HHSEARCH alignment of GI: 254780707 and SCOP domain: d1amfa_

Alignment
>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]}
Probab=99.29  E-value=2.6e-10  Score=73.65  Aligned_cols=229  Identities=14%  Similarity=0.145  Sum_probs=116.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCC
Q ss_conf             67999803425899999999999877980799981576205789885210133530121332024767876762487872
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI  105 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~  105 (346)
                      ..|++-+++++.+.++.+++.|++++ +++| .+..+||+..++++.+|..   .| ...++.....+...... .....
T Consensus         1 Gel~vy~a~s~~~~~~~l~~~Fek~~-gi~V-~~~~~~sg~l~~~l~~~~~---~~-~~~~~~~~~~~~~~~~~-~~~~~   73 (231)
T d1amfa_           1 GKITVFAAASLTNAMQDIATQFKKEK-GVDV-VSSFASSSTLARQIEAGAP---AD-LFISADQKWMDYAVDKK-AIDTA   73 (231)
T ss_dssp             CEEEEEEEGGGHHHHHHHHHHHHHHH-CCEE-EEEEECHHHHHHHHHHTCC---CS-EEECSSHHHHHHHHHTT-CBCGG
T ss_pred             CEEEEEEECCHHHHHHHHHHHHHHHH-CCEE-EEEECCHHHHHHHHHHCCC---CE-EEEECCHHHHHHHHHCC-CCCCC
T ss_conf             98999997471999999999998821-9879-9997882999999983898---66-99966334568988605-66766


Q ss_pred             EEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHHH
Q ss_conf             46665215412554166654568888888764102555553236730232310011122450354488542357899988
Q gi|254780707|r  106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK  185 (346)
Q Consensus       106 ~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~~~  185 (346)
                      ..........++.++..+...                   ......++.|.|+..  |.. + .+..+..+++...+...
T Consensus        74 ~~~~~~~~~~~~~~~~~~~~~-------------------~~~~~~~~~~~dl~~--~~~-~-~~~~~~~~~~~~~~~~~  130 (231)
T d1amfa_          74 TRQTLLGNSLVVVAPKASVQK-------------------DFTIDSKTNWTSLLN--GGR-L-AVGDPEHVPAGIYAKEA  130 (231)
T ss_dssp             GCEEEEEECEEEEEETTCCCC-------------------CCCCSTTCCHHHHHT--TCC-E-EEECTTTCHHHHHHHHH
T ss_pred             CCEEEECCCCEEEECCCCCCC-------------------CCCCCCHHHHHHHCC--CCC-E-EEECCCCCHHHHHHHHH
T ss_conf             512320454112210122234-------------------232335778986107--996-8-99889873389999998


Q ss_pred             HCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCCCC
Q ss_conf             51345556541011111013660001344431024664021166236777631015321001332001100111001344
Q gi|254780707|r  186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI  265 (346)
Q Consensus       186 v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~~~~  265 (346)
                      ....+...     ..                     ........+..+....+......+|.........+...    ..
T Consensus       131 ~~~~~~~~-----~~---------------------~~~~~~~~~~~~~~~~~~~g~~~~~i~~~~~~~~~~~~----~~  180 (231)
T d1amfa_         131 LQKLGAWD-----TL---------------------SPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGV----KV  180 (231)
T ss_dssp             HHHTTCHH-----HH---------------------GGGEEEESSHHHHHHHHHTTSSSEEEEEHHHHHHCSSE----EE
T ss_pred             HHHHCCCC-----CC---------------------CCCCCCCCCHHHHHHHHHCCCCEEEEEEHHHHHHCCCC----CC
T ss_conf             88717730-----00---------------------10101133124789999718761998521124531688----70


Q ss_pred             CCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCC
Q ss_conf             5767895560279875036789997078856688999999997498740522027755963
Q gi|254780707|r  266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLI  326 (346)
Q Consensus       266 ~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~Gyv  326 (346)
                      ..+.|.     ++..++.++.. +++..   ..++.++|++|++|+++|.   ++.+.||.
T Consensus       181 ~~~~p~-----~~~~~~~~~~~-i~~~~---~~~~A~~Fi~fl~S~e~Q~---il~~~Gf~  229 (231)
T d1amfa_         181 VATFPE-----DSHKKVEYPVA-VVEGH---NNATVKAFYDYLKGPQAAE---IFKRYGFT  229 (231)
T ss_dssp             EEECCG-----GGSCCEEEEEE-EBTTC---CSHHHHHHHHHHTSHHHHH---HHHHTTCE
T ss_pred             EEEECC-----CCCEEEEEEEE-EECCC---CCHHHHHHHHHHCCHHHHH---HHHHCCEE
T ss_conf             698579-----88437588899-98799---9899999999978999999---99983908


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Molybdate-binding protein, ModA
species: Escherichia coli [TaxId: 562]