HHSEARCH alignment of GI: 254780707 and SCOP domain: d1eu8a_

Alignment
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]}
Probab=96.43  E-value=0.02  Score=29.76  Aligned_cols=93  Identities=12%  Similarity=0.184  Sum_probs=50.9

Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHH-HH-----HHHHHHCCCCCCCEEECCC-------------
Q ss_conf             7999803425899999999999877980799981576205-78-----9885210133530121332-------------
Q gi|254780707|r   27 RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV-GL-----KEFCRGIGDDTIDIVNSSR-------------   87 (346)
Q Consensus        27 ~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~-Gi-----~~~~~G~~~~~~dig~ssr-------------   87 (346)
                      ++.+.|...-..+++.+.++|+++||+++|. ++..+.+. ..     .+..+|.  ...||...+.             
T Consensus         7 ~~~~~g~p~~~~~~~~~i~~F~~~~p~i~V~-~~~~~~~~~~~~~~~~~~~~a~g--~~PDi~~~~~~~~~~~~~~g~l~   83 (407)
T d1eu8a_           7 VFAVGGAPNEIEYWKGVIAEFEKKYPGVTVE-LKRQATDTEQRRLDLVNALRGKS--SDPDVFLMDVAWLGQFIASGWLE   83 (407)
T ss_dssp             EEEECCSHHHHHHHHHHHHHHHHHSTTCEEE-EEECCSSHHHHHHHHHHHHTTTC--SSEEEEEEETTTHHHHHHHTCBC
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHCCCEEEE-EEECCCCHHHHHHHHHHHHHHCC--CCCEEEEECHHHHHHHHHCCCCC
T ss_conf             9997897669999999999999888691899-99736845999999999998289--99879998948899999879933


Q ss_pred             CCCHH--------------HHHHHHHCCCCCCEEEEEECCCCEEEECCCC
Q ss_conf             02476--------------7876762487872466652154125541666
Q gi|254780707|r   88 KITQN--------------ELDECKKHGVSDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus        88 ~l~~~--------------E~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~  123 (346)
                      +|++-              .++.+... ...+-.+|......++.+|++.
T Consensus        84 dL~~~~~~~~~~~~~~~~~~~~~~~~~-dG~~y~iP~~~~~~~~~yNkdl  132 (407)
T d1eu8a_          84 PLDDYVQKDNYDLSVFFQSVINLADKQ-GGKLYALPVYIDAGLLYYRKDL  132 (407)
T ss_dssp             CSHHHHHHHTCCGGGBCHHHHHHHTEE-TTEECCEEEEEEECEEEEEHHH
T ss_pred             CCCHHHHHCCHHHHHHCHHHHHHHHCC-CCEEECCCCCHHHHHHHCCCHH
T ss_conf             385765531132554048899875134-5423027630123455416125


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: D-maltodextrin-binding protein, MBP
species: Archaeon Thermococcus litoralis [TaxId: 2265]