62 (292)
T 3cfz_A            4 KIVLKIFHAGSLSVPFEEYEKMFEKEHPNVDVE-REPAGSVACVRKIIDLG--KKADILASA   62 (292)
T ss_dssp             CEEEEEEEEGGGHHHHHHHHHHHHHHCTTEEEE-EEEECHHHHHHHHHTSC--CCCSEEEES
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHHHHCCCEEEE-EEECCHHHHHHHHHHCC--CCCCEEEEC
T ss_conf             649999977586899999999999888590899-99788599999999679--998799999


No 33 
>3jv9_A OXYR, transcriptional regulator, LYSR family; LYSR-type transcriptional regulator, LTTR, redox, structural genomics, OPPF; 2.39A {Neisseria meningitidis}
Probab=97.24  E-value=0.0039  Score=34.97  Aligned_cols=86  Identities=9%  Similarity=0.103  Sum_probs=65.9

Q ss_pred             CCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             76799980342589-99999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   25 RNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        25 ~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
                      +++|+|+-+.++.+ ++..+-..|++.||++++.+ ....+..=++.+.+|.    +|++....+....           
T Consensus         3 ~G~lrIG~~~s~~~~~lp~~l~~f~~~~P~v~l~i-~~~~~~~l~~~l~~g~----~D~~i~~~~~~~~-----------   66 (219)
T 3jv9_A            3 EGAFKLGLIFTVAPYLLPKLIVSLRRTAPKMPLML-EENYTHTLTESLKRGD----VDAIIVAEPFQEP-----------   66 (219)
T ss_dssp             CCCEEEEEETTTHHHHHHHHHHHHHHHSTTCCEEE-EEECHHHHHHHHHHTS----SSEEEEESSCCCT-----------
T ss_pred             CEEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEEE-EECCCHHHHHHHHCCC----EEEEEECCCCCCC-----------
T ss_conf             02899997778899999999999999888928999-9887377776561695----8887502687778-----------


Q ss_pred             CCEEEEEECCCCEEEECCCCCCC
Q ss_conf             72466652154125541666545
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRDMVSV  126 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~~~~~  126 (346)
                      .+...++..+.++++..++.+..
T Consensus        67 ~~~~~~l~~e~~~lv~~~~~~l~   89 (219)
T 3jv9_A           67 GIVTEPLYDEPFFVIVPKGHSFE   89 (219)
T ss_dssp             TEEEEEEEEEEEEEEEETTCGGG
T ss_pred             CEEEEEECCCCEEEEEECCCCCC
T ss_conf             74898503310899975664212


No 34 
>3k01_A Acarbose/maltose binding protein GACH; ABC transporter, acarbose-binding protein, transport protein; 1.35A {Streptomyces glaucescens} PDB: 3jzj_A* 3k00_A* 3k02_A*
Probab=97.24  E-value=0.0056  Score=34.11  Aligned_cols=95  Identities=11%  Similarity=0.124  Sum_probs=51.9

Q ss_pred             CEEEEEEC--CHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCC--CCCCCEEECCCC-------------
Q ss_conf             67999803--4258999999999998779807999815762057898852101--335301213320-------------
Q gi|254780707|r   26 NRIRIAGS--STLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIG--DDTIDIVNSSRK-------------   88 (346)
Q Consensus        26 ~~I~i~GS--st~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~--~~~~dig~ssr~-------------   88 (346)
                      .+|++-++  ......++.++++|+++||+++|. ++..+.+....++..-..  .+..||...+..             
T Consensus        28 gtit~w~~~~~~~~~~~~~~i~~Fek~~p~i~V~-~~~~~~~~~~~~l~~~~~ag~~~pDi~~~~~~~~~~~~~~g~l~~  106 (412)
T 3k01_A           28 GTVTFWDTSNEAEKATYQALAEGFEKEHPKVDVK-YVNVPFGEANAKFKNAAGGNSGAPDVMRTEVAWVADFASIGYLAP  106 (412)
T ss_dssp             EEEEEEECCCTTTHHHHHHHHHTHHHHCTTEEEE-EEECCHHHHHHHHHHHHHTTSSCCSEEEEEHHHHHHHHHTTCBCC
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEE-EEECCCHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHHHCCCCCC
T ss_conf             0899995898125999999999999888392899-997784789999999997399998699988288999997799354


Q ss_pred             CCHH------------HHHHHHHCCCCCCEEEEEECCCCEEEECCCC
Q ss_conf             2476------------7876762487872466652154125541666
Q gi|254780707|r   89 ITQN------------ELDECKKHGVSDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus        89 l~~~------------E~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~  123 (346)
                      |++.            -++.+..  ...+-.+|+..+..++.+|++.
T Consensus       107 L~~~~~~~~~~~~~~~~~~~~~~--dG~~y~iP~~~~~~~~~yn~d~  151 (412)
T 3k01_A          107 LDGTPALDDGSDHLPQAAASTRY--EGKTYAVPQVIDTLALFYNKEL  151 (412)
T ss_dssp             CTTSGGGCSCTTBCHHHHHTTEE--TTEECCEEEEEEECEEEEEHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHCEE--CCEEEEEEEEEEEEEEEEECHH
T ss_conf             75101133567779999976389--9989999875027899971513


No 35 
>1pot_A POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} SCOP: c.94.1.1 PDB: 1poy_1*
Probab=97.22  E-value=0.0019  Score=36.71  Aligned_cols=81  Identities=14%  Similarity=0.021  Sum_probs=44.6

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCH-HHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHH--------------------
Q ss_conf             9999999987798079998157620-5789885210133530121332024767876762--------------------
Q gi|254780707|r   41 KIIAENFSEYFPEFKTPFVESGGSS-VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK--------------------   99 (346)
Q Consensus        41 ~~~a~~y~~~~~~~~~~~~~~~GSg-~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~--------------------   99 (346)
                      +.+.++|+++| |++|. +...+++ .-..++.++. ....|+...+...-....+....                    
T Consensus        17 ~~ii~~Fek~~-gi~V~-~~~~~~~~~~~~~~~a~~-~~~~Dvv~~~~~~~~~~~~~g~~~~ld~~~~~~~~~~~~~~~~   93 (325)
T 1pot_A           17 PGLLEQFTKET-GIKVI-YSTYESNETMYAKLKTYK-DGAYDLVVPSTYYVDKMRKEGMIQKIDKSKLTNFSNLDPDMLN   93 (325)
T ss_dssp             TTHHHHHHHHH-CEEEE-EEEESCHHHHHHHHTTCS-SSCSSBBCCBGGGHHHHHHHTCBCCCCTTSCTTGGGBCGGGSC
T ss_pred             HHHHHHHHHHH-CCEEE-EEECCCHHHHHHHHHHCC-CCCCEEEEECHHHHHHHHHCCCCCCCCHHCCCCCCCCCHHHHC
T ss_conf             89999999996-99899-996899999999998069-9998499948689999997695213550004450002877750


Q ss_pred             C--CCCCCEEEEEECCCCEEEECCCCC
Q ss_conf             4--878724666521541255416665
Q gi|254780707|r  100 H--GVSDIQEVTIGHDGILLVSDRDMV  124 (346)
Q Consensus       100 ~--~~~~~~~~~v~~d~i~i~~n~~~~  124 (346)
                      .  .......+|+..+..+++||++..
T Consensus        94 ~~~~~g~~~~vP~~~~~~~l~Yn~d~~  120 (325)
T 1pot_A           94 KPFDPNNDYSIPYIWGATAIGVNGDAV  120 (325)
T ss_dssp             CTTSTTCSSCEEEEEEEEEEEEETTTS
T ss_pred             CCCCCCCCEEEEEEEEECCEEECHHHC
T ss_conf             445899836999975412123216442


No 36 
>1y9u_A Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} SCOP: c.94.1.1 PDB: 2ows_A 2owt_A
Probab=97.22  E-value=0.0072  Score=33.52  Aligned_cols=62  Identities=8%  Similarity=-0.024  Sum_probs=36.0

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCC
Q ss_conf             376799980342589999999999987798079998157620578988521013353012133202
Q gi|254780707|r   24 ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI   89 (346)
Q Consensus        24 a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l   89 (346)
                      +++.|+|-.+. ..-+++.+.+.|++++ |++|..+ .++++ =+..+.+...+...|+-.++...
T Consensus         4 ~a~el~vYs~~-~~~~~~~li~~Fek~t-GIkV~~~-~~~~~-~~~kl~ae~~~~~~DV~~~~~~~   65 (323)
T 1y9u_A            4 MSDEVSLYTTR-EPKLIQPLLDAFAKDS-GIKVNTV-FVKDG-LLERVRAEGDKSPADVLMTVDIG   65 (323)
T ss_dssp             --CEEEEEESS-CGGGTHHHHHHHHHHH-CCEEEEE-ECSSC-HHHHHHHHGGGCCCCEEEEESHH
T ss_pred             CCCEEEEEECC-CHHHHHHHHHHHHHHH-CCEEEEE-ECCHH-HHHHHHHCCCCCCCCEEEECCHH
T ss_conf             57836999798-8768999999999866-9879999-79889-99999974589998789978678


No 37 
>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis}
Probab=97.21  E-value=0.0078  Score=33.31  Aligned_cols=86  Identities=16%  Similarity=0.121  Sum_probs=66.0

Q ss_pred             CCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             76799980342589-99999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   25 RNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        25 ~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
                      .++|+|+-+.++.+ ++..+...|.+++|++++. +....+..-++.+.+|.    +|++....+..+.+          
T Consensus        10 ~G~l~ig~~~s~~~~~lp~~l~~f~~~~P~v~l~-l~~~~~~~~~~~L~~g~----iD~~i~~~~~~~~~----------   74 (232)
T 3ho7_A           10 TGRLNIAVLPTIAPYLLPRVFPIWKKELAGLEIH-VSEMQTSRCLASLLSGE----IDMAIIASKAETEG----------   74 (232)
T ss_dssp             CEEEEEEECTTTHHHHHHHHHHHHHHHSTTEEEE-EEECCHHHHHHHHHHTS----CSEEEESSCCCCTT----------
T ss_pred             EEEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCCHHHHHHHHCCC----EEEEEEECCCCCCC----------
T ss_conf             2799999437789999999999999988896899-99898289999997798----42898634765543----------


Q ss_pred             CCEEEEEECCCCEEEECCCCCCC
Q ss_conf             72466652154125541666545
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRDMVSV  126 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~~~~~  126 (346)
                       +...++..+.+++++..+.+..
T Consensus        75 -l~~~~l~~~~~~lv~~~~h~l~   96 (232)
T 3ho7_A           75 -LEDDLLYYEEFLGYVSRCEPLF   96 (232)
T ss_dssp             -EEEEEEEEEEEEEEECTTSGGG
T ss_pred             -CEEEEECCHHHHHHHCCCCCCC
T ss_conf             -0034200010222111345433


No 38 
>2v84_A Spermidine/putrescine ABC transporter, periplasmic binding protein; polyamine binding, syphilis, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum}
Probab=97.08  E-value=0.011  Score=32.58  Aligned_cols=100  Identities=10%  Similarity=0.096  Sum_probs=51.2

Q ss_pred             HCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHH-HHHHHHHCCCCCCCEEECCC---------
Q ss_conf             31420137679998034258999999999998779807999815762057-89885210133530121332---------
Q gi|254780707|r   18 CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVG-LKEFCRGIGDDTIDIVNSSR---------   87 (346)
Q Consensus        18 ~~~~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~G-i~~~~~G~~~~~~dig~ssr---------   87 (346)
                      +...+..++++++---.--  +-+.+.++|+++| +++|. ++..+|..- +.++..|.  ...|+...+.         
T Consensus        17 ~~~~~~~~~~L~v~~W~~y--~~~~~i~~Fe~~~-gIkV~-~~~~~~~~~~~~kl~ag~--~~~Dvv~~~~~~~~~~~~~   90 (343)
T 2v84_A           17 RGRLQTRQDVLYLYNWTYY--TPTSLIKKFEQQY-NVQVV-YDDYASNEDMFAKLSIGA--SGYDLVVPSGDFVSIMKRK   90 (343)
T ss_dssp             --------CEEEEEEETTT--SCHHHHHHHHHHH-TCEEE-EEEESCHHHHHHHHSSSC--CSCSEECCBHHHHHHHHHT
T ss_pred             CCCCCCCCCEEEEEECCCC--CCHHHHHHHHHHH-CCEEE-EEECCCHHHHHHHHHCCC--CCCCEEEECHHHHHHHHHC
T ss_conf             7653355898999947774--7989999999997-98899-995899899999998289--9999899798999999977


Q ss_pred             ----CCCHHHHH-------HHHH---CCCCCCEEEEEECCCCEEEECCCC
Q ss_conf             ----02476787-------6762---487872466652154125541666
Q gi|254780707|r   88 ----KITQNELD-------ECKK---HGVSDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus        88 ----~l~~~E~~-------~~~~---~~~~~~~~~~v~~d~i~i~~n~~~  123 (346)
                          ++......       ....   ........+|...+..+++||++.
T Consensus        91 gll~~ld~~~~~~~~~i~~~~~~~~~~~~g~~y~vP~~~~~~~l~YNkd~  140 (343)
T 2v84_A           91 HLLEKIDLSKIPNVQFIKESVRARIAYDPKMEYSVPYYLGAAGIAVNKKA  140 (343)
T ss_dssp             TCEECCCGGGCGGGGGBCHHHHHHCTTSTTCSSCEEEEEECCEEEEETTT
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEEEEEEEEHHH
T ss_conf             99654784554105440366531331079984787888532589986311


No 39 
>2h98_A HTH-type transcriptional regulator CATM; BENM, LTTR; 1.80A {Acinetobacter SP} PDB: 2h9q_A* 2f7b_A 2f7c_A* 3glb_A*
Probab=96.82  E-value=0.018  Score=31.31  Aligned_cols=203  Identities=15%  Similarity=0.134  Sum_probs=116.1

Q ss_pred             CCCCEEEEEECCH-HHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCC
Q ss_conf             1376799980342-589999999999987798079998157620578988521013353012133202476787676248
Q gi|254780707|r   23 FARNRIRIAGSST-LFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHG  101 (346)
Q Consensus        23 ~a~~~I~i~GSst-~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~  101 (346)
                      ....+|+|+.+.+ ...++..+...|.+.+|++.+. +....+..-++.+.+|.    +|||....+....         
T Consensus        87 ~~~~~l~i~~~~~~~~~~l~~~l~~~~~~~P~v~i~-i~~~~~~~~~~~l~~~~----~Di~i~~~~~~~~---------  152 (313)
T 2h98_A           87 TVSQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIE-LIECGTKDQINALKQGK----IDLGFGRLKITDP---------  152 (313)
T ss_dssp             --CCEEEEEECGGGGGTTHHHHHHHHHHHCTTSEEE-EEECCHHHHHHHHHHTS----CSEEEESSCCCCT---------
T ss_pred             CCCCEEEEEECHHHHHHHHHHHHHHHHHHCCCEEEE-EECCCCHHHHHHHHCCC----CCCEEEECCCCCC---------
T ss_conf             566239998610567889999999998629933432-11278278999974215----5513530356673---------


Q ss_pred             CCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHH
Q ss_conf             78724666521541255416665456888888876410255555323673023231001112245035448854235789
Q gi|254780707|r  102 VSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV  181 (346)
Q Consensus       102 ~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~  181 (346)
                        .+...++..+.+++++..+.+.....                    .+...+.+    +.+.+...+.+...++....
T Consensus       153 --~~~~~~l~~~~~~~~~~~~~~l~~~~--------------------~~~i~~~~----l~~~~~i~~~~~~~~~~~~~  206 (313)
T 2h98_A          153 --AIRRIMLHKEQLKLAIHKHHHLNQFA--------------------ATGVHLSQ----IIDEPMLLYPVSQKPNFATF  206 (313)
T ss_dssp             --TEEEEEEEEEEEEEEEETTSGGGGGT--------------------TSCBCGGG----GTTSCEEECCCSSSSSHHHH
T ss_pred             --HHHHHHHHHHHHEEECCCCCHHHHCC--------------------CCCCCHHH----HHCCCEEEEECCCCCCCHHH
T ss_conf             --13455433322034204776244335--------------------78758899----80898798414567641025


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCC
Q ss_conf             99885134555654101111101366000134443102466402116623677763101532100133200110011100
Q gi|254780707|r  182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK  261 (346)
Q Consensus       182 F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~  261 (346)
                      +.+.....+..                             ...+...++...+.+.+.. ..+++.++..........+.
T Consensus       207 ~~~~~~~~~~~-----------------------------~~~~~~~~~~~~~~~~v~~-g~gi~~lP~~~~~~~~~~l~  256 (313)
T 2h98_A          207 IQSLFTELGLV-----------------------------PSKLTEIREIQLALGLVAA-GEGVCIVPASAMDIGVKNLL  256 (313)
T ss_dssp             HHHHHHHTTCC-----------------------------CSCEEECSCHHHHHHHHHT-TSCBEEEEGGGGGSCCTTEE
T ss_pred             HHHHHHHCCCC-----------------------------CCEEECCCCHHHHHHHHHH-CCEEEEEHHHHHHHHCCCEE
T ss_conf             66778863898-----------------------------7400134989999999994-99699713889844309989


Q ss_pred             CCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             134457678955602798750367899970788566889999999974
Q gi|254780707|r  262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSV  309 (346)
Q Consensus       262 ~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~l  309 (346)
                      .+++.          +  -++.++++++..+..  ..+.++.|++++-
T Consensus       257 ~~pl~----------~--~~~~~~i~l~~r~~~--~~~~~~~f~~~~~  290 (313)
T 2h98_A          257 YIPIL----------D--DDAYSPISLAVRNMD--HSNYIPKILACVQ  290 (313)
T ss_dssp             EEEBC----------S--TTCEEEEEEEEETTC--CCTHHHHHHHHHH
T ss_pred             EEECC----------C--CCCCEEEEEEEECCC--CCHHHHHHHHHHH
T ss_conf             99878----------9--986007999998998--8979999999999


No 40 
>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- plasmid, transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A
Probab=96.70  E-value=0.022  Score=30.77  Aligned_cols=200  Identities=13%  Similarity=0.220  Sum_probs=112.6

Q ss_pred             CCCEEEEEECCHHH-HHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             37679998034258-99999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   24 ARNRIRIAGSSTLF-PYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        24 a~~~I~i~GSst~~-P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
                      ...+|+|+.+.+.. .+...+..+|.+.+|++.+. +....+..-+..+.+|.    .|++....+..+.+         
T Consensus        90 ~~~~l~I~~~~~~~~~~l~~~i~~~~~~~p~i~i~-i~~~~~~~~~~~l~~g~----~Di~i~~~~~~~~~---------  155 (305)
T 3fxq_A           90 WEGHITFAASPAIALAALPLALASFAREFPDVTVN-VRDGMYPAVSPQLRDGT----LDFALTAAHKHDID---------  155 (305)
T ss_dssp             HHTEEEEEECHHHHHTHHHHHHHHHHHHCTTCEEE-EEECCTTTTHHHHHHTS----SSEEEEECCGGGSC---------
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHHHHCCCCEEE-EEECCCHHHHHHHHCCC----EEEEEEECCCCCCC---------
T ss_conf             66259996246302767899999999978997676-57448177777875597----34899840554356---------


Q ss_pred             CCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHH
Q ss_conf             87246665215412554166654568888888764102555553236730232310011122450354488542357899
Q gi|254780707|r  103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL  182 (346)
Q Consensus       103 ~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F  182 (346)
                      ..+...++..+.++++++.+.|..+.                        ..+.++    ...|+.  .+...++++..+
T Consensus       156 ~~l~~~~l~~~~~~~~~~~~hpl~~~------------------------~~l~~l----~~~~~i--~~~~~~~~~~~~  205 (305)
T 3fxq_A          156 TDLEAQPLYVSDVVIVGQRQHPMANA------------------------TRLAEL----QECRWA--FSSAPRGPGAII  205 (305)
T ss_dssp             TTEEEEEEEECCEEEEEETTCTTTTC------------------------CSGGGG----TTSEEE--EECCTTSTTHHH
T ss_pred             CCCEEEECCCCCEEEEECCCCCCCCC------------------------CCHHHH----HCCEEE--EECCCCCCCHHH
T ss_conf             88437871444179998688845689------------------------895675----302145--523776531257


Q ss_pred             HHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEEC-CCCHHHHHHHHCCCCCCCCCCCCCHHHHC--CCC
Q ss_conf             988513455565410111110136600013444310246640211-66236777631015321001332001100--111
Q gi|254780707|r  183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEV-DGDYTETLARIEVNKDVFGFVGLSFYKNN--ADV  259 (346)
Q Consensus       183 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~-~~~~~~~~~~v~~~~~~igy~~~~~~~~~--~~~  259 (346)
                      .+.....+...                             ..+.. .++...+...+. ....++.++...+...  ...
T Consensus       206 ~~~~~~~~~~~-----------------------------~~i~~~~~~~~~~~~~v~-~g~gi~~lp~~~~~~~~~~~~  255 (305)
T 3fxq_A          206 RNAFARYGLPE-----------------------------PKLGLVCESFLALPGVVA-HSDLLTTMPRTLYERNAFKDQ  255 (305)
T ss_dssp             HHHHHHTTCCC-----------------------------CEEEEEECCTTTHHHHHH-TSSCEEEEEHHHHHSSTTGGG
T ss_pred             HHHHHHCCCCC-----------------------------CCCCCCCCCHHHHHHHHH-CCCEEEECCHHHHHHHHHCCC
T ss_conf             78999719863-----------------------------223333367999999997-499899811999985513799


Q ss_pred             CCCCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             001344576789556027987503678999707885668899999999749
Q gi|254780707|r  260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS  310 (346)
Q Consensus       260 ~~~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls  310 (346)
                      +..++++           + -+..+.+|++.++. ....+.++.|++++-.
T Consensus       256 l~~~~l~-----------~-~~~~~~~~l~~~~~-~~~~~~~~~fi~~i~~  293 (305)
T 3fxq_A          256 LCSIPLQ-----------D-ALPNPTIYVLRRHD-LPVTPAAAGLIRWIQH  293 (305)
T ss_dssp             EEECCCS-----------S-CCCCCEEEEEEETT-SCCCHHHHHHHHHHHH
T ss_pred             EEEEECC-----------C-CCCCCEEEEEEECC-CCCCHHHHHHHHHHHH
T ss_conf             8999688-----------8-88776899999896-9889999999999999


No 41 
>1i6a_A OXYR, hydrogen peroxide-inducible genes activator; OXYR regulatory domain, oxidized form, transcription; 2.30A {Escherichia coli} SCOP: c.94.1.1 PDB: 1i69_A
Probab=96.51  E-value=0.03  Score=30.03  Aligned_cols=86  Identities=17%  Similarity=0.148  Sum_probs=62.5

Q ss_pred             CCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             76799980342589-99999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   25 RNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        25 ~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
                      .++|+|+-+.++.. ++..+...|.+.||++++. +....|..-+..+.+|.    +|++....+..+.+          
T Consensus         4 ~G~lrIg~~~~~~~~~lp~~l~~f~~~~P~v~i~-i~~~~~~~l~~~l~~~~----~d~~~~~~~~~~~~----------   68 (219)
T 1i6a_A            4 SGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMY-LHEAQTHQLLAQLDSGK----LDAVILALVKESEA----------   68 (219)
T ss_dssp             CEEEEEEECTTTHHHHHHHHHHHHHHHCTTEEEE-EEECCHHHHHHHHHHTS----CSEEEEECCGGGTT----------
T ss_pred             EEEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCCHHHHHHHHCCC----CHHHHCCCCCCCCC----------
T ss_conf             1899998377799999999999999988896899-99888488888875364----01010235532345----------


Q ss_pred             CCEEEEEECCCCEEEECCCCCCC
Q ss_conf             72466652154125541666545
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRDMVSV  126 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~~~~~  126 (346)
                       +...++..+.+++++.++.+..
T Consensus        69 -~~~~~l~~~~~~~v~~~~hpla   90 (219)
T 1i6a_A           69 -FIEVPLFDEPMLLAIYEDHPWA   90 (219)
T ss_dssp             -SEEEEEEEEEEEEEEETTSGGG
T ss_pred             -CCCCCCCCCCEEEEEECCCHHH
T ss_conf             -3234344553699992597111


No 42 
>1eu8_A Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} SCOP: c.94.1.1
Probab=96.49  E-value=0.031  Score=29.98  Aligned_cols=48  Identities=13%  Similarity=0.057  Sum_probs=31.8

Q ss_pred             CCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHH
Q ss_conf             503678999707885668899999999749874052202775596348999
Q gi|254780707|r  281 PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNE  331 (346)
Q Consensus       281 Pl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~  331 (346)
                      .......+.+.... ...++.++|++|++|.+.|.  .+....|++|...+
T Consensus       289 ~~~~~~~~~i~~~s-~~~e~A~~fl~~l~s~e~~~--~~~~~~g~~P~~~~  336 (409)
T 1eu8_A          289 ATLGGWHIGISKYS-DNKALAWEFVKFVESYSVQK--GFAMNLGWNPGRVD  336 (409)
T ss_dssp             CBEEEEEEEEBTTC-SCHHHHHHHHHHHTSHHHHH--HHHHHTCCCBSBTT
T ss_pred             CEECCCEEEEECCC-CCHHHHHHHHHHHCCHHHHH--HHHHHCCCCCCCHH
T ss_conf             00056102445678-77999999999966999999--99985499866276


No 43 
>1q35_A Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} SCOP: c.94.1.1 PDB: 1si0_A 1si1_A
Probab=96.18  E-value=0.043  Score=29.22  Aligned_cols=94  Identities=10%  Similarity=0.027  Sum_probs=46.6

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHH-------
Q ss_conf             6799980342589999999999987798079998157620578988521013353012133202476787676-------
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECK-------   98 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~-------   98 (346)
                      +.|+|--+. ..-+++.+.+.|++++ |++|..+ ..+++ -+..+.+...+...|+..++-..-...+....       
T Consensus         2 ~el~vYt~~-~~~~~~~li~~Fek~t-GIkV~~~-~~~~~-~~~kl~ae~~~~~~Dvv~~~~~~~~~~~~~~~~~~~~~~   77 (320)
T 1q35_A            2 NEVNVYSYR-QPYLIEPMLKNFEKDT-GIKVNII-FADKG-LVDRVKQEGELSPADVLLTVDISRVMEIVNADLAQKIDS   77 (320)
T ss_dssp             CEEEEEESS-CGGGTHHHHHHHHHHH-CCEEEEE-ECC-C-CHHHHHHHGGGCCCCEEEESCHHHHHHHHHTTCBCCCCC
T ss_pred             CEEEEEECC-CHHHHHHHHHHHHHHH-CCEEEEE-ECCHH-HHHHHHHCCCCCCCCEEEECCHHHHHHHHHCCCCCCCCH
T ss_conf             758998798-8768999999998866-9789999-69989-999999647999988899797899999885275433421


Q ss_pred             ---------HCCCCCCEEEEEECCCCEEEECCCC
Q ss_conf             ---------2487872466652154125541666
Q gi|254780707|r   99 ---------KHGVSDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus        99 ---------~~~~~~~~~~~v~~d~i~i~~n~~~  123 (346)
                               .........++......++.+|.+-
T Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yn~~~  111 (320)
T 1q35_A           78 KVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDR  111 (320)
T ss_dssp             HHHHHHSCGGGBCTTSSCEEEEEEEEEEEEETTT
T ss_pred             HHHHHHCHHHHCCCCCEEEEEEEEEEEEEECCCC
T ss_conf             0155534044326763376267777788850321


No 44 
>3i3v_A Probable secreted solute-binding lipoprotein; transporter, PSI-II, structural genomics, protein structure initiative; 2.30A {Streptomyces coelicolor}
Probab=96.04  E-value=0.056  Score=28.57  Aligned_cols=39  Identities=15%  Similarity=0.158  Sum_probs=28.1

Q ss_pred             CEEEEE----ECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCH
Q ss_conf             679998----0342589999999999987798079998157620
Q gi|254780707|r   26 NRIRIA----GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS   65 (346)
Q Consensus        26 ~~I~i~----GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg   65 (346)
                      .+|++.    +++.-.+.+.+..++|+++||+++|. +...++.
T Consensus         8 ~tl~~~~~~~~~~~~~~~~~~~v~~F~~~~p~i~V~-~~~~~~~   50 (405)
T 3i3v_A            8 DTLVVHTQLGTTAPGSPTYLAAVDRFREENPGVKIK-NLVNGDD   50 (405)
T ss_dssp             CSEEEEESCSSSSTTHHHHHHHHHHHHHHSTTCCEE-EEECSTT
T ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEE-EECCCCC
T ss_conf             869999707888866799999999999888294999-9727861


No 45 
>1urs_A Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius} SCOP: c.94.1.1 PDB: 1urg_A* 1urd_A*
Probab=96.03  E-value=0.056  Score=28.56  Aligned_cols=51  Identities=12%  Similarity=0.053  Sum_probs=34.8

Q ss_pred             CCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHHH
Q ss_conf             750367899970788566889999999974987405220277559634899999
Q gi|254780707|r  280 YPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER  333 (346)
Q Consensus       280 YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~  333 (346)
                      .++.....+.+++.. ....+.++|++|+++++.|.  .+....|++|.-.+..
T Consensus       282 ~~~~~~~~~~i~~~s-~~~~~A~~fl~~l~s~e~q~--~~~~~~~~~P~~~~~~  332 (402)
T 1urs_A          282 TPFLGVITAFVNKES-KTQAADWSLVQALTSAQAQQ--MYFRDSQQIPALLSVQ  332 (402)
T ss_dssp             CCEEEEEEEEEBTTC-SCHHHHHHHHHHHTSHHHHH--HHHHHHCCEESSHHHH
T ss_pred             CCCCCCCCCCCCCCC-CCHHHHHHHHHHHCCHHHHH--HHHHHHCCCCCCHHHH
T ss_conf             110466554355568-78999999999976999999--9999819888737777


No 46 
>2heu_A Sugar ABC transporter, sugar-binding protein; periplasmic binding protein, transport protein; 1.04A {Streptococcus pneumoniae} PDB: 2hq0_A 2i58_A* 2hfb_A
Probab=95.82  E-value=0.07  Score=28.03  Aligned_cols=42  Identities=12%  Similarity=0.096  Sum_probs=27.6

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCH
Q ss_conf             899970788566889999999974987405220277559634899
Q gi|254780707|r  286 LLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISN  330 (346)
Q Consensus       286 ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~  330 (346)
                      .++-+.+.. ....+..+|++|++|++.|..  +....|+.|..+
T Consensus       294 ~~~~I~~~s-~~~eaA~~fl~~l~s~e~q~~--~~~~~g~~p~~~  335 (401)
T 2heu_A          294 LAWSISATT-KHPKEANAFVEYMTRPEVMQK--YYDVDGSPTAIE  335 (401)
T ss_dssp             SEEEEBTTC-SCHHHHHHHHHHHTSHHHHHH--HHHHHCCCBCBT
T ss_pred             EEEEEECCC-CCHHHHHHHHHHHCCHHHHHH--HHHHHCCCCCCH
T ss_conf             488886899-789999999999779999999--999619878863


No 47 
>1elj_A Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus} SCOP: c.94.1.1
Probab=95.69  E-value=0.079  Score=27.73  Aligned_cols=107  Identities=17%  Similarity=0.250  Sum_probs=56.2

Q ss_pred             CEEEE--EECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCH-HHHHH-HHHHCCCCCCCEEECCCC-------------
Q ss_conf             67999--80342589999999999987798079998157620-57898-852101335301213320-------------
Q gi|254780707|r   26 NRIRI--AGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS-VGLKE-FCRGIGDDTIDIVNSSRK-------------   88 (346)
Q Consensus        26 ~~I~i--~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg-~Gi~~-~~~G~~~~~~dig~ssr~-------------   88 (346)
                      ..|++  ..+..-...++.+.++|+++||+++|. ++..++- .-++. +.+|.   ..|+...+..             
T Consensus         6 g~i~~W~~~~~~~~~~~~~~~~~F~~~~p~I~v~-~~~~~~~~~~l~~~~~sg~---~pDv~~~~~~~~~~~~~~g~l~~   81 (381)
T 1elj_A            6 GKVVIWHAMQPNELEVFQSLAEEYMALCPEVEIV-FEQKPNLEDALKAAIPTGQ---GPDLFIWAHDWIGKFAEAGLLEP   81 (381)
T ss_dssp             EEEEEEECCCHHHHHHHHHHHHHHHHHCTTEEEE-EEECTTHHHHHHHHTTTTC---SCSEEEEEGGGHHHHHHTTCBCC
T ss_pred             EEEEEEECCCHHHHHHHHHHHHHHHHHCCCEEEE-EEECCCHHHHHHHHHHCCC---CCEEEEECCHHHHHHHHCCCCCC
T ss_conf             1899995898038999999999999878198999-9868999999999997699---98199999477999998799655


Q ss_pred             CCH---HHH-HH----HHH--CCCCCCEEEEEECCCCEEEECCCCCCC-CCCHHHHHHH
Q ss_conf             247---678-76----762--487872466652154125541666545-6888888876
Q gi|254780707|r   89 ITQ---NEL-DE----CKK--HGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKA  136 (346)
Q Consensus        89 l~~---~E~-~~----~~~--~~~~~~~~~~v~~d~i~i~~n~~~~~~-~lt~~~l~~~  136 (346)
                      +++   .+. +.    ...  .....+-.+|...+..++.+|++.... -.|-+++...
T Consensus        82 l~~~~~~~~~~~~~~~~~~~~~~dG~~y~~P~~~~~~~l~ynkdl~~~~p~T~~e~~~~  140 (381)
T 1elj_A           82 IDEYVTEDLLNEFAPMAQDAMQYKGHYYALPFAAETVAIIYNKEMVSEPPKTFDEMKAI  140 (381)
T ss_dssp             CTTTCCHHHHTTBCHHHHHHTEETTEECEEEEEEEECEEEEETTTCSSCCSSHHHHHHH
T ss_pred             CCHHHCHHHHHHCCHHHHHHEEECCEEEEECCCCCCCHHHCCCHHHHCHHHHHHHHHHH
T ss_conf             85211345676514998964189999984043334401220520110113456789999


No 48 
>1a99_A POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} SCOP: c.94.1.1
Probab=95.28  E-value=0.044  Score=29.15  Aligned_cols=42  Identities=5%  Similarity=0.046  Sum_probs=28.6

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHH
Q ss_conf             999707885668899999999749874052202775596348999
Q gi|254780707|r  287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNE  331 (346)
Q Consensus       287 y~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~  331 (346)
                      .+.+.+.. ...++.++|++|++|.+.|..  +....||.|....
T Consensus       253 ~~~I~k~s-~~~e~A~~fi~~l~s~e~q~~--~~~~~g~~p~~~~  294 (344)
T 1a99_A          253 VFAMPADA-KNKDEAYQFLNYLLRPDVVAH--ISDHVFYANANKA  294 (344)
T ss_dssp             EEECBTTC-SCHHHHHHHHHHHHSHHHHHH--HHHHHCCEESBTT
T ss_pred             CCCEECCC-CCHHHHHHHHHHHCCHHHHHH--HHHHHCCCCCCHH
T ss_conf             11001899-987999999999659999999--9997488882677


No 49 
>3oxn_A Putative transcriptional regulator, LYSR family; structural genomics, PSI-2, protein structure initiative; 2.70A {Vibrio parahaemolyticus}
Probab=94.85  E-value=0.15  Score=26.20  Aligned_cols=90  Identities=8%  Similarity=-0.006  Sum_probs=67.3

Q ss_pred             CCCCCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHH
Q ss_conf             201376799980342589-9999999999877980799981576205789885210133530121332024767876762
Q gi|254780707|r   21 GTFARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK   99 (346)
Q Consensus        21 ~~~a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~   99 (346)
                      ++..+.+++|+.+.++.. ++..+...|.+.+|++.+. +....+..-.+.+.+|.    +|++....+..+.       
T Consensus        14 P~~~~~~~rI~~~~~~~~~~lp~ll~~l~~~~P~v~i~-l~~~~~~~~~~~L~~g~----iDl~I~~~~~~~~-------   81 (241)
T 3oxn_A           14 PQQCDQTFTIATTDYAMQTILPFALPRIYQEAPNVSFN-FLPLQHDRLSDQLTYEG----ADLAICRPTGPVE-------   81 (241)
T ss_dssp             CCSCCCEEEEEECSHHHHHTHHHHHHHHHHHCTTCEEE-EEECCGGGHHHHHHTSC----CSEEEECCSSCCT-------
T ss_pred             CCCCCCEEEEEECHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCHHHHHHHHHCCC----CCEEEECCCCCCC-------
T ss_conf             20068689999737999999999999999988692899-99798799999997598----5422202678741-------


Q ss_pred             CCCCCCEEEEEECCCCEEEECCCCCCC
Q ss_conf             487872466652154125541666545
Q gi|254780707|r  100 HGVSDIQEVTIGHDGILLVSDRDMVSV  126 (346)
Q Consensus       100 ~~~~~~~~~~v~~d~i~i~~n~~~~~~  126 (346)
                          .+...++..+..++++..+.|..
T Consensus        82 ----~l~~~~l~~~~~v~v~~~~HPl~  104 (241)
T 3oxn_A           82 ----PLRSEILGRVGVLCLLSKQHPLA  104 (241)
T ss_dssp             ----TEEEEEEECCCEEEEEETTSGGG
T ss_pred             ----CCCCCCCCCCCCEEECCCCCHHH
T ss_conf             ----01135432236402237665032


No 50 
>2zyo_A Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A*
Probab=94.38  E-value=0.19  Score=25.56  Aligned_cols=53  Identities=21%  Similarity=0.153  Sum_probs=35.5

Q ss_pred             CCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHHHH
Q ss_conf             87503678999707885668899999999749874052202775596348999999
Q gi|254780707|r  279 LYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERK  334 (346)
Q Consensus       279 ~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~~  334 (346)
                      .+++...-.+.+.+.. ...++.++|++|+++++.|.  .+....|++|...+...
T Consensus       275 ~~~~~~~~~~~i~~~~-~~~~~A~~fl~~~~s~e~~~--~~~~~~g~~P~~~~~~~  327 (397)
T 2zyo_A          275 AQTFIGVKGWYLSAYS-KYPKYATELMQFLTSKEALA--SRFKETGEIPPQKELLN  327 (397)
T ss_dssp             CCCEEEEEEEEEETTC-SCHHHHHHHHHHTTSHHHHH--HHHHHHCCBCCBHHHHT
T ss_pred             CCCCCCCCEEEEECCC-CCHHHHHHHHHHHCCHHHHH--HHHHHHCCCCCCHHHHH
T ss_conf             7555576515751687-77899999999965999999--99998589888578862


No 51 
>2z8f_A Galacto-N-biose/lacto-N-biose I transporter substrate-binding protein; ABC transporter, mucin core-1, human MILK oligosacchalide; HET: BGC GAL NAG MES; 1.65A {Bifidobacterium longum} PDB: 2z8e_A* 2z8d_A*
Probab=93.72  E-value=0.26  Score=24.81  Aligned_cols=96  Identities=13%  Similarity=0.143  Sum_probs=50.8

Q ss_pred             CCCCEEEEE-----ECCHHHHHHHHHHHHHHHHCCCCEEEEEEC-CCC-HHHHHH----HHHHCCCCCCCEEECCC----
Q ss_conf             137679998-----034258999999999998779807999815-762-057898----85210133530121332----
Q gi|254780707|r   23 FARNRIRIA-----GSSTLFPYSKIIAENFSEYFPEFKTPFVES-GGS-SVGLKE----FCRGIGDDTIDIVNSSR----   87 (346)
Q Consensus        23 ~a~~~I~i~-----GSst~~P~~~~~a~~y~~~~~~~~~~~~~~-~GS-g~Gi~~----~~~G~~~~~~dig~ssr----   87 (346)
                      ...+.|+|.     ....-.++++.+.++|+++||+++|. ++. .++ +.-...    +.+|.   ..||...+.    
T Consensus        11 ~~~~~v~i~~~~~~~~~~~~~~~~~~i~~F~k~~p~i~V~-~~~~~~~~~d~~~kl~~~~~ag~---~pDi~~~~~~~~~   86 (412)
T 2z8f_A           11 DDGGVVNITYMHRLPDSEGMTLVNDIVAKWNKQHPDIQVK-ATKFDGKASDMIKKLETDVKSGE---APDLAQVGYAELP   86 (412)
T ss_dssp             CCCSCEEEEEEECCCCCTTSCCHHHHHHHHHHHCTTEEEE-EEECSSCGGGHHHHHHHHHHHTC---CCSEEEEEGGGHH
T ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEE-EEEECCCHHHHHHHHHHHHHCCC---CCEEEEECHHHHH
T ss_conf             8999889999856899416899999999999888392899-99827977899999999986799---8869998918899


Q ss_pred             ---------CCCHHHHHHHHH----------CCCCCCEEEEEECCCCEEEECCCC
Q ss_conf             ---------024767876762----------487872466652154125541666
Q gi|254780707|r   88 ---------KITQNELDECKK----------HGVSDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus        88 ---------~l~~~E~~~~~~----------~~~~~~~~~~v~~d~i~i~~n~~~  123 (346)
                               +|++- ++....          .....+..+|...+..++.+|++.
T Consensus        87 ~~~~~g~l~dL~~~-~~~~~~~~~~~~~~~~~~dGk~y~iP~~~~~~~~~ynkd~  140 (412)
T 2z8f_A           87 EVFTKGLLQDVTQY-AEQYKNDFASGPYSLVQVGGKAYGLPQDTGPLVYFYNKAE  140 (412)
T ss_dssp             HHHHTTCBCCCHHH-HHHHGGGBCHHHHHTTEETTEECEEECBCCBEEEEEEHHH
T ss_pred             HHHHCCCCCCCCHH-HHHHHHHCCHHHHHHEEECCEEEEEEEECCCCEEEEECHH
T ss_conf             99987995538154-6665764579989750899999999974376069997113


No 52 
>3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, protein structure initiative; 2.71A {Pseudomonas aeruginosa PA01}
Probab=93.36  E-value=0.3  Score=24.46  Aligned_cols=86  Identities=13%  Similarity=0.146  Sum_probs=57.9

Q ss_pred             CCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             376799980342589-9999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   24 ARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        24 a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
                      ...++++..+.+... ++..+...|.+.||++++. +...-+...++.+.+|.    +|||.+..+..+..         
T Consensus        93 ~~~~~~i~~~~~~~~~~l~~~l~~~~~~~P~i~l~-~~~~~~~~~~~~L~~~~----~Di~i~~~~~~~~~---------  158 (306)
T 3fzv_A           93 IAGQIDIGCFETVAPLYLPGLIAGFRQAYPGVEIR-IRDGEQQELVQGLTSGR----FDLAFLYEHDLDST---------  158 (306)
T ss_dssp             CCEEEEEEEEGGGHHHHHHHHHHHHHHHCTTEEEE-EEEECHHHHHHHHHHTS----CSEEEECSSSCCTT---------
T ss_pred             CCCEEEEEEEHHHHHHHHHHHHHHHHHHCCCEEEE-EEECCHHHHHHHHHCCC----CCEEEEECCCCCCC---------
T ss_conf             77526888504789999899999998538974999-99787799999998599----73688835789987---------


Q ss_pred             CCCEEEEE-ECCCCEEEECCCCCC
Q ss_conf             87246665-215412554166654
Q gi|254780707|r  103 SDIQEVTI-GHDGILLVSDRDMVS  125 (346)
Q Consensus       103 ~~~~~~~v-~~d~i~i~~n~~~~~  125 (346)
                        +...++ ..+.+.+++..+.+.
T Consensus       159 --~~~~~l~~~~~~~v~~~~~~~l  180 (306)
T 3fzv_A          159 --IETEPLMPPQRPHALLPEGHRF  180 (306)
T ss_dssp             --EEEEESSCCBCCEEEEETTCTT
T ss_pred             --CEEEEECCCCEEEEEECCCHHH
T ss_conf             --2589921462689996264265


No 53 
>2xd3_A MALX, maltose/maltodextrin-binding protein; solute-binding protein, sugar binding protein, virulence, alpha-glucan, sugar transport; HET: GLC; 2.00A {Streptococcus pneumoniae} PDB: 2xd2_A*
Probab=93.27  E-value=0.32  Score=24.38  Aligned_cols=105  Identities=12%  Similarity=0.215  Sum_probs=55.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH----HHCCCCCCCEEECCC-------------CC
Q ss_conf             7999803425899999999999877980799981576205789885----210133530121332-------------02
Q gi|254780707|r   27 RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFC----RGIGDDTIDIVNSSR-------------KI   89 (346)
Q Consensus        27 ~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~----~G~~~~~~dig~ssr-------------~l   89 (346)
                      .|++--...-.+.++.++++|.++ ++++|. ++..+.+.-..++.    +|.   ..||...+.             +|
T Consensus        36 ~it~~~~~~~~~~~~~~~~~Fek~-~gi~V~-~~~~~~~~~~~kl~~~~~sg~---~pDi~~~~~~~~~~~~~~g~l~~l  110 (416)
T 2xd3_A           36 ELTVYVDEGYKSYIEEVAKAYEKE-AGVKVT-LKTGDALGGLDKLSLDNQNGN---VPDVMMAPYDRVGSLGSDGQLSEV  110 (416)
T ss_dssp             CCEEEECGGGHHHHHHHHHHHHHH-SSCCCE-EEECCHHHHHHTHHHHHHHSC---CCSEEEEEHHHHHHHHHTTCBCCC
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHC-CCCEEE-EEECCCHHHHHHHHHHHHCCC---CCEEEEECCHHHHHHHHCCCCCCC
T ss_conf             899997898259999999998754-195799-997993799999999986799---883999892889999977980308


Q ss_pred             CHH------HH-HHHHHCCCCCCEEEEEECCCCEEEECCCCCCC-CCCHHHHHHH
Q ss_conf             476------78-76762487872466652154125541666545-6888888876
Q gi|254780707|r   90 TQN------EL-DECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKA  136 (346)
Q Consensus        90 ~~~------E~-~~~~~~~~~~~~~~~v~~d~i~i~~n~~~~~~-~lt~~~l~~~  136 (346)
                      .+.      .. ..........+-.+|+..+..++++|++.... -.|-+++...
T Consensus       111 ~~~~~~~~~~~~~~~~~~~dGk~y~vP~~~~~~~~~yn~d~~~~~P~T~~e~~~~  165 (416)
T 2xd3_A          111 KLSDGAKTDDTTKSLVTAANGKVYGAPAVIESLVMYYNKDLVKDAPKTFADLENL  165 (416)
T ss_dssp             CCCGGGCCCHHHHHHHBCTTCCBCCEEEEEECCEEEEETTTCSSCCCBHHHHHHH
T ss_pred             CHHHHHHHCCCCHHHHCCCCCEEEEEEECCCEEEEEEECCCCCCCCCCHHHHHHH
T ss_conf             8667531120008762055981899961363479999676555799877889999


No 54 
>2hzl_A Trap-T family sorbitol/mannitol transporter, periplasmic binding protein, SMOM; trap transporter, periplasmic subunit, ligand binding; 1.40A {Rhodobacter sphaeroides 2} PDB: 2hzk_A
Probab=93.15  E-value=0.14  Score=26.34  Aligned_cols=64  Identities=20%  Similarity=0.234  Sum_probs=36.5

Q ss_pred             EEEEEE---CC--HHHHHHHHHHHHHHHHCC-CCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCH
Q ss_conf             799980---34--258999999999998779-807999815762057898852101335301213320247
Q gi|254780707|r   27 RIRIAG---SS--TLFPYSKIIAENFSEYFP-EFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ   91 (346)
Q Consensus        27 ~I~i~G---Ss--t~~P~~~~~a~~y~~~~~-~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~   91 (346)
                      +++++.   .+  .....++.|+++-.+... .+++. +-++|+-++-.+..++...+.+|++..+-....
T Consensus        33 tlr~a~~~p~~~~~~~~~~~~fa~~V~e~T~G~v~i~-~~~~g~Lg~~~e~~e~v~~G~vd~~~~~~~~~~  102 (365)
T 2hzl_A           33 TWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQ-VFSAGELVPGLQAADAVTEGTVECCHTVGYYYW  102 (365)
T ss_dssp             EEEEEESSCTTCTTTTHHHHHHHHHHHHHTTTSSEEE-EECTTTSSCGGGHHHHHHTTSSSEEEECGGGGT
T ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEE-EECCCCCCCCHHHHHHHHCCCCCCEEEECCCCC
T ss_conf             9999806999886377999999999999759919999-961864364065899997699753121011246


No 55 
>3thi_A Protein (thiaminase I); thiamin degradation, transferase; 2.00A {Bacillus subtilis} SCOP: c.94.1.1 PDB: 2thi_A 4thi_A
Probab=91.07  E-value=0.6  Score=22.84  Aligned_cols=79  Identities=13%  Similarity=0.103  Sum_probs=42.5

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECC-------------CCCCHH----------
Q ss_conf             589999999999987798079998157620578988521013353012133-------------202476----------
Q gi|254780707|r   36 LFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS-------------RKITQN----------   92 (346)
Q Consensus        36 ~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ss-------------r~l~~~----------   92 (346)
                      ...+++.+.++|+++||+++|.. ....+...    ..|   ...||...+             .+|++.          
T Consensus        14 ~~~~~~~~~~~Fe~~~P~i~Ve~-~~~~~~~~----~~~---~~pDv~~~~~~~~~~~~~~g~l~~l~~~~~~~~~~~~~   85 (371)
T 3thi_A           14 PARFQAAVLDQWQRQEPGVKLEF-TDWDSYSA----DPP---DDLDVFVLDSIFLSHFVDAGYLLPFGSQDIDQAEDVLP   85 (371)
T ss_dssp             HHHHHHHHHHHHHHHCTTSEEEE-CCCCTTTC----CCC---TTCCEEEEEGGGHHHHHHTTCEECBCGGGCTTGGGBCH
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEE-EECCCHHH----CCC---CCCEEEEECHHHHHHHHHCCCCCCCCCCHHHHHHHCCH
T ss_conf             79999999999998880958999-81678655----489---96889999968899999889913187420230544169


Q ss_pred             -HHHHHHHCCCCCCEEEEEECCCCEEEECCCCC
Q ss_conf             -78767624878724666521541255416665
Q gi|254780707|r   93 -ELDECKKHGVSDIQEVTIGHDGILLVSDRDMV  124 (346)
Q Consensus        93 -E~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~~  124 (346)
                       -++.+..  ...+-.+|+..+..++++|++..
T Consensus        86 ~~~~~~~~--~G~~y~vP~~~~~~~l~Ynkd~~  116 (371)
T 3thi_A           86 FALQGAKR--NGEVYGLPQILCTNLLFYRKGDL  116 (371)
T ss_dssp             HHHHHTEE--TTEECCEEEEEECEEEEEETTCH
T ss_pred             HHHHHCEE--CCEEEEEEEECCCEEEEEEHHHH
T ss_conf             98974488--98899988751207999877888


No 56 
>3f5f_A Maltose-binding periplasmic protein, heparan sulfate 2-O-sulfotransferase 1; maltose binding protein, fusion, heparan sulfate biosynthesis; HET: GLC A3P; 2.65A {Escherichia coli k-12}
Probab=89.75  E-value=0.78  Score=22.18  Aligned_cols=92  Identities=15%  Similarity=0.237  Sum_probs=48.5

Q ss_pred             CEEEE-EECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCH-HHHHH-HHHHCCCCCCCEEECCC-------------CC
Q ss_conf             67999-80342589999999999987798079998157620-57898-85210133530121332-------------02
Q gi|254780707|r   26 NRIRI-AGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS-VGLKE-FCRGIGDDTIDIVNSSR-------------KI   89 (346)
Q Consensus        26 ~~I~i-~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg-~Gi~~-~~~G~~~~~~dig~ssr-------------~l   89 (346)
                      .+|++ .+++.-.+.++.++++|++. +|++|. ++..++- .-+.. +.+|.   ..||...+.             +|
T Consensus         5 g~l~vW~~~d~~~~~l~~~~~~Fe~~-~gIkV~-~~~~~~~~~kl~~~~asG~---~PDv~~~~~~~~~~~~~~G~l~~L   79 (658)
T 3f5f_A            5 GKLVIWINGDKGYNGLAEVGKKFEKD-TGIKVT-VEHPDKLEEKFPQVAATGD---GPDIIFWAHDRFGGYAQSGLLAEI   79 (658)
T ss_dssp             TSEEEECCTTSCHHHHHHHHHHHHHH-HCCCEE-EECCTTHHHHHHHHHHTTC---SCSEEEEEHHHHHHHHHTTCBCCC
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHC-CCCEEE-EEECCCHHHHHHHHHHCCC---CCEEEEECHHHHHHHHHCCCEEEC
T ss_conf             68999967983389999999998426-194899-9848889999999986699---986999896899999988897568


Q ss_pred             CHHH----------HHHHHHCCCCCCEEEEEECCCCEEEECCCCC
Q ss_conf             4767----------8767624878724666521541255416665
Q gi|254780707|r   90 TQNE----------LDECKKHGVSDIQEVTIGHDGILLVSDRDMV  124 (346)
Q Consensus        90 ~~~E----------~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~~  124 (346)
                      ++..          ++.+...  ..+-.+|...+..++++|++..
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~d--Gk~YgiP~~~~~~~l~YNkdl~  122 (658)
T 3f5f_A           80 TPDKAFQDKLYPFTWDAVRYN--GKLIAYPIAVEALSLIYNKDLL  122 (658)
T ss_dssp             CCCHHHHTTBCHHHHHHTEET--TEECSEEEEEECCEEEEETTTC
T ss_pred             CCCHHHHHHCCHHHHHHCEEC--CEEEEEEEECCEEEEEEECHHH
T ss_conf             926433654789889746899--9899998863457999990762


No 57 
>2uvj_A TOGB, ABC type periplasmic sugar-binding protein; periplasmic binding protein, pectin degradation, trigalacturonic acid; HET: ADA; 1.8A {Yersinia enterocolitica} PDB: 2uvi_A* 2uvh_A* 2uvg_A
Probab=89.49  E-value=0.82  Score=22.07  Aligned_cols=57  Identities=18%  Similarity=0.294  Sum_probs=35.1

Q ss_pred             CEEEEE--ECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHH----HHHHHCCCCCCCEEECC
Q ss_conf             679998--03425899999999999877980799981576205789----88521013353012133
Q gi|254780707|r   26 NRIRIA--GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLK----EFCRGIGDDTIDIVNSS   86 (346)
Q Consensus        26 ~~I~i~--GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~----~~~~G~~~~~~dig~ss   86 (346)
                      -+|+++  |+..-...++++.++|+++||+++|. ++..+.+.-..    ++.+|.   ..|+...+
T Consensus         6 vtL~~~~W~~~~~~~~~~~~i~~F~~~~p~i~V~-~~~~~~~~~~~kl~~~~~sg~---~PDv~~~~   68 (408)
T 2uvj_A            6 VNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVK-AEYTGWDGHLSRLTTQIAGGT---EPDVMQTN   68 (408)
T ss_dssp             EEEEEEEECCHHHHHHHHHHHHHHHHHCTTEEEE-EEEECSTTHHHHHHHHHHHTC---CCSEEEEC
T ss_pred             EEEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEE-EEECCCHHHHHHHHHHHHCCC---CCEEEEEC
T ss_conf             8999999488179999999999999988393899-997883799999999997799---87599999


No 58 
>3kos_A HTH-type transcriptional activator AMPR; alpha-beta sandwich, DNA-binding, transcription regulation; HET: MES; 1.83A {Citrobacter freundii} PDB: 3kot_A
Probab=88.39  E-value=0.98  Score=21.63  Aligned_cols=80  Identities=8%  Similarity=0.033  Sum_probs=49.1

Q ss_pred             CCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             376799980342589-9999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   24 ARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        24 a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
                      .+++|+|+=+.++.. ++..+-.+|.+.||++++. +...   .....+.++.    +|++..-.+....          
T Consensus        10 ~~g~Lri~~~~sfa~~~L~p~L~~F~~~~P~i~v~-l~~~---~~~~~l~~~~----~Dl~i~~~~~~~~----------   71 (219)
T 3kos_A           10 TQEKLKIGVVGTFAIGCLFPLLSDFKRSYPHIDLH-ISTH---NNRVDPAAEG----LDYTIRYGGGAWH----------   71 (219)
T ss_dssp             -CEEEEEEEEHHHHHHTHHHHHHHHHHHCTTEEEE-EEEE---CSCCCHHHHT----CSEEEEEECSCCT----------
T ss_pred             CCCEEEEECHHHHHHHHHHHHHHHHHHHCCCEEEE-EEEC---CCCCCCCCCC----EEEEEECCCCCCC----------
T ss_conf             97709997819999999999999999988397999-9965---7522110255----5899733787886----------


Q ss_pred             CCCEEEEEECCCCEEEECCC
Q ss_conf             87246665215412554166
Q gi|254780707|r  103 SDIQEVTIGHDGILLVSDRD  122 (346)
Q Consensus       103 ~~~~~~~v~~d~i~i~~n~~  122 (346)
                       .+...++..+.++++.++.
T Consensus        72 -~~~~~~L~~~~~~~v~sp~   90 (219)
T 3kos_A           72 -DTDAQYLCSALMSPLCSPT   90 (219)
T ss_dssp             -TEEEEEEEECCEEEEBCHH
T ss_pred             -CCEEEEECCCCCEEECCCC
T ss_conf             -6436773024435523832


No 59 
>3hhf_B Transcriptional regulator, LYSR family; transcription factor, structural genomics, oxford protein production facility, OPPF; 2.30A {Neisseria meningitidis serogroup B}
Probab=84.77  E-value=1.6  Score=20.51  Aligned_cols=80  Identities=11%  Similarity=0.271  Sum_probs=51.3

Q ss_pred             CCEEEEEECCHHH-HHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             7679998034258-999999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   25 RNRIRIAGSSTLF-PYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        25 ~~~I~i~GSst~~-P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
                      +.+|+|+-++++. -++...-.+|++.||++++.+. ..   .....+.++.    .|++..-....+.           
T Consensus         6 ~G~lrI~~~~~~~~~~L~p~l~~F~~~~P~v~i~i~-~~---~~~~~l~~~~----~d~~i~~~~~~~~-----------   66 (213)
T 3hhf_B            6 QGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLV-SS---EGYINLIERK----VDIALRAGELDDS-----------   66 (213)
T ss_dssp             CEEEEEEECHHHHHHTHHHHHHHHHHHCTTEEEEEE-CC---STTHHHHTTS----SSEEEECC--CCS-----------
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHHHHHCCCEEEEEE-EC---CCCHHHHHHE----EEEHHCCCCCCCC-----------
T ss_conf             279999138899999999999999998849799999-75---6301223120----1010004776665-----------


Q ss_pred             CCEEEEEECCCCEEEECCCC
Q ss_conf             72466652154125541666
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~~  123 (346)
                      .+...++....++++.++..
T Consensus        67 ~~~~~~l~~~~~~~~~~~~~   86 (213)
T 3hhf_B           67 GLRARHLFDSRFRVIASPEY   86 (213)
T ss_dssp             SEEEEEEEEECEEEEECHHH
T ss_pred             CCCEEEEEEEEEEECCCHHH
T ss_conf             43124630056885046046


No 60 
>3fd3_A Chromosome replication initiation inhibitor protein; structural genomics, LYSR, PSI-2, protein structure initiative; HET: MSE P33 PG4; 1.70A {Agrobacterium tumefaciens str}
Probab=84.25  E-value=1.7  Score=20.37  Aligned_cols=198  Identities=12%  Similarity=0.084  Sum_probs=99.5

Q ss_pred             CCEEEEEE-CCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             76799980-342589-9999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   25 RNRIRIAG-SSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        25 ~~~I~i~G-Sst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
                      +-|++|+. +++... +... -.+|.+.|| +.+. ++...+...++.+.+|.    +|++....+..+.+         
T Consensus         1 r~tlria~~~~sl~~wl~P~-L~~f~~~~p-i~l~-l~~~~~~~~~~~l~~g~----~D~aI~~~~~~~~~---------   64 (208)
T 3fd3_A            1 RVTLNIATNADSLGTWFLDA-VSKFTGGSD-YLVN-IAVDDQDHTVEWLRGGR----VLAAVTAHDKPVQG---------   64 (208)
T ss_dssp             CCEEEEEECHHHHTTTHHHH-HHHHHHTSS-CEEE-EEECCSSCHHHHHHTTS----CSEEEESCCSCCTT---------
T ss_pred             CEEEEEEECHHHHHHHHHHH-HHHHHHHCC-CEEE-EEEECCHHHHHHHHCCC----EEEEEECCCCCCCC---------
T ss_conf             95789987738789889999-999999797-9799-99945662788875797----59999838999998---------


Q ss_pred             CCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHH
Q ss_conf             87246665215412554166654568888888764102555553236730232310011122450354488542357899
Q gi|254780707|r  103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL  182 (346)
Q Consensus       103 ~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F  182 (346)
                        +...++..+..+++..++-....                     .++..++.|+    .+.|...  ....++....+
T Consensus        65 --l~~~~L~~~~~~~vasp~~~~~~---------------------~~~~~~~~dL----~~~p~i~--~~~~~~~~~~~  115 (208)
T 3fd3_A           65 --CRVTPLGVLRYHATASPDFMARH---------------------FADGVTPAAL----ARAPGLT--FNQKDRLQASW  115 (208)
T ss_dssp             --CEEEEEEEEEEEEEECHHHHHHH---------------------CTTCSCHHHH----TTSCEEE--SSTTCCHHHHH
T ss_pred             --EEEEEEEEEEEEEEECHHHHHHC---------------------CCCCCCHHHH----HCCCCCC--CCCCCCCHHHH
T ss_conf             --69999460279999834999863---------------------7999999999----5086332--25666411355


Q ss_pred             HHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCC
Q ss_conf             98851345556541011111013660001344431024664021166236777631015321001332001100111001
Q gi|254780707|r  183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL  262 (346)
Q Consensus       183 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~  262 (346)
                      ...........                              ......+...+.. ......+|++++...+......-..
T Consensus       116 ~~~~~~~~~~~------------------------------~~~~~~~~~~~~~-~v~~G~Gia~lP~~~v~~~l~~g~L  164 (208)
T 3fd3_A          116 IRTALGEDVSY------------------------------PTHWLPSTDGFVK-ASLAGMGWGLNPVQLVAEHLAAGRL  164 (208)
T ss_dssp             HHHHHSSCCCC------------------------------CEEECCCHHHHHH-HHHTTSCBEEEEHHHHHHHHHHTSS
T ss_pred             HHHCCCCCCCC------------------------------CEEEECCHHHHHH-HHHHCCCEEECCHHHHHHHHHCCCE
T ss_conf             66414766544------------------------------3378888999999-9993994774859999999878986


Q ss_pred             CCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHH
Q ss_conf             34457678955602798750367899970788566889999999974987
Q gi|254780707|r  263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE  312 (346)
Q Consensus       263 ~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~  312 (346)
                      +.   +.|        .+|+-.+||...+.   ...+.++.|.+++.+..
T Consensus       165 v~---l~p--------~~~~~v~ly~~~~r---~~s~~~~~~~~~l~~~a  200 (208)
T 3fd3_A          165 VE---LMP--------GTPLDIPLYWQVNR---LAAERLAGLTANMVGTA  200 (208)
T ss_dssp             EE---SST--------TCCEEEEEEEEECT---TTTTTTHHHHHHHHHHH
T ss_pred             EE---ECC--------CCCCEEEEEEECCC---CCCHHHHHHHHHHHHHH
T ss_conf             89---799--------98661547976477---68989999999999998


No 61 
>2zzv_A ABC transporter, solute-binding protein; periplasmic substrate binding protein, calcium, lactate, trap transporter, transport protein; 1.40A {Thermus thermophilus} PDB: 2zzw_A 2zzx_A
Probab=84.03  E-value=1.7  Score=20.32  Aligned_cols=58  Identities=16%  Similarity=0.139  Sum_probs=34.1

Q ss_pred             CEEEEEE----CCHHHHHHHHHHHHHHHHCCC-CEEEEEECCCC----HHHHHHHHHHCCCCCCCEEECCCC
Q ss_conf             6799980----342589999999999987798-07999815762----057898852101335301213320
Q gi|254780707|r   26 NRIRIAG----SSTLFPYSKIIAENFSEYFPE-FKTPFVESGGS----SVGLKEFCRGIGDDTIDIVNSSRK   88 (346)
Q Consensus        26 ~~I~i~G----Sst~~P~~~~~a~~y~~~~~~-~~~~~~~~~GS----g~Gi~~~~~G~~~~~~dig~ssr~   88 (346)
                      -+++++-    .+.....++.|+++..+...| +++. +-..|+    ..-++++..|.    +|++..+-.
T Consensus        34 ~tlk~~~~~p~~~~~~~~~~~f~~~V~e~t~G~i~i~-~~~~g~Lg~~~e~~~~v~~G~----~d~~~~~~~  100 (361)
T 2zzv_A           34 YRWRIQTAWDAGTVGYSLFQKFTERVKELTDGQLEVQ-PFPAGAVVGTFDMFDAVKTGV----LDGMNPFTL  100 (361)
T ss_dssp             EEEEEEESSCTTSHHHHHHHHHHHHHHHHTTTSEEEE-EECTTSSSCGGGHHHHHHHTS----SSEEECBGG
T ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEE-EECCCCCCCHHHHHHHHHCCC----CCEEEEECC
T ss_conf             6999983789987657999999999999769908999-955866576799999997598----752542022


No 62 
>2gh9_A Maltose/maltodextrin-binding protein; MBP, maltose binding protein, thermophilic protein, periplasmic binding protein; HET: MLR; 1.95A {Thermus thermophilus HB27}
Probab=83.87  E-value=1.7  Score=20.28  Aligned_cols=52  Identities=15%  Similarity=0.088  Sum_probs=35.2

Q ss_pred             CCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHHHHH
Q ss_conf             5036789997078856688999999997498740522027755963489999999
Q gi|254780707|r  281 PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKS  335 (346)
Q Consensus       281 Pl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~~~  335 (346)
                      ++.....+.+.+.. ....+..+|++|++|++.|.  .+....|++|...+..+.
T Consensus       264 ~~~~~~~~~i~~~s-~~~e~A~~fl~~l~s~e~q~--~~~~~~g~~P~~~~~~~~  315 (386)
T 2gh9_A          264 PFLGVQGVVVNAYS-KNKTQAVNFAKTLVTGRNLV--AFNQAGGRIPVSKSAVKQ  315 (386)
T ss_dssp             CEEEEEEEEEBTTC-TTHHHHHHHHHHHTSHHHHH--HHHHHSCCEECBHHHHHH
T ss_pred             CCCCCCEEECCCCC-CCHHHHHHHHHHHCCHHHHH--HHHHHHCCCCCCHHHHHH
T ss_conf             53354101004668-78999999999977999999--999970988877899998


No 63 
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A*
Probab=80.31  E-value=2.4  Score=19.52  Aligned_cols=68  Identities=18%  Similarity=0.180  Sum_probs=44.7

Q ss_pred             HHCCCCCC--CCEEEEEECCHHHHHHHHHHHHH-HHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCC
Q ss_conf             83142013--76799980342589999999999-98779807999815762057898852101335301213320
Q gi|254780707|r   17 YCGTGTFA--RNRIRIAGSSTLFPYSKIIAENF-SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRK   88 (346)
Q Consensus        17 ~~~~~~~a--~~~I~i~GSst~~P~~~~~a~~y-~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~   88 (346)
                      .++.++.+  ..+|+|+-.....|++-+-.+.| .+...++++..+...+....++++.+|.    +||+.++..
T Consensus        18 ~~~~~a~a~~~~~lrIg~~~~~~~~~va~~~G~f~~~~~~~~v~~~~~~~g~~~~~al~sG~----~D~~~~~~~   88 (324)
T 3ksx_A           18 GSHQPALAAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGS----IDLGGAGDI   88 (324)
T ss_dssp             -------CCCCSEEEEEEETTCHHHHHHHHHTHHHHHCTTSEEEEEEESSHHHHHHHHHTTS----CSEEEEESH
T ss_pred             CCCCCCCCCCCCEEEEEEECCCCHHHHHHHHCHHHHHCCCCCEEEEECCCHHHHHHHHHCCC----CCEEEECHH
T ss_conf             57886555899759999616865799999848697838998279997897799999998499----288964659


No 64 
>2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein structure initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1
Probab=78.61  E-value=2.7  Score=19.21  Aligned_cols=89  Identities=13%  Similarity=0.163  Sum_probs=64.0

Q ss_pred             CCEEEEEECCHH-HHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             767999803425-8999999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   25 RNRIRIAGSSTL-FPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        25 ~~~I~i~GSst~-~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
                      ..++++++..+. ..++..+...|++.+|++.+. +....+..-...+.+|.    +||+....+..+..        ..
T Consensus       100 ~~~~~i~~~~~~~~~~~~~l~~~~~~~~p~~~~~-~~~~~~~~~~~~l~~g~----~D~ai~~~~~~~~~--------~~  166 (310)
T 2esn_A          100 QRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLR-LVNAERKLSVEALASGR----IDFALGYDEEHERL--------PE  166 (310)
T ss_dssp             CCEEEEECCHHHHHHHHHHHHHHHHHHSTTCEEE-EECCSSSCCHHHHHHTS----SSEEEECCSTTCCC--------CT
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHHHHCCCCCCCE-EECCCCHHHHHHHCCCC----CCEEEEECCCCCCC--------CC
T ss_conf             7624787531377889999999974228863211-21155033322210577----40589824765557--------77


Q ss_pred             CCEEEEEECCCCEEEECCCCCCC
Q ss_conf             72466652154125541666545
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRDMVSV  126 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~~~~~  126 (346)
                      .+...++..+..++++.++.|..
T Consensus       167 ~l~~~~l~~~~~~~~~~~~~p~~  189 (310)
T 2esn_A          167 GIQAHDWFADRYVVVARRDHPRL  189 (310)
T ss_dssp             TEEEEEEEEECEEEEEESSCTTC
T ss_pred             CCEEEEEEEEEEEEECCCCCHHH
T ss_conf             74268824544787327788423


No 65 
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni}
Probab=75.05  E-value=3.4  Score=18.64  Aligned_cols=59  Identities=15%  Similarity=0.053  Sum_probs=32.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCCEEEEEECCCCEEEECCCC
Q ss_conf             80799981576205789885210133530121332024767876762487872466652154125541666
Q gi|254780707|r   53 EFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus        53 ~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~  123 (346)
                      +.++. +....+..-+..+.+|.    +|+.......+++-....      . ...|......+++++++.
T Consensus        80 ~~~v~-~~~~~~~~~~~~l~~g~----~d~~~~~~~~t~~r~~~~------~-fs~p~~~~~~~~~~~~~~  138 (259)
T 2v25_A           80 DKKIK-LVAVNAKTRGPLLDNGS----VDAVIATFTITPERKRIY------N-FSEPYYQDAIGLLVLKEK  138 (259)
T ss_dssp             TTSEE-EEECCTTTHHHHHHTTS----CSEECSSCBCCHHHHTTE------E-ECSCSEEEEEEEEEEGGG
T ss_pred             CCEEE-EEEEEHHHHHHHHHCCC----CCCCCCCCCCCHHHHHCE------E-ECEEEECCCCCEEEECCC
T ss_conf             75799-99833775899997699----660033366897881011------4-220344045430220357


No 66 
>3mz1_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative, MI center for STR uctural genomics, MCSG; 1.88A {Sinorhizobium meliloti}
Probab=73.57  E-value=3.7  Score=18.43  Aligned_cols=79  Identities=13%  Similarity=0.227  Sum_probs=51.2

Q ss_pred             CCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             76799980342589-99999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   25 RNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        25 ~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
                      ...+++.-+.+... ++..+...|.+.+|++++.. ....   -+..+.+|.    +||+....+..+.+          
T Consensus        87 ~~~~~i~~~~~~~~~~l~~~l~~~~~~~p~i~i~i-~~~~---~~~~l~~~~----~Di~i~~~~~~~~~----------  148 (300)
T 3mz1_A           87 KGRLRVETASAFANLVIIPALPEFHKKYPDIQIDL-GVSD---RTIDYLAEN----VDCAIRAGTLTDQS----------  148 (300)
T ss_dssp             CEEEEEEECHHHHHHTHHHHHHHHHHHCTTEEEEE-EECC---CC--CCCTT----CCEEEEESSCSCTT----------
T ss_pred             CCEEEECCCHHHHHHHHHHHHHHHHHHCCCEEEEE-EECC---CHHHHHCCC----CEEEEEECCCCCCC----------
T ss_conf             64155113478999999999999999889849999-9786---367887699----24999907888755----------


Q ss_pred             CCEEEEEECCCCEEEECCC
Q ss_conf             7246665215412554166
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRD  122 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~  122 (346)
                       +...++..+.++++..++
T Consensus       149 -l~~~~l~~~~~~~~~~~~  166 (300)
T 3mz1_A          149 -LIARRITEMKFVACASRD  166 (300)
T ss_dssp             -SEEEEEEEECEEEEEEHH
T ss_pred             -CEEEEECCCCEEEEECHH
T ss_conf             -335440455269996579


No 67 
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1
Probab=73.28  E-value=3.8  Score=18.39  Aligned_cols=51  Identities=12%  Similarity=0.032  Sum_probs=31.8

Q ss_pred             CCEEEEEEEEECCCCCCCHHHHHHHHH-HHCHHHCCCCCHHHHCCCCCCCHHHHH
Q ss_conf             503678999707885668899999999-749874052202775596348999999
Q gi|254780707|r  281 PISRPLLFYVKRQHFNSVLGLREYVSF-SVSDEMMAPDSQLFQYGLIPISNEERK  334 (346)
Q Consensus       281 Pl~r~ly~yv~~~~~~~~~~~~~Fl~~-~ls~~~~~~~~~~~~~GyvPLp~~~~~  334 (346)
                      ++.....+.+++.. ...++..+|+.| +.++++|.  .+....|+.|......+
T Consensus       261 ~~~g~~~~~I~~~s-kn~eaA~~fl~~~lts~e~q~--~~~~~~g~~p~~~~~~~  312 (805)
T 2nvu_B          261 PFVGVLSAGINAAS-PNKELAKEFLENYLLTDEGLE--AVNKDKPLGAVALKSYE  312 (805)
T ss_dssp             CCEEEEEEEEBSSC-STTHHHHHHHHTTTSSHHHHH--HHHTTC----CCBHHHH
T ss_pred             CEEEEEEEEEECCC-CCHHHHHHHHHHHHCCHHHHH--HHHHHCCCCCCCHHHHH
T ss_conf             16701799998989-899999999999805999999--99982798867455502


No 68 
>2w7y_A FCSSBP, probable sugar ABC transporter, sugar-binding protein; solute-binding protein, blood group antigen, carbohydrate transport; HET: A2G GAL FUC; 2.35A {Streptococcus pneumoniae}
Probab=70.59  E-value=1.8  Score=20.23  Aligned_cols=37  Identities=14%  Similarity=0.121  Sum_probs=27.5

Q ss_pred             CCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHH
Q ss_conf             856688999999997498740522027755963489999
Q gi|254780707|r  294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEE  332 (346)
Q Consensus       294 ~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~  332 (346)
                      +....++..+||+|++|++.|.  .+....|++|...+.
T Consensus       318 ~s~~~~~A~~fl~~l~s~e~~~--~~~~~~g~~P~~~~~  354 (430)
T 2w7y_A          318 SEAKQKLALEFLKYMTSDDVQK--VIFEKVGANPSNENV  354 (430)
T ss_dssp             CHHHHHHHHHHHHHHTSHHHHH--HHHHTSCSCBSCTTS
T ss_pred             CHHHHHHHHHHHHHHCCHHHHH--HHHHHHCCCCCCCCC
T ss_conf             8066999999999975999999--999972988887200


No 69 
>1uth_A LYSR-type regulatory protein; transcription regulation, transcriptional regulator; 2.2A {Burkholderia SP} SCOP: c.94.1.1 PDB: 1utb_A 1utb_B 1uth_B 2uyf_A 2uye_A
Probab=69.75  E-value=4.5  Score=17.93  Aligned_cols=85  Identities=9%  Similarity=0.065  Sum_probs=63.8

Q ss_pred             CEEEEEECCHH-HHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCC
Q ss_conf             67999803425-89999999999987798079998157620578988521013353012133202476787676248787
Q gi|254780707|r   26 NRIRIAGSSTL-FPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD  104 (346)
Q Consensus        26 ~~I~i~GSst~-~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~  104 (346)
                      ..++++-+.+. ..++..+...|.+.+|++.+. +....+..-+..+.+|.    +||+....+..+           ..
T Consensus       105 ~~~~i~~~~~~~~~~l~~~l~~~~~~~p~~~i~-i~~~~~~~~~~~l~~g~----~D~~i~~~~~~~-----------~~  168 (315)
T 1uth_A          105 RTFNLAMTDIGEMYFMPPLMEALAQRAPHIQIS-TLRPNAGNLKEDMESGA----VDLALGLLPELQ-----------TG  168 (315)
T ss_dssp             CEEEEECCHHHHHHHHHHHHHHHHHHCTTCEEE-EECTTSSCHHHHHHHTS----CCEEEECCTTCC-----------TT
T ss_pred             CEEEEEECHHHHHHHHHHHHHHHHHHCCCCCEE-EEEECHHHHHHHHHCCC----CEEEEEECCCCC-----------CC
T ss_conf             238984005778988999999988748876328-99704488999986799----529998079999-----------98


Q ss_pred             CEEEEEECCCCEEEECCCCCCC
Q ss_conf             2466652154125541666545
Q gi|254780707|r  105 IQEVTIGHDGILLVSDRDMVSV  126 (346)
Q Consensus       105 ~~~~~v~~d~i~i~~n~~~~~~  126 (346)
                      +...++..+..++++++..+..
T Consensus       169 l~~~~l~~~~~~~~~~~~~~~~  190 (315)
T 1uth_A          169 FFQRRLFRHRYVCMFRKDHPSA  190 (315)
T ss_dssp             EEEEEEEEECEEEEEETTCSSC
T ss_pred             CEEEEEEEEEEEEEECCCCHHH
T ss_conf             2899976110699962875543


No 70 
>1p99_A Hypothetical protein PG110; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Staphylococcus aureus subsp} SCOP: c.94.1.1
Probab=60.97  E-value=6.8  Score=16.95  Aligned_cols=55  Identities=13%  Similarity=0.042  Sum_probs=36.8

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEEC
Q ss_conf             7679998034258999999999998779807999815762057898852101335301213
Q gi|254780707|r   25 RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS   85 (346)
Q Consensus        25 ~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~s   85 (346)
                      ..+|+|.-.....++...+.+.+.+.  |.++..++-.+...-..++.+|.    +|++..
T Consensus        38 ~k~i~IG~~~~~~~~~~~~~~~~kk~--Gl~Ve~~~F~d~~~~~~AL~~G~----ID~~~~   92 (295)
T 1p99_A           38 DKKVTIGVASNDTKAWEKVKELAKKD--DIDVEIKHFSDYNLPNKALNDGD----IDMNAF   92 (295)
T ss_dssp             --CEEEEESSSCCHHHHHHHHHHGGG--TCCEEEEECSSTTSHHHHHHTTS----SSEEEE
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHC--CCEEEEEEECCCHHHHHHHHCCC----CCEEEC
T ss_conf             96499996798389999999999975--98899998178277999997599----676751


No 71 
>2b3f_A Glucose-binding protein; protein-carbohydrate complex, periplasmic binding protein, galactose, GBP, sugar binding protein; HET: GAL; 1.56A {Thermus thermophilus HB27} PDB: 2b3b_A*
Probab=60.80  E-value=4.1  Score=18.15  Aligned_cols=38  Identities=11%  Similarity=-0.017  Sum_probs=26.6

Q ss_pred             EEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCC
Q ss_conf             97078856688999999997498740522027755963489
Q gi|254780707|r  289 YVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPIS  329 (346)
Q Consensus       289 yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp  329 (346)
                      .+.+.. ...++..+||+|++|.+.|.  .+....|++|.-
T Consensus       281 ~I~~~s-k~~e~A~~fl~~l~s~e~q~--~~~~~~g~iP~~  318 (400)
T 2b3f_A          281 GLPKGA-KNRQNAINWLRLVGSKEGQD--TSNPLKGSIAAR  318 (400)
T ss_dssp             CCBTTC-TTHHHHHHHHHHHTSHHHHH--HHHHHHSCBCSS
T ss_pred             EEECCC-CCHHHHHHHHHHHCCHHHHH--HHHHHCCCCCCC
T ss_conf             998999-89999999999977999999--999962950664


No 72 
>2gha_A Maltose ABC transporter, periplasmic maltose- binding protein; periplasmic binding protein, MBP, maltotriose, sugar binding protein; HET: MLR; 1.60A {Thermotoga maritima MSB8} PDB: 2ghb_A 2fnc_A*
Probab=53.91  E-value=9  Score=16.27  Aligned_cols=92  Identities=16%  Similarity=0.214  Sum_probs=52.0

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH----HHCCCCCCCEEECCCC-------------
Q ss_conf             67999803425899999999999877980799981576205789885----2101335301213320-------------
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFC----RGIGDDTIDIVNSSRK-------------   88 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~----~G~~~~~~dig~ssr~-------------   88 (346)
                      ..|++=++..-.+.++.++++|+++| +++|. ++..+.+.-..++.    +|.   ..|+...+..             
T Consensus         3 ~~lt~W~~~~~~~~~~~~~~~Fe~~~-gi~V~-~~~~~~~~~~~~l~~~~~sg~---~pDv~~~~~~~~~~~~~~g~l~~   77 (382)
T 2gha_A            3 PKLTIWCSEKQVDILQKLGEEFKAKY-GVEVE-VQYVNFQDIKSKFLTAAPEGQ---GADIIVGAHDWVGELAVNGLIEP   77 (382)
T ss_dssp             CEEEEEECTTTHHHHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHHHGGGTC---SCSEEEEEGGGHHHHHHTTCBCC
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHHHHHCCC---CCEEEEECCHHHHHHHHCCCEEE
T ss_conf             88999968876899999999998735-98799-997883899999999986799---98099989288999998889443


Q ss_pred             CCHH---------HHHHHHHCCCCCCEEEEEECCCCEEEECCCCC
Q ss_conf             2476---------78767624878724666521541255416665
Q gi|254780707|r   89 ITQN---------ELDECKKHGVSDIQEVTIGHDGILLVSDRDMV  124 (346)
Q Consensus        89 l~~~---------E~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~~  124 (346)
                      |++.         -++.+...  ..+-.+|......++++|++..
T Consensus        78 L~~~~~~~~~~~~~~~~~~~d--G~~y~vP~~~~~~~~~ynkd~~  120 (382)
T 2gha_A           78 IPNFSDLKNFYETALNAFSYG--GKLYGIPYAMEAIALIYNKDYV  120 (382)
T ss_dssp             CCCCTTGGGBCHHHHHHTEET--TEECCEEEEEECCEEEEETTTC
T ss_pred             CCCHHHHHHCCHHHHHHCEEC--CEEEEEEEECCCCCEEECHHHC
T ss_conf             864675643389889643799--8899986320343202422212


No 73 
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa}
Probab=52.39  E-value=9.6  Score=16.13  Aligned_cols=57  Identities=11%  Similarity=0.012  Sum_probs=30.4

Q ss_pred             CEEEEE-----ECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCC
Q ss_conf             679998-----03425899999999999877980799981576205789885210133530121332
Q gi|254780707|r   26 NRIRIA-----GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR   87 (346)
Q Consensus        26 ~~I~i~-----GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr   87 (346)
                      ++|+++     .+..+.+.++.+++...++. +..+..+....-.+-++.+..|.    +||+-.+-
T Consensus         4 ~~l~fg~~p~~~~~~~~~~~~pl~~~L~~~l-G~~V~~~~~~dy~~~ieal~~g~----vDia~~~~   65 (310)
T 3n5l_A            4 PVINFGIISTESSQNLKSIWEPFLKDMSQQT-GYQVKAFFAPDYAGIIQGMRFDK----VDIAWYGN   65 (310)
T ss_dssp             CEEEEEECCSSCHHHHHHHHHHHHHHHHHHH-SSEEEEECCSSHHHHHHHHHTTS----CSEEECCH
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHHHHH-CCCEEEEECCCHHHHHHHHHCCC----CCEEEECC
T ss_conf             8699997789999999999999999999976-99579997599999999997699----86899892


No 74 
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli}
Probab=46.52  E-value=12  Score=15.60  Aligned_cols=60  Identities=18%  Similarity=0.209  Sum_probs=38.5

Q ss_pred             CCEEEEEECCHHHHHHHHHHHH-HHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCC
Q ss_conf             7679998034258999999999-998779807999815762057898852101335301213320
Q gi|254780707|r   25 RNRIRIAGSSTLFPYSKIIAEN-FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRK   88 (346)
Q Consensus        25 ~~~I~i~GSst~~P~~~~~a~~-y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~   88 (346)
                      ..+|+|+=.....|+.-+-... |.+...++++.-++..++..-++++.+|.    +||+..+..
T Consensus         2 p~~irIGy~~~~~~~~va~~~g~fe~~g~~~~Ve~~~~~~g~~~~~al~~G~----iD~~~~~~~   62 (308)
T 2x26_A            2 PEALRIGYQKGSIGMVLAKSHQLLEKRYPESKISWVEFPAGPQMLEALNVGS----IDLGSTGDI   62 (308)
T ss_dssp             CSEEEEEECTTCHHHHHHHHTTHHHHHCTTSEEEEEECSSHHHHHHHHHHTS----CSEEEECSH
T ss_pred             CCEEEEEECCCCHHHHHHHHHCHHHHHCCCCEEEEEECCCHHHHHHHHHCCC----CCEEEECHH
T ss_conf             9649997578854999999709787718998079997898799999998499----788995739


No 75 
>3omb_A Extracellular solute-binding protein, family 1; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG; 2.10A {Bifidobacterium longum subsp}
Probab=45.04  E-value=5.1  Score=17.63  Aligned_cols=35  Identities=6%  Similarity=-0.070  Sum_probs=20.4

Q ss_pred             CCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHC
Q ss_conf             875036789997078856688999999997498740
Q gi|254780707|r  279 LYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM  314 (346)
Q Consensus       279 ~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~  314 (346)
                      ..+....-.+.+.+... ...+..+||+|++|++++
T Consensus       345 ~~~~~~~~~~~I~~~sk-~~e~A~~fl~~l~s~e~~  379 (535)
T 3omb_A          345 SSSELSPAGLSISSHAA-NKDAALKLANLLYSEKYS  379 (535)
T ss_dssp             CCSSEEEEEEEEBTTCT-THHHHHHHHHHHTSHHHH
T ss_pred             CCCCCCCCEEEEECCCC-CHHHHHHHHHHHCCHHHH
T ss_conf             75422473147768999-999999999997099989


No 76 
>3hhg_A Transcriptional regulator, LYSR family; transcription factor, structural genomics, oxford protein production facility, OPPF; 3.20A {Neisseria meningitidis serogroup B}
Probab=40.95  E-value=15  Score=15.10  Aligned_cols=81  Identities=14%  Similarity=0.296  Sum_probs=55.5

Q ss_pred             CCEEEEEEC-CHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             767999803-4258999999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   25 RNRIRIAGS-STLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        25 ~~~I~i~GS-st~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
                      ...+++..+ +....++.....+|.+.+|++.+...    ++..+.++.+|.    +||+....+..+           .
T Consensus        92 ~~~~~i~~~~~~~~~~l~~~~~~~~~~~p~~~~~~~----~~~~~~~L~~~~----~Dl~i~~~~~~~-----------~  152 (306)
T 3hhg_A           92 QGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLV----SSEGYINLIERK----VDIALRAGELDD-----------S  152 (306)
T ss_dssp             CEEEEEEBCHHHHHHTHHHHHHHHHHHCTTEEEEEE----CCSSSHHHHTTS----SSCEEESCCCCC-----------S
T ss_pred             CCCCEEECCHHHHHHHCCHHHHHHHHHCCCCEEEEE----ECCHHHHHHCCC----CEEEEECCCCCC-----------C
T ss_conf             575035302158988716132788986898459997----374788987499----039998178888-----------9


Q ss_pred             CCEEEEEECCCCEEEECCCCC
Q ss_conf             724666521541255416665
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRDMV  124 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~~~  124 (346)
                      .+...+++.+.++++++++.+
T Consensus       153 ~l~~~~l~~~~~~~~~~~~~~  173 (306)
T 3hhg_A          153 GLRARHLFDSRFRVIASPEYL  173 (306)
T ss_dssp             SCEEEEEEEEEEEEEECHHHH
T ss_pred             CEEEEEEEEEEEEEEEECHHH
T ss_conf             848999630359999806477


No 77 
>1y4c_A Maltose binding protein fused with designed helical protein; de novo designed helical protein, maltose binding protein fusion, de novo protein; HET: GLC; 1.90A {Escherichia coli}
Probab=34.61  E-value=19  Score=14.52  Aligned_cols=92  Identities=15%  Similarity=0.209  Sum_probs=47.7

Q ss_pred             CEEEE-EECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCH-HHHH-HHHHHCCCCCCCEEECCC-------------CC
Q ss_conf             67999-80342589999999999987798079998157620-5789-885210133530121332-------------02
Q gi|254780707|r   26 NRIRI-AGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS-VGLK-EFCRGIGDDTIDIVNSSR-------------KI   89 (346)
Q Consensus        26 ~~I~i-~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg-~Gi~-~~~~G~~~~~~dig~ssr-------------~l   89 (346)
                      .+|++ .+++.....+..+.++|.+. ++++|. +...++- .-+. .+.+|.   ..|+...+.             +|
T Consensus         5 gtltvW~~~~~~~~~l~e~~~~Fe~~-~gIkV~-i~~~~d~~~kl~t~~asG~---~PDV~~~~~~~~~~~~~~G~l~dL   79 (494)
T 1y4c_A            5 GKLVIWINGDKGYNGLAEVGKKFEKD-TGIKVT-VEHPDKLEEKFPQVAATGD---GPDIIFWAHDRFGGYAQSGLLAEI   79 (494)
T ss_dssp             CEEEEECCTTSCHHHHHHHHHHHHHH-HCCEEE-EECCTTHHHHHHHHHTTTC---SCSEEEEEGGGHHHHHHTTCBCCC
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHCC-CCCEEE-EEECCCHHHHHHHHHHCCC---CCEEEEECHHHHHHHHHCCCCCCC
T ss_conf             38999967983379999999997006-394799-9858879999999986699---985999991889999988893418


Q ss_pred             CHHHH----------HHHHHCCCCCCEEEEEECCCCEEEECCCCC
Q ss_conf             47678----------767624878724666521541255416665
Q gi|254780707|r   90 TQNEL----------DECKKHGVSDIQEVTIGHDGILLVSDRDMV  124 (346)
Q Consensus        90 ~~~E~----------~~~~~~~~~~~~~~~v~~d~i~i~~n~~~~  124 (346)
                      ++.+.          +.+..  ...+-.+|+..+..++++|.+..
T Consensus        80 ~~~~~~~d~~~~~~~~~~t~--dGk~YgvP~~~~~~~l~YNkdl~  122 (494)
T 1y4c_A           80 TPDKAFQDKLYPFTWDAVRY--NGKLIAYPIAVEALSLIYNKDLL  122 (494)
T ss_dssp             CCCHHHHTTBCHHHHHHTEE--TTEECSEEEEEECCEEEEETTTC
T ss_pred             CCCHHHHHHCCHHHHHHCEE--CCEEEECCCEEEEEEEEECCCCC
T ss_conf             92654475458888974558--99996046111235899744234


No 78 
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1
Probab=33.07  E-value=20  Score=14.38  Aligned_cols=48  Identities=15%  Similarity=0.235  Sum_probs=36.5

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCC
Q ss_conf             9999999999877980799981576205789885210133530121332024
Q gi|254780707|r   39 YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKIT   90 (346)
Q Consensus        39 ~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~   90 (346)
                      .+..++..+-++..++++..+...|++.-+.++.+|.    +||+.++....
T Consensus        29 ~y~g~a~gl~~~~~gl~ve~~~~~g~~~~i~al~sg~----~D~a~~~~~~~   76 (231)
T 2ozz_A           29 LYEGLASGLKAQFDGIPFYYAHMRGADIRVECLLNGV----YDMAVVSRLAA   76 (231)
T ss_dssp             HHHHHHHHHHHTTTTSCEEEEECSCHHHHHHHHHTTS----CSEEEEEHHHH
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCC----CCEEEECCHHH
T ss_conf             8888876699985398289999448399999998699----47797271889


No 79 
>2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I}
Probab=32.02  E-value=21  Score=14.28  Aligned_cols=109  Identities=11%  Similarity=0.149  Sum_probs=50.5

Q ss_pred             CCCCEEEEE-----ECCHHHHHHHHHHHHHHHHCC-CCEEEEEECCCCH-HHHHHHHHHCCCCCCCEEECCCCCCHHHHH
Q ss_conf             137679998-----034258999999999998779-8079998157620-578988521013353012133202476787
Q gi|254780707|r   23 FARNRIRIA-----GSSTLFPYSKIIAENFSEYFP-EFKTPFVESGGSS-VGLKEFCRGIGDDTIDIVNSSRKITQNELD   95 (346)
Q Consensus        23 ~a~~~I~i~-----GSst~~P~~~~~a~~y~~~~~-~~~~~~~~~~GSg-~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~   95 (346)
                      +....|++.     |.++ --+.+.+++.+++... .+.+. ..++|+| .|...+.+...+++.-+...+..+...-+.
T Consensus        14 ~P~k~I~iiVp~~~GGg~-D~~aR~~a~~l~k~lg~~v~V~-N~pGagG~~g~~~~~~~~~Dg~t~~~~~~~~~~~~~l~   91 (312)
T 2f5x_A           14 YPERPVNMVVPFAAGGPT-DNVARSLAESMRPTLGETVVVE-NKGGAGGTIGTTQVARAQPDGYSILLMHAGFSTAPSLY   91 (312)
T ss_dssp             CCSSCEEEEESSCTTSHH-HHHHHHHHHHHHHHHSSCEEEE-ECCCGGGHHHHHHHHTSCSSSSEEEEEETHHHHGGGTC
T ss_pred             CCCCCEEEEEECCCCCHH-HHHHHHHHHHHHHHHCCCEEEE-ECCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCC
T ss_conf             999998999800898689-9999999999999869987999-78982159999999956999981565215534452001


Q ss_pred             HHH-HCCCCCCE-EEEEECCCCEEEECCCCCCCCCCHHHHHH
Q ss_conf             676-24878724-66652154125541666545688888887
Q gi|254780707|r   96 ECK-KHGVSDIQ-EVTIGHDGILLVSDRDMVSVSLTVEDLYK  135 (346)
Q Consensus        96 ~~~-~~~~~~~~-~~~v~~d~i~i~~n~~~~~~~lt~~~l~~  135 (346)
                      ... .....++. ...+..+..+++++.+.+..  +.+++.+
T Consensus        92 ~~~~~~~~~df~~i~~~~~~~~~~~v~~~s~~~--t~~dli~  131 (312)
T 2f5x_A           92 KNPGYEPYTSFEPIGLVVDVPMTIIARGDFPPN--NIKELAE  131 (312)
T ss_dssp             SCCSSCTTTSEEEEEEEEEEEEEEEECTTCSCC--SHHHHHH
T ss_pred             CCCCCCHHHHHCCCCCEECCCEEEEECCCCCHH--HHHHHHH
T ss_conf             578888488633001000475689867988403--3789999


No 80 
>3kjt_A Maltose-binding periplasmic protein; alternate conformation, sugar transport, transpor transport protein; 1.50A {Escherichia coli k-12} PDB: 3hpi_A 1anf_A* 1dmb_A* 1ez9_A* 1jw4_A 1jw5_A* 1lls_A 1omp_A 2d21_A 2r6g_E* 3mbp_A* 4mbp_A* 1fqa_A* 1fqb_A* 1fqc_A* 1fqd_A* 1ezo_A 1ezp_A 2h25_A 2klf_A ...
Probab=26.72  E-value=26  Score=13.75  Aligned_cols=95  Identities=15%  Similarity=0.189  Sum_probs=48.3

Q ss_pred             CCCCEEEE-EECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHH-HH-HHHHHHCCCCCCCEEECCC------------
Q ss_conf             13767999-803425899999999999877980799981576205-78-9885210133530121332------------
Q gi|254780707|r   23 FARNRIRI-AGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV-GL-KEFCRGIGDDTIDIVNSSR------------   87 (346)
Q Consensus        23 ~a~~~I~i-~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~-Gi-~~~~~G~~~~~~dig~ssr------------   87 (346)
                      .....|++ .+...-.+.++.++++|++++ +++|. ++..++-. =+ .++.+|.   ..||...+.            
T Consensus         4 ~~~~~l~~W~~~~~~~~~~~~~~~~Fe~~~-gi~V~-~~~~~~~~~~l~~~~~sg~---~pDv~~~~~~~~~~~~~~g~l   78 (372)
T 3kjt_A            4 IEEGKLVIWINGLFGYNGLAEVGKKFEKDT-GIKVT-VEHPDKLEEKFPQVAATGD---GPDIIFYAHDRFGGYAQSGLL   78 (372)
T ss_dssp             CCTTSEEEECCTTSCHHHHHHHHHHHHHHH-SCCEE-EECCTTHHHHHHHHHTTTC---SCSEEEEEHHHHHHHHHTTCB
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHH-CCEEE-EEECCCHHHHHHHHHHCCC---CCEEEEECCHHHHHHHHCCCC
T ss_conf             767769999789831599999999987513-93899-9858889999999986799---986999992889999987890


Q ss_pred             -CCCHHH----------HHHHHHCCCCCCEEEEEECCCCEEEECCCCC
Q ss_conf             -024767----------8767624878724666521541255416665
Q gi|254780707|r   88 -KITQNE----------LDECKKHGVSDIQEVTIGHDGILLVSDRDMV  124 (346)
Q Consensus        88 -~l~~~E----------~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~~  124 (346)
                       +|++..          ++.+...  ..+-.+|+..+..++++|++..
T Consensus        79 ~~l~~~~~~~~~~~~~~~~~~~~d--G~~y~iP~~~~~~~~~ynkd~~  124 (372)
T 3kjt_A           79 AEITPDKAFQDKLYPFTWDAVRYN--GKLIAYPIAVYALSLIYNKDLL  124 (372)
T ss_dssp             CCCCCCHHHHTTBCHHHHHHTEET--TEECSEEEEEECCEEEEETTTC
T ss_pred             CCCCCCHHHHHHCCHHHHHHCEEC--CEEEEEECCCCCEEEEEECCCC
T ss_conf             428913334655389889735599--9899985146606999975233


No 81 
>1xt8_A Putative amino-acid transporter periplasmic solute-binding protein; ABC transport, cysteine uptake, spine, structural genomics; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1
Probab=25.05  E-value=28  Score=13.57  Aligned_cols=71  Identities=14%  Similarity=0.052  Sum_probs=33.1

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCCEEEEEECCCCEEE
Q ss_conf             99999999998779807999815762057898852101335301213320247678767624878724666521541255
Q gi|254780707|r   39 YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV  118 (346)
Q Consensus        39 ~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~~~~~v~~d~i~i~  118 (346)
                      +++.++++-.  ..+.++. +.......-+..+.+|.    +|+..+....+++-.+..      .+ ..|......+++
T Consensus        73 l~~~ia~~Lg--~~~~~v~-~~~~~~~~~~~~l~~g~----~d~~~~~~~~t~~R~~~~------~f-s~py~~~~~~~~  138 (292)
T 1xt8_A           73 LAKRIAKELF--GDENKVQ-FVLVEAANRVEFLKSNK----VDIILANFTQTPQRAEQV------DF-CSPYMKVALGVA  138 (292)
T ss_dssp             HHHHHHHHHH--SCTTCEE-EEECCGGGHHHHHHTTS----CSEECSSCBCCHHHHTTE------EE-CCCCEEEEEEEE
T ss_pred             HHHHHHHHHC--CCCCEEE-EEECCHHHHHHHHHCCC----CCCCCCCCCCCCCHHCCC------CC-CCCEEECCCEEE
T ss_conf             9999999855--8971799-99634786899998699----771135565671121024------66-753474151378


Q ss_pred             ECCCC
Q ss_conf             41666
Q gi|254780707|r  119 SDRDM  123 (346)
Q Consensus       119 ~n~~~  123 (346)
                      +..+.
T Consensus       139 ~~~~~  143 (292)
T 1xt8_A          139 VPKDS  143 (292)
T ss_dssp             EETTC
T ss_pred             EECCC
T ss_conf             72245


No 82 
>2de3_A Dibenzothiophene desulfurization enzyme B; alpha-beta, hydrolase; HET: OBP; 1.60A {Rhodococcus SP} PDB: 2de4_A* 2de2_A
Probab=21.32  E-value=33  Score=13.14  Aligned_cols=56  Identities=5%  Similarity=-0.040  Sum_probs=40.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECC
Q ss_conf             6799980342589999999999987798079998157620578988521013353012133
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS   86 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ss   86 (346)
                      .+|...-+....|++-+-.+.|-+++ +..+..+...++..-++.+.+|.    +|||...
T Consensus        20 ~~v~~~~~~~~~p~~vA~~~G~f~~~-GldV~~~~~~~~~~~~~al~~G~----~D~~~~~   75 (365)
T 2de3_A           20 DTLTYSNSPVPNALLTASESGFLDAA-GIELDVLSGQQGTVHFTYDQPAY----TRFGGEI   75 (365)
T ss_dssp             CEEEEEECSSCCHHHHHHHTTHHHHT-TCEEEECBGGGTTHHHHCCSTTE----EEEECSH
T ss_pred             EEEEEECCCCCHHHHHHHHCCHHHHC-CCCEEEEECCCCHHHHHHHHCCC----CCEEEEC
T ss_conf             79996479850899999986979984-99179996788279999997598----3789305


No 83 
>2kmf_A Photosystem II 11 kDa protein; PSB27, structure, helical bundle, cyanobacteria, photosynthesis; NMR {Synechocystis SP} PDB: 2knd_A
Probab=21.17  E-value=33  Score=13.13  Aligned_cols=23  Identities=22%  Similarity=0.369  Sum_probs=17.3

Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHC
Q ss_conf             77559634899999999999960
Q gi|254780707|r  320 LFQYGLIPISNEERKSVRDSIAV  342 (346)
Q Consensus       320 ~~~~GyvPLp~~~~~~~~~~~~~  342 (346)
                      -...|..|||+++++++.+.+..
T Consensus        84 Y~s~g~rPLPek~k~Rl~~el~~  106 (115)
T 2kmf_A           84 YTSYGARPIPEKLKKRLQLEFTQ  106 (115)
T ss_dssp             HHHHSSCCCCHHHHHHHHHHHHH
T ss_pred             HHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             87379999999999999999999


No 84 
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125}
Probab=21.16  E-value=33  Score=13.12  Aligned_cols=46  Identities=11%  Similarity=-0.000  Sum_probs=34.8

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCC
Q ss_conf             899999999999877980799981576205789885210133530121332
Q gi|254780707|r   37 FPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR   87 (346)
Q Consensus        37 ~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr   87 (346)
                      .|++-+....|-+++ |.++..+...++..-++++.+|.    +||+.+.-
T Consensus        18 ap~~vA~~~G~f~~~-Gl~Ve~~~~~~~~~~~~al~~G~----~D~~~~~~   63 (302)
T 3ix1_A           18 TFLYVAIENGYFAEE-GLDVDIVFPTNPTDPIQLTASGA----IPLALSYQ   63 (302)
T ss_dssp             HHHHHHHHTTHHHHT-TEEEEEECCSSTTHHHHHHHHTS----CSEEEECH
T ss_pred             HHHHHHHHCCHHHHC-CCEEEEEECCCCHHHHHHHHCCC----CCEEEECH
T ss_conf             999999988938984-97189995798059999997799----89899775


Done!