HHSEARCH alignment of GI: 254780707 and SCOP domain: d1a99a_

Alignment
>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]}
Probab=94.57  E-value=0.1  Score=25.80  Aligned_cols=42  Identities=5%  Similarity=0.046  Sum_probs=28.8

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHH
Q ss_conf             999707885668899999999749874052202775596348999
Q gi|254780707|r  287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNE  331 (346)
Q Consensus       287 y~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~  331 (346)
                      .+.+.+.. ....+..+|++|++|.+.|..  .....||+|....
T Consensus       251 ~~~i~~~s-~n~~~A~~fi~fl~s~e~q~~--~~~~~g~~p~~~~  292 (341)
T d1a99a_         251 VFAMPADA-KNKDEAYQFLNYLLRPDVVAH--ISDHVFYANANKA  292 (341)
T ss_dssp             EEECBTTC-SCHHHHHHHHHHHHSHHHHHH--HHHHHCCEESBTT
T ss_pred             CCEEECCC-CCHHHHHHHHHHHHCHHHHHH--HHHHHCCCCCCHH
T ss_conf             11334478-886999999999847899999--9997388885788


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Putrescine receptor (PotF)
species: Escherichia coli [TaxId: 562]