HHSEARCH alignment of GI: 254780707 and SCOP domain: d1xvxa_

Alignment
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]}
Probab=98.08  E-value=9e-05  Score=42.79  Aligned_cols=97  Identities=11%  Similarity=0.108  Sum_probs=51.4

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECC-CC-CCHHH----------
Q ss_conf             6799980342589999999999987798079998157620578988521013353012133-20-24767----------
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS-RK-ITQNE----------   93 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ss-r~-l~~~E----------   93 (346)
                      +.+.+--+ .-.++++.+.+.|++++ |++|. +...+|+.-+.++.........|+..+. .. +...+          
T Consensus         4 ~~lvvYs~-~~~~~~~~ii~~Fek~t-GI~V~-~~~~~s~~l~~ki~aeg~~~~~Dv~~~~d~~~~~~~~~~~l~~~~~~   80 (311)
T d1xvxa_           4 SGIVVYNA-QHENLVKSWVDGFTKDT-GIKVT-LRNGGDSELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDA   80 (311)
T ss_dssp             SCEEEEEC-SCHHHHHHHHHHHHHHH-CCCEE-EEECCHHHHHHHHHHHGGGCCCSEEEESSSHHHHHHHHTTCBCCCCH
T ss_pred             CEEEEEEC-CCHHHHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHCCCCCCCCC
T ss_conf             70999979-88779999999998866-98899-99898599999999747899987899787899998875586222233


Q ss_pred             --HHHHHHC-CCCCCEEEEEECCCCEEEECCCCCC
Q ss_conf             --8767624-8787246665215412554166654
Q gi|254780707|r   94 --LDECKKH-GVSDIQEVTIGHDGILLVSDRDMVS  125 (346)
Q Consensus        94 --~~~~~~~-~~~~~~~~~v~~d~i~i~~n~~~~~  125 (346)
                        ....... ....-.-+++.....++++|.+...
T Consensus        81 ~~~~~i~~~~~d~~~~~~~~~~~~~~i~yn~~~~~  115 (311)
T d1xvxa_          81 VTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEKIS  115 (311)
T ss_dssp             HHHHHBCGGGSCSSSSCEEEEEEEEEEEECTTTSC
T ss_pred             CCCCCCCCCCCCCCCCEEEEEECEEEEEEECCCCC
T ss_conf             33223552100347812221003289998611045


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Ferric-binding protein FbpA
species: Yersinia enterocolitica, YfuA [TaxId: 630]