Query         gi|254780707|ref|YP_003065120.1| putative phosphate-binding periplasmic protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 346
No_of_seqs    141 out of 1801
Neff          9.3 
Searched_HMMs 13730
Date          Wed Jun  1 08:06:31 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780707.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1pc3a_ c.94.1.1 (A:) Phosphat 100.0       0       0  361.8  21.5  296   19-344     3-332 (333)
  2 d1ixha_ c.94.1.1 (A:) Phosphat 100.0       0       0  357.7  20.3  275   25-343     1-311 (321)
  3 d2v3qa1 c.94.1.1 (A:1-376) Pst 100.0       0       0  350.6  17.1  292   27-343     1-357 (376)
  4 d1twya_ c.94.1.1 (A:) ABC tran 100.0       0       0  296.9  20.2  248   26-327     1-248 (249)
  5 d1atga_ c.94.1.1 (A:) Molybdat  99.4 2.3E-11 1.7E-15   79.5  16.2  230   27-329     1-230 (231)
  6 d1amfa_ c.94.1.1 (A:) Molybdat  99.3 2.6E-10 1.9E-14   73.7  16.8  229   26-326     1-229 (231)
  7 d1sbpa_ c.94.1.1 (A:) Sulphate  98.8 1.1E-08   8E-13   64.6   8.7  245   38-339    19-274 (309)
  8 d2onsa1 c.94.1.1 (A:32-342) Mo  98.6 3.7E-08 2.7E-12   61.7   6.2   56   27-85      3-58  (311)
  9 d1xvxa_ c.94.1.1 (A:) Ferric-b  98.1   9E-05 6.5E-09   42.8  13.4   97   26-125     4-115 (311)
 10 d2fyia1 c.94.1.1 (A:88-307) Ly  98.0 0.00032 2.3E-08   39.7  16.5  201   24-310     4-206 (220)
 11 d1nnfa_ c.94.1.1 (A:) Ferric-b  97.9 0.00028   2E-08   40.1  12.5   48   36-85      9-56  (308)
 12 d1ixca2 c.94.1.1 (A:90-294) Ly  97.6  0.0014   1E-07   36.1  16.3  198   26-309     2-200 (205)
 13 d1al3a_ c.94.1.1 (A:) Cofactor  97.6  0.0017 1.2E-07   35.7  14.1  201   25-310     5-206 (237)
 14 d1pota_ c.94.1.1 (A:) Spermidi  97.4  0.0022 1.6E-07   35.0  12.1   92   26-123     2-117 (322)
 15 d1y4ta_ c.94.1.1 (A:) Ferric-b  97.4 0.00082   6E-08   37.4   9.7  128   28-182     3-146 (317)
 16 d1q35a_ c.94.1.1 (A:) Ferric-b  96.7   0.014   1E-06   30.6  11.3   94   26-123     2-111 (318)
 17 d1i6aa_ c.94.1.1 (A:) Hydrogen  96.7   0.014   1E-06   30.6  12.5   84   26-125     5-89  (212)
 18 d1eu8a_ c.94.1.1 (A:) D-maltod  96.4    0.02 1.4E-06   29.8  15.0   93   27-123     7-132 (407)
 19 d1elja_ c.94.1.1 (A:) D-maltod  96.3   0.025 1.8E-06   29.2  12.7  108   25-136     5-140 (380)
 20 d1y9ua_ c.94.1.1 (A:) Ferric-b  96.3   0.019 1.4E-06   29.8   9.0   46   39-87     13-58  (318)
 21 d3thia_ c.94.1.1 (A:) Thiamina  96.2   0.019 1.4E-06   29.8   8.6   50  277-329   255-304 (362)
 22 d1us5a_ c.94.1.1 (A:) Putative  96.0   0.032 2.3E-06   28.6  12.4   62   24-89      1-65  (298)
 23 d2esna2 c.94.1.1 (A:92-303) Pr  95.0   0.078 5.7E-06   26.4   8.4   92   21-125     3-95  (212)
 24 d1a99a_ c.94.1.1 (A:) Putresci  94.6     0.1 7.4E-06   25.8   8.1   42  287-331   251-292 (341)
 25 d1ursa_ c.94.1.1 (A:) D-maltod  94.6     0.1 7.4E-06   25.8  11.3   51  280-333   253-303 (367)
 26 d1utha_ c.94.1.1 (A:) LysR-typ  92.7    0.22 1.6E-05   23.9   9.9   89   21-125     7-96  (219)
 27 d2ozza1 c.94.1.1 (A:1-228) Hyp  32.9      11 0.00084   14.4   5.1   48   38-89     25-72  (228)

No 1  
>d1pc3a_ c.94.1.1 (A:) Phosphate-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=100.00  E-value=0  Score=361.83  Aligned_cols=296  Identities=15%  Similarity=0.160  Sum_probs=228.3

Q ss_pred             CCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHH
Q ss_conf             14201376799980342589999999999987798079998157620578988521013353012133202476787676
Q gi|254780707|r   19 GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECK   98 (346)
Q Consensus        19 ~~~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~   98 (346)
                      .+++.+..+|+++|||+++|+++.|+++|++.||++++ +|+++|||+|+++||+|.    +|||++||+|+++|++.|.
T Consensus         3 ~~~~~~~~~l~~~GSst~~p~~~~~a~~y~~~~~~~~v-~~~~~GSg~G~~~~~~g~----~di~~ssr~l~~~E~~~~~   77 (333)
T d1pc3a_           3 TTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTI-TAQGTGSGAGIAQAAAGT----VNIGASDAYLSEGDMAAHK   77 (333)
T ss_dssp             CSCCSSCEEEEEEECTTTHHHHHHHHHHHHHHSTTEEE-ECCBCCHHHHHHHHHTTS----CSEEEESSCCCHHHHHHST
T ss_pred             CCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHCCCEEE-EEECCCCHHHHHHHHCCC----CCEEEECHHHHHHHHHHHC
T ss_conf             67778885699975366999999999999988889069-996267689999997599----9389857777667875403


Q ss_pred             HCCCCCCEEEEEECCCCEEEECCCC--CCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCC
Q ss_conf             2487872466652154125541666--54568888888764102555553236730232310011122450354488542
Q gi|254780707|r   99 KHGVSDIQEVTIGHDGILLVSDRDM--VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKH  176 (346)
Q Consensus        99 ~~~~~~~~~~~v~~d~i~i~~n~~~--~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~S  176 (346)
                           .+.++++++|++++++|.++  +..+|+.+++.+||.+++..|.    .....|.+++..+|+.+|++++|+++|
T Consensus        78 -----~~~~~~v~~~~i~v~v~~~~~~~~~~Lt~~~l~~i~~G~itnW~----~~~~~~~n~~~~~p~~~I~v~~r~~~S  148 (333)
T d1pc3a_          78 -----GLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWD----DPQIAALNPGVNLPGTAVVPLHRSDGS  148 (333)
T ss_dssp             -----TEEEEEEEEEEEEEEECCTTCCSCCEECHHHHHHHHHTSCCBTT----CHHHHHHSTTCCCCCCBCEECEESSCC
T ss_pred             -----CEEEEEEEEEEEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCC----CCCCCCCCCCCCCCCCCEEEECCCCCC
T ss_conf             -----23530279850244454013553101289998675478755246----533333356777898613873178776


Q ss_pred             CHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCC-CCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             357899988513455565410111110136600013444310246-6402116623677763101532100133200110
Q gi|254780707|r  177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQD-GIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN  255 (346)
Q Consensus       177 GT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~  255 (346)
                      ||++.|+++++...+..+.......              ...... .......+.+..+.+.+..++++|||++++|+..
T Consensus       149 GT~~~f~~~l~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~v~~~v~~~~~aIGy~~~~~~~~  214 (333)
T d1pc3a_         149 GDTFLFTQYLSKQDPEGWGKSPGFG--------------TTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQ  214 (333)
T ss_dssp             HHHHHHHHHHHHHCTTTTTTTTCCS--------------SSCCCCCCTTCCEECHHHHHHHHHHHSTTEEEEEEGGGHHH
T ss_pred             CCHHHHHHHHHHCCCCCHHHCCCCC--------------CCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCEEEHHH
T ss_conf             3046668876511741022124766--------------43134556650331575899988745832102452130222


Q ss_pred             CCC-CC-----CCCCCCCCCCCHHHHC-----------------------CCCCCCEEEEEEEEECCCCC--CCHHHHHH
Q ss_conf             011-10-----0134457678955602-----------------------79875036789997078856--68899999
Q gi|254780707|r  256 NAD-VL-----KLVPIDGIVPSMGTIV-----------------------SGLYPISRPLLFYVKRQHFN--SVLGLREY  304 (346)
Q Consensus       256 ~~~-~~-----~~~~~~~v~p~~~~i~-----------------------~g~YPl~r~ly~yv~~~~~~--~~~~~~~F  304 (346)
                      +.. .+     .....+.+.|+.+++.                       +|+|||+|++|+|+++++.+  ..+.+++|
T Consensus       215 ~~~~~~~~a~~~~~~g~~v~Pt~~~i~~~~~~~~~~~~~~~~~~~~~~~~~g~YPi~~~~y~~v~~~~~~~~~~~~v~~F  294 (333)
T d1pc3a_         215 ASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAF  294 (333)
T ss_dssp             HHHTTCEECEEECTTSCEECCSHHHHHHHHTTTTTCCCTTCCCCCTTCSCTTCCSCEEEEEEEEESBCSSHHHHHHHHHH
T ss_pred             CCCCCHHHEEEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCEEECCCCCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHH
T ss_conf             01222121121013466668856665443202333457874132045777896541107999995578973545999999


Q ss_pred             HHHHHCHHHCCCCCHHHHCCCCCCCHHHHHHHHHHHHCCC
Q ss_conf             9997498740522027755963489999999999996077
Q gi|254780707|r  305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK  344 (346)
Q Consensus       305 l~~~ls~~~~~~~~~~~~~GyvPLp~~~~~~~~~~~~~~~  344 (346)
                      ++|+||+++|  +.+++++||||||++++++++++++...
T Consensus       295 l~~~ls~~gq--~~~~~~~GyvPLp~~~~~~~~~~~~~i~  332 (333)
T d1pc3a_         295 LHWAITDGNK--ASFLDQVHFQPLPPAVVKLSDALIATIS  332 (333)
T ss_dssp             HHHHTTGGGS--HHHHHHHTCBCCCHHHHHHHHHHHTTCB
T ss_pred             HHHHHCCCCH--HHHHHHCCCEECCHHHHHHHHHHHHHHC
T ss_conf             9998584147--7778858985799999999999998614


No 2  
>d1ixha_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=0  Score=357.69  Aligned_cols=275  Identities=14%  Similarity=0.167  Sum_probs=218.5

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCC
Q ss_conf             76799980342589999999999987798079998157620578988521013353012133202476787676248787
Q gi|254780707|r   25 RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD  104 (346)
Q Consensus        25 ~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~  104 (346)
                      +.+|+++|||+++|+|+.|+++|++.|+. ++ +|+++|||+|+++||+|.    +|||++||+|+++|++++      .
T Consensus         1 ~~si~~~GSstv~p~~~~~a~~~~~~~~~-~v-~~~~~GSg~G~~~~~~g~----~di~~ssr~~~~~e~~~~------~   68 (321)
T d1ixha_           1 EASLTGAGATFPAPVYAKWADTYQKETGN-KV-NYQGIGSSGGVKQIIANT----VDFGASDAPLSDEKLAQE------G   68 (321)
T ss_dssp             CCEEEEEECSTTHHHHHHHHHHHHHHHCC-EE-EEEECCHHHHHHHHHTTC----SSEEEESSCCCHHHHHHH------T
T ss_pred             CCEEEEECHHHHHHHHHHHHHHHHHHCCC-EE-EEECCCCHHHHHHHHCCC----CEEEEECHHHCHHHHHHC------C
T ss_conf             94499971626999999999999985798-68-997247699999997499----839994731299989665------9


Q ss_pred             CEEEEEECCCCEEEECCCCCC---CCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHC-------CCCCCCCCCEEECCCC
Q ss_conf             246665215412554166654---568888888764102555553236730232310-------0111224503544885
Q gi|254780707|r  105 IQEVTIGHDGILLVSDRDMVS---VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI-------RPDFPEVRIAIYVPSG  174 (346)
Q Consensus       105 ~~~~~v~~d~i~i~~n~~~~~---~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~-------~~~lp~~~I~~~~r~~  174 (346)
                      +.+++++.|++++++|.+|+.   .+|+.+||.+||.           |+|++|+|+       +..|||.||++++|++
T Consensus        69 ~~~~~v~~~~i~~~v~~~n~~~~~l~Lt~~~l~~If~-----------g~It~W~~~~~~~~n~~~~lPd~~I~v~~R~~  137 (321)
T d1ixha_          69 LFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYL-----------GKIKKWDDEAIAKLNPGLKLPSQNIAVVRRAD  137 (321)
T ss_dssp             EEEEEEEEEEEEEEECCTTCCTTCCEECHHHHHHHHT-----------TCCCBTTCHHHHHHCTTCCCCCCBCEEEEESS
T ss_pred             CEEEEEEEEEEEEEECCCCCCCCCCCCCHHHHHHHHC-----------CCCCCCCCCCCCCCCCCCCCCCCCEEEECCCC
T ss_conf             8466898887898752677876434016999744304-----------75544667210014767788875128861788


Q ss_pred             CCCHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHH
Q ss_conf             42357899988513455565410111110136600013444310246640211662367776310153210013320011
Q gi|254780707|r  175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK  254 (346)
Q Consensus       175 ~SGT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~  254 (346)
                      +|||+++|+++++...+.+...       .+        ......+..  ....+.+..+++.+..++++|||++++|+.
T Consensus       138 ~SGT~~~f~~~l~~~~~~~~~~-------~~--------~~~~~~~~~--~~~~~~~~~v~~~V~~~~~aIGy~~~~~~~  200 (321)
T d1ixha_         138 GSGTSFVFTSYLAKVNEEWKNN-------VG--------TGSTVKWPI--GLGGKGNDGIAAFVQRLPGAIGYVEYAYAK  200 (321)
T ss_dssp             CCHHHHHHHHHHHHHCHHHHHH-------TC--------CCSSCCCSS--CEEESHHHHHHHHHHHSTTEEEEEEHHHHH
T ss_pred             CCCHHHHHHHHHHHCCHHHHHC-------CC--------CCCCCCCCC--CCCCCCCCHHHHEEECCCCCEEEEEEEEEC
T ss_conf             8752288999998408444420-------37--------676422122--322323434443133367860565214300


Q ss_pred             HCCCCCCCC---CCCCCCCCHHHHCC---------------------CCCCCEEEEEEEEECCCC--CCCHHHHHHHHHH
Q ss_conf             001110013---44576789556027---------------------987503678999707885--6688999999997
Q gi|254780707|r  255 NNADVLKLV---PIDGIVPSMGTIVS---------------------GLYPISRPLLFYVKRQHF--NSVLGLREYVSFS  308 (346)
Q Consensus       255 ~~~~~~~~~---~~~~v~p~~~~i~~---------------------g~YPl~r~ly~yv~~~~~--~~~~~~~~Fl~~~  308 (346)
                      .+......+   ..+.|.|+.+++..                     ++|||+|++|+|++++..  +..+.+++|++|+
T Consensus       201 ~~~~~~a~~~~~~~~~v~Pt~~~i~~~~~~~~~~~~~~~~~~~~~~~g~YPl~~~~y~~v~~~~~~~~~~~~v~~Fl~~~  280 (321)
T d1ixha_         201 QNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWA  280 (321)
T ss_dssp             TTTCEECEEECTTSCEECCCHHHHHHHTTTCCTTTCSCCCCBSCCSTTCCSBEEEEEEEEESBCSSHHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEECCCCCEECCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             16851378632577423577144300112334455544334678888863234227899974689756789999999999


Q ss_pred             HCHHHCCCCCHHHHCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             49874052202775596348999999999999607
Q gi|254780707|r  309 VSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG  343 (346)
Q Consensus       309 ls~~~~~~~~~~~~~GyvPLp~~~~~~~~~~~~~~  343 (346)
                      +++ +|+   ++.++||||||+++++++++++++.
T Consensus       281 ls~-gq~---~~~~~GyvPLp~~~~~~~~~~~~~~  311 (321)
T d1ixha_         281 YKT-GAK---QANDLDYASLPDSVVEQVRAAWKTN  311 (321)
T ss_dssp             HHH-CHH---HHHHTTCEECCHHHHHHHHHHHHHH
T ss_pred             HHH-HHH---HHHHCCCEECCHHHHHHHHHHHHHH
T ss_conf             875-777---8886998539999999999999975


No 3  
>d2v3qa1 c.94.1.1 (A:1-376) PstS-like phosphate-binding protein {Human (Homo sapiens) [TaxId: 9606]}
Probab=100.00  E-value=0  Score=350.57  Aligned_cols=292  Identities=14%  Similarity=0.136  Sum_probs=222.9

Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHC-------CCCCCCEEECCCCCCHHHHHHHHH
Q ss_conf             7999803425899999999999877980799981576205789885210-------133530121332024767876762
Q gi|254780707|r   27 RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI-------GDDTIDIVNSSRKITQNELDECKK   99 (346)
Q Consensus        27 ~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~-------~~~~~dig~ssr~l~~~E~~~~~~   99 (346)
                      .|+++|||+++|+++.|..     ++++.+ +|+++|||+|+++||+|.       ..+++|||++||||+++|++.+..
T Consensus         1 ~i~gaGat~p~p~~~~~~~-----~~~~~~-~y~~~GSG~G~~~~~~g~~~~~~~~~~~tvdfa~sd~~l~~~E~~~~~~   74 (376)
T d2v3qa1           1 DINGGGATLPQKLYLTPDV-----LTAGFA-PYIGVGSGKGKIAFLENKYNQFGTDTTKNVHWAGSDSKLTATELATYAA   74 (376)
T ss_dssp             CBCEEECSTTHHHHTSTTT-----SCTTBC-CCEECCHHHHHHHHHHTCGGGTCSCTTSCCCEEEESSCCCHHHHHHHHH
T ss_pred             CCEEEEHHHHHHHHHHHHH-----CCCCEE-EEECCCCHHHHHHHHCCCCCCCCCCCCCCCCEEECCCCCCHHHHHHHHH
T ss_conf             9321522279999999876-----359678-9956576899999963886444556546771353477789999988774


Q ss_pred             CCC---CCCEEEEEECCCCEEEECCCCC-CCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCC
Q ss_conf             487---8724666521541255416665-456888888876410255555323673023231001112245035448854
Q gi|254780707|r  100 HGV---SDIQEVTIGHDGILLVSDRDMV-SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK  175 (346)
Q Consensus       100 ~~~---~~~~~~~v~~d~i~i~~n~~~~-~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~  175 (346)
                      .+.   ..++++|++.|+|+++||++++ ..+||.++|.+||           .|+|++|+|+++..|+.+|++++|+++
T Consensus        75 ~~~~~~~~~v~iPv~~~~Iai~~N~~~~~~l~Lt~~~L~~If-----------~G~It~Wnd~~i~~p~~~I~vv~R~d~  143 (376)
T d2v3qa1          75 DKEPGWGKLIQVPSVATSVAIPFRKAGANAVDLSVKELCGVF-----------SGRIADWSGITGAGRSGPIQVVYRAES  143 (376)
T ss_dssp             HTHHHHCCEEEEEEEEEECBCBBCCCCSSCCEECHHHHHHHH-----------HTSCCBGGGSTTSCCCSBCEEEEESSC
T ss_pred             HCCCCCCCEEEEEEEEEEEEEEEECCCCHHHHCCHHHHHHHH-----------CCCCCCCCCCCCCCCCCCCEEEECCCC
T ss_conf             066777862897477644799873476255434799998433-----------376230011354576778547844899


Q ss_pred             CCHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECC--CCHHHHHHHHCCCCCCCCCCCCCHH
Q ss_conf             23578999885134555654101111101366000134443102466402116--6236777631015321001332001
Q gi|254780707|r  176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD--GDYTETLARIEVNKDVFGFVGLSFY  253 (346)
Q Consensus       176 SGT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~--~~~~~~~~~v~~~~~~igy~~~~~~  253 (346)
                      |||+++|++++....+.++.......     .  ...............+...  +....+++.+..++++|||++++|+
T Consensus       144 SGTt~~Ft~~L~~~~~~~~~~~g~~~-----~--~~~~~~~~~~~~~~~~~a~gs~gv~~~v~~~~~~~gaIGY~~~~ya  216 (376)
T d2v3qa1         144 SGTTELFTRFLNAKCTTEPGTFAVTT-----T--FANSYSLGLTPLAGAVAATGSDGVMAALNDTTVAEGRITYISPDFA  216 (376)
T ss_dssp             CHHHHHHHHHHHHHCCSSSSCBCCCS-----C--GGGTBTTCSTTSTTCEEESHHHHHHHHHHCTTSCSCEECCBCHHHH
T ss_pred             CCCHHHHHHHHHHHCCCCCCCCCCCC-----C--HHHHCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEE
T ss_conf             86078889988652755322346431-----0--2332245677677650003573087887540477765444430100


Q ss_pred             HHCCCCCCC--------------CCCCCCCCCHHHHC------------------------------------CCCCCCE
Q ss_conf             100111001--------------34457678955602------------------------------------7987503
Q gi|254780707|r  254 KNNADVLKL--------------VPIDGIVPSMGTIV------------------------------------SGLYPIS  283 (346)
Q Consensus       254 ~~~~~~~~~--------------~~~~~v~p~~~~i~------------------------------------~g~YPl~  283 (346)
                      ..+...+..              ...+.+.|+.+++.                                    +++|||+
T Consensus       217 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~v~pt~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YPI~  296 (376)
T d2v3qa1         217 APTLAGLDDATKVARVGKGVVNGVAVEGKSPAAANVSAAISVVPLPAAADRGNPDVWVPVFGATTGGGVVAYPDSGYPIL  296 (376)
T ss_dssp             SSSGGGGGCTTTBCEECCEEETTEEECCBCCCTHHHHHHHHTCCCCCGGGTTCGGGGSCEEESSCBTTEEECCSSSCSCE
T ss_pred             CCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEC
T ss_conf             02222210333202445300003566621245888997651144554344566532223334322001357888851112


Q ss_pred             EEEEEEEECCCC--CCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             678999707885--668899999999749874052202775596348999999999999607
Q gi|254780707|r  284 RPLLFYVKRQHF--NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG  343 (346)
Q Consensus       284 r~ly~yv~~~~~--~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~~~~~~~~~~~  343 (346)
                      |++|+|++++..  ...+++|+||+|+|++..+++ .++.++||||||+++|+++|+++.+.
T Consensus       297 ~~~y~~~~~~~~~~~~~~~vk~Fl~~~l~~~~~gq-~~~~~~GyvPLp~~~~~~i~~~~~~~  357 (376)
T d2v3qa1         297 GFTNLIFSQCYANATQTGQVRDFFTKHYGTSANND-AAIEANAFVPLPSNWKAAVRASFLTA  357 (376)
T ss_dssp             EEEEEEEESCBSSHHHHHHHHHHHHHHTCSSSSSH-HHHHHTTCBCCCHHHHHHHHHHHTST
T ss_pred             CHHHEEEECCCCCCHHHHHHHHHHHHHHHCCCCHH-HHHHHCCCEECCHHHHHHHHHHHHHC
T ss_conf             11110000236870015999999999860553257-88997897439999999999998622


No 4  
>d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]}
Probab=100.00  E-value=0  Score=296.87  Aligned_cols=248  Identities=23%  Similarity=0.387  Sum_probs=209.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCC
Q ss_conf             67999803425899999999999877980799981576205789885210133530121332024767876762487872
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI  105 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~  105 (346)
                      .+|+|.||++++|+++.|+++|++.||++++ .++..||+.|++++++|.    +||++++|+++++|.+.       .+
T Consensus         1 ~~i~i~GS~s~~~~~~~l~~~f~~~~p~~~v-~v~~~gS~~~~~~l~~g~----~di~~~s~~~~~~e~~~-------~~   68 (249)
T d1twya_           1 SEITISGSTSVARIMDVLAEKYNQQHPETYV-AVQGVGSTAGISLLKKGV----ADIAMTSRYLTESEAQN-------TL   68 (249)
T ss_dssp             CEEEEEECHHHHHHHHHHHHHHHHHCTTCEE-EEEESCHHHHHHHHHTTS----CSEEEESSCCCTTTCCT-------TC
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHHHCCCCEE-EEEECCCHHHHHHHHCCC----CEEEECCCCHHHHHHHC-------CE
T ss_conf             9699995160999999999999988879379-997078579999997599----72552342123454220-------02


Q ss_pred             EEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHHH
Q ss_conf             46665215412554166654568888888764102555553236730232310011122450354488542357899988
Q gi|254780707|r  106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK  185 (346)
Q Consensus       106 ~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~~~  185 (346)
                      ..+++++|++++++|++||..++|.+||.+||.           |++++|+|+++  |+.+|.++.|+++|||+..|.++
T Consensus        69 ~~~~ia~d~lviiv~~~np~~~lt~~ql~~I~~-----------g~i~~W~~~~~--~~~~i~~~~r~~~Sgt~~~f~~~  135 (249)
T d1twya_          69 HTFTLAFDGLAIVVNQANPVTNLTREQLYGIYK-----------GQITNWKQVGG--NDQKIAVVTREASSGTRYSFESL  135 (249)
T ss_dssp             EEEEEEEEEEEEEECTTCCCCEECHHHHHHHHH-----------TSCCBGGGGTS--CSCBCEEEEECTTCHHHHHHHHH
T ss_pred             EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHH-----------HHCCCHHHHCC--CCCCCCEECCCCCCHHHHHHHHH
T ss_conf             457888503012236431112255778876454-----------20021233212--23444200278883089999999


Q ss_pred             HCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCCCC
Q ss_conf             51345556541011111013660001344431024664021166236777631015321001332001100111001344
Q gi|254780707|r  186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI  265 (346)
Q Consensus       186 v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~~~~  265 (346)
                      +............                     .........+.+.++.+.+..++++|||++++++..   .++.+.+
T Consensus       136 ~~~~~~~~~~~~~---------------------~~~~~~~~~~~~~~v~~~v~~~~~aig~~~~~~~~~---~~k~l~i  191 (249)
T d1twya_         136 MGLTKTVKDREVS---------------------DVAPTALVVNSNSMMKTLVNHNTQAVGFISIGSVDK---SVKAIQF  191 (249)
T ss_dssp             HTCEEEETTEEEE---------------------CSCTTSEEESSHHHHHHHHHHCTTEEEEEEGGGCCT---TSEECEE
T ss_pred             HCCCCCCCCCCCC---------------------CCCCEEEEECCCHHHHHHHHCCCCCEEEEEEECCCC---CCHHHHC
T ss_conf             7104321221001---------------------246613884382899999964877507987300236---4023301


Q ss_pred             CCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCC
Q ss_conf             57678955602798750367899970788566889999999974987405220277559634
Q gi|254780707|r  266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIP  327 (346)
Q Consensus       266 ~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvP  327 (346)
                      +++.|+.++|.+|+|||+|++|+|++..+  ..+.+++|++|++|+++|.   ++++.||||
T Consensus       192 ~~~~ps~~~i~~g~YPl~r~~~~~~~~~~--~~~~a~~Fi~f~~S~~gq~---ii~~~G~v~  248 (249)
T d1twya_         192 EKADPTSDNIAKHTYQLSRPFLILHYSDN--ADEQTKEFIAFLKSESAKK---LIVEYGYIM  248 (249)
T ss_dssp             TTBCCCHHHHHTTCSCCEEEEEEEECTTT--CCHHHHHHHHHHHSHHHHH---HHHHTTCBC
T ss_pred             CCCCCCHHHHCCCCCCCEEEEEEEEECCC--CCHHHHHHHHHHHCHHHHH---HHHHCCCCC
T ss_conf             34555433211588872568999997999--9999999999981988899---999679999


No 5  
>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]}
Probab=99.38  E-value=2.3e-11  Score=79.46  Aligned_cols=230  Identities=12%  Similarity=0.098  Sum_probs=117.6

Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCCE
Q ss_conf             79998034258999999999998779807999815762057898852101335301213320247678767624878724
Q gi|254780707|r   27 RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ  106 (346)
Q Consensus        27 ~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~~  106 (346)
                      .|++.+++++.++++.+++.|+++++ +++ .+..+||+..++++..|.   ..|+-.+..+.........  .......
T Consensus         1 el~v~~~~~~~~~~~~l~~~Fe~~tG-i~V-~~~~g~s~~l~~~i~~g~---~~dv~~~~~~~~~~~~~~~--~~~~~~~   73 (231)
T d1atga_           1 ELKVVTATNFLGTLEQLAGQFAKQTG-HAV-VISSGSSGPVYAQIVNGA---PYNVFFSADEKSPEKLDNQ--GFALPGS   73 (231)
T ss_dssp             CEEEEEEGGGHHHHHHHHHHHHHHHC-CCE-EEEEECHHHHHHHHHTTC---CCSEEECSSSHHHHHHHHT--TCBCTTC
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHC-CEE-EEEECCHHHHHHHHHCCC---CCCEEEECCHHHHHHHHHH--CCCCCCC
T ss_conf             97999950469999999999999649-789-999777699999998289---8866875104666665640--1322231


Q ss_pred             EEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHHHH
Q ss_conf             66652154125541666545688888887641025555532367302323100111224503544885423578999885
Q gi|254780707|r  107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV  186 (346)
Q Consensus       107 ~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~~~v  186 (346)
                      ........+++..+...+                          ..++|.++..  |......+..+..+++-..+....
T Consensus        74 ~~~~~~~~~~~~~~~~~~--------------------------~~~~~~~l~~--~~~~~i~~~~p~~~~~g~~~~~~~  125 (231)
T d1atga_          74 RFTYAIGKLVLWSAKPGL--------------------------VDNQGKVLAG--NGWRHIAISNPQIAPYGLAGTQVL  125 (231)
T ss_dssp             CEEEEECCEEEEESSTTT--------------------------SCTTSGGGGS--SSCSCEEEECTTTCHHHHHHHHHH
T ss_pred             CCEECCCCEEEECCCCCC--------------------------CCCCHHHHCC--CCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             000014520000035777--------------------------8976888357--435779995676561468998765


Q ss_pred             CCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             13455565410111110136600013444310246640211662367776310153210013320011001110013445
Q gi|254780707|r  187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID  266 (346)
Q Consensus       187 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~~~~~  266 (346)
                      ......     ...        ...           ..+.......+....+......+++...............  ..
T Consensus       126 ~~~~~~-----~~~--------~~~-----------~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~--~~  179 (231)
T d1atga_         126 THLGLL-----DKL--------TAQ-----------ERIVEANSVGQAHSQTASGAADLGFVALAQIIQAAAKIPG--SH  179 (231)
T ss_dssp             HHTTCH-----HHH--------HHT-----------TCEEEESSHHHHHHHHHTTSSSEEEEEGGGTCCTTSCCSS--EE
T ss_pred             HHHHHH-----HHH--------CCC-----------CEEEECCCCCHHHHHHHCCCHHHHHHHHHHHHHHHCCCCC--EE
T ss_conf             400123-----333--------221-----------0355225430456776516404456677899986334664--24


Q ss_pred             CCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCC
Q ss_conf             767895560279875036789997078856688999999997498740522027755963489
Q gi|254780707|r  267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPIS  329 (346)
Q Consensus       267 ~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp  329 (346)
                      .+.|     .++..|+.+++-+ ++.  ....+..++|++|++|+++|.   ++.+.||. +|
T Consensus       180 ~~~~-----~~~~~~~~~~~~i-~~~--a~~~~~A~~Fidfl~S~e~Q~---i~~~~Gf~-~P  230 (231)
T d1atga_         180 WFPP-----ANYYEPIVQQAVI-TKS--TAEKANAEQFMSWMKGPKAVA---IIKAAGYV-LP  230 (231)
T ss_dssp             ECCC-----GGGSCCCEEEEEE-BTT--CSCHHHHHHHHHHTTSHHHHH---HHHHTTCB-CC
T ss_pred             EEEC-----CCCCEEEEEEEEE-ECC--CCCHHHHHHHHHHHCCHHHHH---HHHHHCCC-CC
T ss_conf             6544-----8886366666999-889--999899999999978999999---99984898-99


No 6  
>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]}
Probab=99.29  E-value=2.6e-10  Score=73.65  Aligned_cols=229  Identities=14%  Similarity=0.145  Sum_probs=116.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCC
Q ss_conf             67999803425899999999999877980799981576205789885210133530121332024767876762487872
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI  105 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~  105 (346)
                      ..|++-+++++.+.++.+++.|++++ +++| .+..+||+..++++.+|..   .| ...++.....+...... .....
T Consensus         1 Gel~vy~a~s~~~~~~~l~~~Fek~~-gi~V-~~~~~~sg~l~~~l~~~~~---~~-~~~~~~~~~~~~~~~~~-~~~~~   73 (231)
T d1amfa_           1 GKITVFAAASLTNAMQDIATQFKKEK-GVDV-VSSFASSSTLARQIEAGAP---AD-LFISADQKWMDYAVDKK-AIDTA   73 (231)
T ss_dssp             CEEEEEEEGGGHHHHHHHHHHHHHHH-CCEE-EEEEECHHHHHHHHHHTCC---CS-EEECSSHHHHHHHHHTT-CBCGG
T ss_pred             CEEEEEEECCHHHHHHHHHHHHHHHH-CCEE-EEEECCHHHHHHHHHHCCC---CE-EEEECCHHHHHHHHHCC-CCCCC
T ss_conf             98999997471999999999998821-9879-9997882999999983898---66-99966334568988605-66766


Q ss_pred             EEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHHH
Q ss_conf             46665215412554166654568888888764102555553236730232310011122450354488542357899988
Q gi|254780707|r  106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK  185 (346)
Q Consensus       106 ~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~~~  185 (346)
                      ..........++.++..+...                   ......++.|.|+..  |.. + .+..+..+++...+...
T Consensus        74 ~~~~~~~~~~~~~~~~~~~~~-------------------~~~~~~~~~~~dl~~--~~~-~-~~~~~~~~~~~~~~~~~  130 (231)
T d1amfa_          74 TRQTLLGNSLVVVAPKASVQK-------------------DFTIDSKTNWTSLLN--GGR-L-AVGDPEHVPAGIYAKEA  130 (231)
T ss_dssp             GCEEEEEECEEEEEETTCCCC-------------------CCCCSTTCCHHHHHT--TCC-E-EEECTTTCHHHHHHHHH
T ss_pred             CCEEEECCCCEEEECCCCCCC-------------------CCCCCCHHHHHHHCC--CCC-E-EEECCCCCHHHHHHHHH
T ss_conf             512320454112210122234-------------------232335778986107--996-8-99889873389999998


Q ss_pred             HCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCCCC
Q ss_conf             51345556541011111013660001344431024664021166236777631015321001332001100111001344
Q gi|254780707|r  186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI  265 (346)
Q Consensus       186 v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~~~~  265 (346)
                      ....+...     ..                     ........+..+....+......+|.........+...    ..
T Consensus       131 ~~~~~~~~-----~~---------------------~~~~~~~~~~~~~~~~~~~g~~~~~i~~~~~~~~~~~~----~~  180 (231)
T d1amfa_         131 LQKLGAWD-----TL---------------------SPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGV----KV  180 (231)
T ss_dssp             HHHTTCHH-----HH---------------------GGGEEEESSHHHHHHHHHTTSSSEEEEEHHHHHHCSSE----EE
T ss_pred             HHHHCCCC-----CC---------------------CCCCCCCCCHHHHHHHHHCCCCEEEEEEHHHHHHCCCC----CC
T ss_conf             88717730-----00---------------------10101133124789999718761998521124531688----70


Q ss_pred             CCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCC
Q ss_conf             5767895560279875036789997078856688999999997498740522027755963
Q gi|254780707|r  266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLI  326 (346)
Q Consensus       266 ~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~Gyv  326 (346)
                      ..+.|.     ++..++.++.. +++..   ..++.++|++|++|+++|.   ++.+.||.
T Consensus       181 ~~~~p~-----~~~~~~~~~~~-i~~~~---~~~~A~~Fi~fl~S~e~Q~---il~~~Gf~  229 (231)
T d1amfa_         181 VATFPE-----DSHKKVEYPVA-VVEGH---NNATVKAFYDYLKGPQAAE---IFKRYGFT  229 (231)
T ss_dssp             EEECCG-----GGSCCEEEEEE-EBTTC---CSHHHHHHHHHHTSHHHHH---HHHHTTCE
T ss_pred             EEEECC-----CCCEEEEEEEE-EECCC---CCHHHHHHHHHHCCHHHHH---HHHHCCEE
T ss_conf             698579-----88437588899-98799---9899999999978999999---99983908


No 7  
>d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]}
Probab=98.81  E-value=1.1e-08  Score=64.56  Aligned_cols=245  Identities=13%  Similarity=0.073  Sum_probs=106.5

Q ss_pred             HHHHHHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCCC------EEEEE
Q ss_conf             99999999999877-980799981576205789885210133530121332024767876762487872------46665
Q gi|254780707|r   38 PYSKIIAENFSEYF-PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI------QEVTI  110 (346)
Q Consensus        38 P~~~~~a~~y~~~~-~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~~------~~~~v  110 (346)
                      .+.....+.|.+++ .++.+ ....+||+...+++.+|.   ..|+..+..+...+.+++.  ..+.+.      ....+
T Consensus        19 ei~~af~~~~~~~tG~~V~v-~~~~~gsg~~~~~i~~g~---~aDV~~~a~~~~~~~l~~~--gll~~~~~~~~~~~~~~   92 (309)
T d1sbpa_          19 QYNKAFSAHWKQETGDNVVI-DQSHGGSGKQATSVINGI---EADTVTLALAYDVNAIAER--GRIDKNWIKRLPDDSAP   92 (309)
T ss_dssp             HHHHHHHHHHHHHHSCEEEE-EEEESCHHHHHHHHHTTC---CCSEEEESSHHHHHHHHHT--TSSCTTGGGGSHHHHCS
T ss_pred             HHHHHHHHHHHHHCCCCEEE-EECCCCHHHHHHHHHCCC---CCCEEEECCHHHHHHHHHC--CCCCCCCHHCCCCCCEE
T ss_conf             99999999987701997799-964786599999997599---9889996778889999977--98553100003556303


Q ss_pred             ECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHHHH----
Q ss_conf             2154125541666545688888887641025555532367302323100111224503544885423578999885----
Q gi|254780707|r  111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV----  186 (346)
Q Consensus       111 ~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~~~v----  186 (346)
                      .....+++++..++.                         .++.|.|+..  |...+....+. .|++...+...+    
T Consensus        93 ~~~~~~~~~~~~~~~-------------------------~~~~w~dL~~--~~~k~~~~~p~-~~~~g~~~~~~~~~~~  144 (309)
T d1sbpa_          93 YTSTIVFLVRKGNPK-------------------------QIHDWNDLIK--PGVSVITPNPK-SSGGARWNYLAAWGYA  144 (309)
T ss_dssp             EEBCEEEEEETTCTT-------------------------CCCSGGGGGS--TTCCEECCCTT-TCHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEECCCCCC-------------------------CCCCHHHHHC--CCCCCCCCCCC-CCCCHHHHHHHHHHHH
T ss_conf             420058997278865-------------------------6540233200--12210123344-6620389999998644


Q ss_pred             CCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             13455565410111110136600013444310246640211662367776310153210013320011001110013445
Q gi|254780707|r  187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID  266 (346)
Q Consensus       187 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~~~~~  266 (346)
                      ........  ....        +....    ... .......+........+......++..................+.
T Consensus       145 ~~~~~~~~--~~~~--------~~~~~----l~~-~~~~~~~~~~~~~~~~v~~Ge~~~~i~~~~~a~~~~~~~~~~~~~  209 (309)
T d1sbpa_         145 LHHNNNDQ--AKAE--------DFVKA----LFK-NVEVLDSGARGSTNTFVERGIGDVLIAWENEALLATNELGKDKFE  209 (309)
T ss_dssp             HHHTTTCH--HHHH--------HHHHH----HHH-TEEECCSSHHHHHHHHHTSCCCSEEEEEHHHHHHHHHTTTTTTEE
T ss_pred             HHCCCCHH--HHHH--------HHHHH----HHC-CCCEECCCCHHHHHHHHHCCCEEEEEEECCHHHHHHHHHCCCCEE
T ss_conf             30254167--8999--------99998----751-474404686789999998597269998411999998764278537


Q ss_pred             CCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             7678955602798750367899970788566889999999974987405220277559634899999999999
Q gi|254780707|r  267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS  339 (346)
Q Consensus       267 ~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~~~~~~~  339 (346)
                      -+.|....  -..||+....-+. +  ......+.++|++|++|+++|.   ++.+.||.|+.+++..+....
T Consensus       210 ~v~p~~~~--~~~~~v~~~~~~~-~--~~~n~~~A~~FidfllS~egQ~---i~~~~G~~P~~~~v~~~~~~~  274 (309)
T d1sbpa_         210 IVTPSESI--LAEPTVSVVDKVV-E--KKDTKAVAEAYLKYLYSPEGQE---IAAKNFYRPRDADVAKKYDDA  274 (309)
T ss_dssp             EECCSEEE--CBCCEEEECHHHH-H--HHTCHHHHHHHHHGGGSHHHHH---HHHHTTCEESCHHHHHHTGGG
T ss_pred             EECCCCCC--CCCCCEEEEEEEC-C--CCCCHHHHHHHHHHHCCHHHHH---HHHHCCCCCCCCCCCHHHHCC
T ss_conf             84688766--6667769997212-6--7888999999999963999999---999859946993304043421


No 8  
>d2onsa1 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]}
Probab=98.60  E-value=3.7e-08  Score=61.66  Aligned_cols=56  Identities=16%  Similarity=0.295  Sum_probs=43.2

Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEEC
Q ss_conf             79998034258999999999998779807999815762057898852101335301213
Q gi|254780707|r   27 RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS   85 (346)
Q Consensus        27 ~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~s   85 (346)
                      +|++-.+++..+.++.++++|+++||+++| .++..+++..+++++++.  ...|+...
T Consensus         3 ~L~v~~ags~~~~~~~~~~~Fe~~~P~I~V-~~~~~~~~~~~~~~~a~g--~~pDv~~~   58 (311)
T d2onsa1           3 KLKVFHAGSLTEPMKAFKRAFEEKHPNVEV-QTEAAGSAATIRKVTELG--RKADVIAT   58 (311)
T ss_dssp             EEEEEEEGGGHHHHHHHHHHHHHHCTTEEE-EEEEECHHHHHHHHHTSC--CCCSEEEE
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHCCCCEE-EEEECCCHHHHHHHHHCC--CCCCEEEE
T ss_conf             999996158299999999999988859189-999688199999999679--99998998


No 9  
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]}
Probab=98.08  E-value=9e-05  Score=42.79  Aligned_cols=97  Identities=11%  Similarity=0.108  Sum_probs=51.4

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECC-CC-CCHHH----------
Q ss_conf             6799980342589999999999987798079998157620578988521013353012133-20-24767----------
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS-RK-ITQNE----------   93 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ss-r~-l~~~E----------   93 (346)
                      +.+.+--+ .-.++++.+.+.|++++ |++|. +...+|+.-+.++.........|+..+. .. +...+          
T Consensus         4 ~~lvvYs~-~~~~~~~~ii~~Fek~t-GI~V~-~~~~~s~~l~~ki~aeg~~~~~Dv~~~~d~~~~~~~~~~~l~~~~~~   80 (311)
T d1xvxa_           4 SGIVVYNA-QHENLVKSWVDGFTKDT-GIKVT-LRNGGDSELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDA   80 (311)
T ss_dssp             SCEEEEEC-SCHHHHHHHHHHHHHHH-CCCEE-EEECCHHHHHHHHHHHGGGCCCSEEEESSSHHHHHHHHTTCBCCCCH
T ss_pred             CEEEEEEC-CCHHHHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHCCCCCCCCC
T ss_conf             70999979-88779999999998866-98899-99898599999999747899987899787899998875586222233


Q ss_pred             --HHHHHHC-CCCCCEEEEEECCCCEEEECCCCCC
Q ss_conf             --8767624-8787246665215412554166654
Q gi|254780707|r   94 --LDECKKH-GVSDIQEVTIGHDGILLVSDRDMVS  125 (346)
Q Consensus        94 --~~~~~~~-~~~~~~~~~v~~d~i~i~~n~~~~~  125 (346)
                        ....... ....-.-+++.....++++|.+...
T Consensus        81 ~~~~~i~~~~~d~~~~~~~~~~~~~~i~yn~~~~~  115 (311)
T d1xvxa_          81 VTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEKIS  115 (311)
T ss_dssp             HHHHHBCGGGSCSSSSCEEEEEEEEEEEECTTTSC
T ss_pred             CCCCCCCCCCCCCCCCEEEEEECEEEEEEECCCCC
T ss_conf             33223552100347812221003289998611045


No 10 
>d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]}
Probab=97.99  E-value=0.00032  Score=39.71  Aligned_cols=201  Identities=12%  Similarity=0.078  Sum_probs=117.6

Q ss_pred             CCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCC
Q ss_conf             376799980342589-9999999999877980799981576205789885210133530121332024767876762487
Q gi|254780707|r   24 ARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV  102 (346)
Q Consensus        24 a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~  102 (346)
                      ..++|+|+-+.+... ++..+...|.+.||++++. +....+..-.+.+.+|.    +|+|.+..+....          
T Consensus         4 ~sG~l~i~~~~~~~~~~Lp~~l~~f~~~~P~i~l~-i~~~~~~~~~~~l~~g~----~Di~i~~~~~~~~----------   68 (220)
T d2fyia1           4 TSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLE-LIQGTPQEIATLLQNGE----ADIGIASERLSND----------   68 (220)
T ss_dssp             CCEEEEEEECHHHHHHTHHHHHHHHHHHCTTEEEE-EEECCHHHHHHHHHHTS----CSEEEESSSSTTC----------
T ss_pred             CCEEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCCHHHHHHHHHHH----HHHHHHCCCCCCC----------
T ss_conf             97889999878999999999999999988895899-99887088999987634----3333200111222----------


Q ss_pred             CCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHH
Q ss_conf             87246665215412554166654568888888764102555553236730232310011122450354488542357899
Q gi|254780707|r  103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL  182 (346)
Q Consensus       103 ~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F  182 (346)
                      ..+...++..+.++++...+.+....                      +...|.|+    .+.|+..+  .++++.+..+
T Consensus        69 ~~~~~~~l~~~~~~~v~~~~~~~~~~----------------------~~~~~~dL----~~~~~i~~--~~~~~~~~~~  120 (220)
T d2fyia1          69 PQLVAFPWFRWHHSLLVPHDHPLTQI----------------------SPLTLESI----AKWPLITY--RQGITGRSRI  120 (220)
T ss_dssp             TTEEEEEEEEECEEEEEETTCGGGTS----------------------SSCCHHHH----TTSCEEEE--CTTSTTHHHH
T ss_pred             CCCCCCCCCCCCCEEECCCCCCCCCC----------------------CCCHHHHH----CCCCCCCC--CCCCCHHHHH
T ss_conf             21112332233321442565443445----------------------75202332----00123322--2343158899


Q ss_pred             HHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHC-CCCCC
Q ss_conf             98851345556541011111013660001344431024664021166236777631015321001332001100-11100
Q gi|254780707|r  183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN-ADVLK  261 (346)
Q Consensus       183 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~-~~~~~  261 (346)
                      .+.....+...                             ...-..++...+...+... .+++.++...+... ...+.
T Consensus       121 ~~~~~~~~~~~-----------------------------~~~~~~~~~~~~~~~v~~g-~gi~ilp~~~~~~~~~~~l~  170 (220)
T d2fyia1         121 DDAFARKGLLA-----------------------------DIVLSAQDSDVIKTYVALG-LGIGLVAEQSSGEQEEENLI  170 (220)
T ss_dssp             HHHHHHTTCCC-----------------------------CEEEEESSHHHHHHHHHHT-SCEEEEEGGGGSTTCCTTEE
T ss_pred             HHHHHHCCCCC-----------------------------CEEEEECCHHHHHHHHHHC-CEEEECCHHHHHHHHCCCEE
T ss_conf             88776404677-----------------------------6147870478889987633-56886769999987448879


Q ss_pred             CCCCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             1344576789556027987503678999707885668899999999749
Q gi|254780707|r  262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS  310 (346)
Q Consensus       262 ~~~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls  310 (346)
                      .+      |      ....+..+.+|++.++ +....+.++.|++|+-.
T Consensus       171 ~l------~------~~~~~~~~~~~l~~~~-~~~~~~~~~~Fi~~~~~  206 (220)
T d2fyia1         171 RL------D------TRHLFDANTVWLGLKR-GQLQRNYVWRFLELCNA  206 (220)
T ss_dssp             EE------C------CTTTSCCEEEEEEEET-TCCBCHHHHHHHHHHCS
T ss_pred             EE------E------CCCCCCCEEEEEEEEC-CCCCCHHHHHHHHHHHH
T ss_conf             98------5------7787774089999979-88689999999999987


No 11 
>d1nnfa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]}
Probab=97.85  E-value=0.00028  Score=40.08  Aligned_cols=48  Identities=15%  Similarity=0.108  Sum_probs=32.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEEC
Q ss_conf             58999999999998779807999815762057898852101335301213
Q gi|254780707|r   36 LFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS   85 (346)
Q Consensus        36 ~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~s   85 (346)
                      ...+++.+.+.|++++ |++|. +...+|+.-+.++.+...+..+|+..+
T Consensus         9 ~~~~~~~l~~~Fek~t-GIkV~-~~~~~~~~~~~kl~ae~~~~~~DV~~~   56 (308)
T d1nnfa_           9 QKEAATAVAKAFEQET-GIKVT-LNSGKSEQLAGQLKEEGDKTPADVFYT   56 (308)
T ss_dssp             CHHHHHHHHHHHHHHS-CCCEE-EEECCHHHHHHHHHHHGGGCCCSEEEE
T ss_pred             CHHHHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             8779999999998855-98799-997981999999997468999888997


No 12 
>d1ixca2 c.94.1.1 (A:90-294) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]}
Probab=97.60  E-value=0.0014  Score=36.09  Aligned_cols=198  Identities=14%  Similarity=0.096  Sum_probs=110.4

Q ss_pred             CEEEEEECCH-HHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCC
Q ss_conf             6799980342-589999999999987798079998157620578988521013353012133202476787676248787
Q gi|254780707|r   26 NRIRIAGSST-LFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD  104 (346)
Q Consensus        26 ~~I~i~GSst-~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~  104 (346)
                      ++|+|+-+++ ...++..+..+|.+.||++++. +....+..-++.+.+|.    +|++....+.....           
T Consensus         2 G~lrIg~~~~~~~~~Lp~~l~~f~~~~P~v~l~-i~~~~~~~l~~~l~~g~----~D~~~~~~~~~~~~-----------   65 (205)
T d1ixca2           2 GELSVAYFGTPIYRSLPLLLRAFLTSTPTATVS-LTHMTKDEQVEGLLAGT----IHVGFSRFFPRHPG-----------   65 (205)
T ss_dssp             EEEEEEECSGGGGTHHHHHHHHHHHHCTTEEEE-EEECCHHHHHHHHHHTS----CSEEEESCCCCCTT-----------
T ss_pred             EEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCCCCCHHHHHHHH----CCCCCCCCCCCCCH-----------
T ss_conf             689999896889999999999999988796899-99887744201102222----03221235443200-----------


Q ss_pred             CEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHHH
Q ss_conf             24666521541255416665456888888876410255555323673023231001112245035448854235789998
Q gi|254780707|r  105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK  184 (346)
Q Consensus       105 ~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~~  184 (346)
                      ............++.....+....                      +...+.+    +...+...+.+..++..++.+..
T Consensus        66 ~~~~~~~~~~~~~~~~~~~~~~~~----------------------~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~  119 (205)
T d1ixca2          66 IEIVNIAQEDLYLAVHRSQSGKFG----------------------KTCKLAD----LRAVELTLFPRGGRPSFADEVIG  119 (205)
T ss_dssp             EEEEEEEEEEEEEEEEGGGGGGTC----------------------SEECGGG----GTTCEEEECCCSSSSCHHHHHHH
T ss_pred             HEEEECCCCCCCCCCCCCCCCCCC----------------------CCCCCCC----CCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             000001212222232222222222----------------------2222220----02576410013666412444333


Q ss_pred             HHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCCC
Q ss_conf             85134555654101111101366000134443102466402116623677763101532100133200110011100134
Q gi|254780707|r  185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP  264 (346)
Q Consensus       185 ~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~~~  264 (346)
                      .....+...                             ......++...+.+.+. ...+++.++..........+..++
T Consensus       120 ~~~~~~~~~-----------------------------~~~~~~~~~~~~~~~v~-~g~gi~~lp~~~~~~~~~~l~~~~  169 (205)
T d1ixca2         120 LFKHAGIEP-----------------------------RIARVVEDATAALALTM-AGAASSIVPASVAAIRWPDIAFAR  169 (205)
T ss_dssp             HHHHTTCCC-----------------------------EEEEECSSHHHHHHHHH-TTSCBEEEEHHHHTSCCTTEEEEE
T ss_pred             HHHHCCCCC-----------------------------CCCCCCCCHHHHHHHCC-CCCEEEECCHHHHHCCCCCEEEEE
T ss_conf             332102222-----------------------------22222220256665314-464599851888701369889998


Q ss_pred             CCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             457678955602798750367899970788566889999999974
Q gi|254780707|r  265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSV  309 (346)
Q Consensus       265 ~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~l  309 (346)
                      ++            .-++.+++|++..+++  ..+.+++|++++.
T Consensus       170 l~------------~~~~~~~~~l~~~~~~--~~p~~~~fi~~l~  200 (205)
T d1ixca2         170 IV------------GTRVKVPISCIFRKEK--QPPILARFVEHVR  200 (205)
T ss_dssp             EC------------CTTCEEEEEEEEESSS--CCHHHHHHHHHHH
T ss_pred             CC------------CCCCEEEEEEEEECCC--CCHHHHHHHHHHH
T ss_conf             88------------9984469999997999--9999999999999


No 13 
>d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type protein CysB {Klebsiella aerogenes [TaxId: 28451]}
Probab=97.55  E-value=0.0017  Score=35.70  Aligned_cols=201  Identities=10%  Similarity=0.041  Sum_probs=112.4

Q ss_pred             CCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             76799980342589-99999999998779807999815762057898852101335301213320247678767624878
Q gi|254780707|r   25 RNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS  103 (346)
Q Consensus        25 ~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~  103 (346)
                      +++|+|+-+.++.. ++-..-.+|.+.||++++. +....|..-++.+.+|.    +|||....+....          .
T Consensus         5 ~G~LrIg~~~~~~~~~LP~~l~~f~~~~P~v~v~-l~~~~~~~l~~~l~~g~----~D~ai~~~~~~~~----------~   69 (237)
T d1al3a_           5 KGSLYVATTHTQARYALPGVIKGFIERYPRVSLH-MHQGSPTQIAEAVSKGN----ADFAIATEALHLY----------D   69 (237)
T ss_dssp             EEEEEEEECHHHHHHTSHHHHHHHHHHCTEEEEE-EEECCHHHHHHHHHTTC----CSEEEESSCCCTT----------S
T ss_pred             CEEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCHHHHHHHHHCCC----CCEEEEEECCCCC----------C
T ss_conf             6789999678899999999999999988891899-99898799999974337----7689996033333----------3


Q ss_pred             CCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHHHH
Q ss_conf             72466652154125541666545688888887641025555532367302323100111224503544885423578999
Q gi|254780707|r  104 DIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE  183 (346)
Q Consensus       104 ~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~F~  183 (346)
                      .+...++..+..++++.++.+....                      +...|.|+    .+.|+..+  +.+++.+..+.
T Consensus        70 ~l~~~~l~~~~~~~v~~~~h~la~~----------------------~~~~~~dL----~~~p~i~~--~~~~~~~~~~~  121 (237)
T d1al3a_          70 DLVMLPCYHWNRSIVVTPEHPLATK----------------------GSVSIEEL----AQYPLVTY--TFGFTGRSELD  121 (237)
T ss_dssp             CEEEEEEEEECEEEEECTTSTTTTT----------------------SCCCHHHH----HTSEEEEE--CTTSTTHHHHH
T ss_pred             CCCCCCCCCCEEEEEEECCCCCCCC----------------------CCCCCHHH----CCCCCCCC--CCCCHHHHHHH
T ss_conf             3334555432389999557311002----------------------34321021----15883011--34450799999


Q ss_pred             HHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCC
Q ss_conf             88513455565410111110136600013444310246640211662367776310153210013320011001110013
Q gi|254780707|r  184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV  263 (346)
Q Consensus       184 ~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~~~~  263 (346)
                      +.....+...                             ......++...+.+.+ ....+++.++...+..    ..  
T Consensus       122 ~~~~~~g~~~-----------------------------~~~~~~~s~~~~~~~v-~~g~Gi~~~p~~~v~~----~~--  165 (237)
T d1al3a_         122 TAFNRAGLTP-----------------------------RIVFTATDADVIKTYV-RLGLGVGVIASMAVDP----VS--  165 (237)
T ss_dssp             HHHHHHTCCC-----------------------------EEEEEESSHHHHHHHH-HHTSCEEEEEGGGCCT----TT--
T ss_pred             HHHHHCCCCC-----------------------------CCEEECCCHHHHHHHH-CCCCEEEECHHHHHHH----HH--
T ss_conf             9999728987-----------------------------4005349999999974-0798787656986326----63--


Q ss_pred             CCCCCCCCHHHHCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             44576789556027987503678999707885668899999999749
Q gi|254780707|r  264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS  310 (346)
Q Consensus       264 ~~~~v~p~~~~i~~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls  310 (346)
                           .+..-.+.-......+.+|+++.+. ....+.+++|++++..
T Consensus       166 -----~~~l~~~~~~~~~~~~~~~l~~~~~-~~l~~~~~~Fie~~~~  206 (237)
T d1al3a_         166 -----DPDLVKLDANGIFSHSTTKIGFRRS-TFLRSYMYDFIQRFAP  206 (237)
T ss_dssp             -----CTTSEEEECBTTBCCEEEEEEEETT-CCCCHHHHHHHHHHCT
T ss_pred             -----CCCEEEEECCCCCCCEEEEEEEECC-CCCCHHHHHHHHHHHH
T ss_conf             -----8987999787887631899999698-8569999999999998


No 14 
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]}
Probab=97.43  E-value=0.0022  Score=35.05  Aligned_cols=92  Identities=12%  Similarity=0.026  Sum_probs=47.0

Q ss_pred             CEEEEEE-CCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHH-HHHHHHHHCCCCCCCEEECCCCCCHHHHHHH------
Q ss_conf             6799980-3425899999999999877980799981576205-7898852101335301213320247678767------
Q gi|254780707|r   26 NRIRIAG-SSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV-GLKEFCRGIGDDTIDIVNSSRKITQNELDEC------   97 (346)
Q Consensus        26 ~~I~i~G-Sst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~-Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~------   97 (346)
                      ++|+.-+ +..+   .+.+.++|+++| +++|. +...+++. -..++.++. +...|+...+-..-..-.+..      
T Consensus         2 ~~l~~~~w~~~~---~~~ii~~Fe~~t-gI~V~-~~~~~~~~~~~~~l~a~~-~~~~Dvv~~~~~~~~~~~~~g~~~~ld   75 (322)
T d1pota_           2 NTLYFYNWTEYV---PPGLLEQFTKET-GIKVI-YSTYESNETMYAKLKTYK-DGAYDLVVPSTYYVDKMRKEGMIQKID   75 (322)
T ss_dssp             EEEEEEEESSSS---CTTHHHHHHHHH-CEEEE-EEEESCHHHHHHHHTTCS-SSCSSBBCCBGGGHHHHHHHTCBCCCC
T ss_pred             CEEEEEECCCCC---CHHHHHHHHHHH-CCEEE-EEECCCHHHHHHHHHHCC-CCCCEEEEECHHHHHHHHHCCCCCCCC
T ss_conf             979999577636---989999999996-98799-995799999999998069-999809996807999987678523366


Q ss_pred             --------------HH--CCCCCCEEEEEECCCCEEEECCCC
Q ss_conf             --------------62--487872466652154125541666
Q gi|254780707|r   98 --------------KK--HGVSDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus        98 --------------~~--~~~~~~~~~~v~~d~i~i~~n~~~  123 (346)
                                    ..  ........+|+..+..++++|.+.
T Consensus        76 ~~~~~~~~~~~~~~~~~~~~~g~~~~~P~~~~~~~l~Yn~~~  117 (322)
T d1pota_          76 KSKLTNFSNLDPDMLNKPFDPNNDYSIPYIWGATAIGVNGDA  117 (322)
T ss_dssp             TTSCTTGGGBCGGGSCCTTSTTCSSCEEEEEEEEEEEEETTT
T ss_pred             HHHCCHHHCCCHHHHCCCCCCCCCEEEEEEEEEEEEEEHHHH
T ss_conf             222000210486652144589983684466423346742544


No 15 
>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]}
Probab=97.41  E-value=0.00082  Score=37.44  Aligned_cols=128  Identities=14%  Similarity=0.151  Sum_probs=66.7

Q ss_pred             EEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCC--------------CHHH
Q ss_conf             99980342589999999999987798079998157620578988521013353012133202--------------4767
Q gi|254780707|r   28 IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI--------------TQNE   93 (346)
Q Consensus        28 I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l--------------~~~E   93 (346)
                      |+|-.+.. +-..+.+.++|++++ |++|. +...+|+.-+.++.+...+...|+..++..-              ....
T Consensus         3 v~iy~~~~-~~~~~~i~~~Fek~t-GIkV~-~~~~~~~~~~~kl~ae~~~~~~Dv~~~~~~~~~~~~~~~~~~~~~~~~~   79 (317)
T d1y4ta_           3 LNIYSARH-YNADFEIIKKFEEKT-GIKVN-HTQAKASELIKRLSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKY   79 (317)
T ss_dssp             EEEEECCC-CTHHHHHHHHHHHHH-CCCEE-EEECCHHHHHHHHHHHGGGCCCCEEEESSHHHHHHHHHTTCEECCCCHH
T ss_pred             EEEEECCC-CCHHHHHHHHHHHHH-CCEEE-EEECCCHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHCCCCCCCCC
T ss_conf             89984898-450799999999986-98899-9979829999999974899997099968789999987631035433210


Q ss_pred             HHHHH--HCCCCCCEEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEC
Q ss_conf             87676--2487872466652154125541666545688888887641025555532367302323100111224503544
Q gi|254780707|r   94 LDECK--KHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV  171 (346)
Q Consensus        94 ~~~~~--~~~~~~~~~~~v~~d~i~i~~n~~~~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~  171 (346)
                      .....  ..........++.....++++|++..                      ....+.++|.|+--  |...-.+..
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~yn~~~~----------------------~~~~~p~tw~dL~~--~~~~~~~~~  135 (317)
T d1y4ta_          80 LEEFIPAHLRDKDKEWFAITKRARIIAYNKNTN----------------------IDISKMKNYEDLAK--AEFKGEIVM  135 (317)
T ss_dssp             HHHHSCGGGBCTTSSCEEEEEEEEEEEEETTSC----------------------CCCTTCCSGGGGGC--GGGTTCEEC
T ss_pred             HHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCC----------------------CCCCCCCCHHHHCC--CCCCCCEEE
T ss_conf             232031665411235555432344432333321----------------------24668888788503--000472443


Q ss_pred             CCCCCCHHHHH
Q ss_conf             88542357899
Q gi|254780707|r  172 PSGKHGTREVL  182 (346)
Q Consensus       172 r~~~SGT~~~F  182 (346)
                      ....+++...+
T Consensus       136 ~~~~~~~~~~~  146 (317)
T d1y4ta_         136 RSATAPYSKTL  146 (317)
T ss_dssp             CCTTSHHHHHH
T ss_pred             ECCCCHHHHHH
T ss_conf             02440267788


No 16 
>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]}
Probab=96.66  E-value=0.014  Score=30.63  Aligned_cols=94  Identities=11%  Similarity=0.029  Sum_probs=46.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCH--------------
Q ss_conf             679998034258999999999998779807999815762057898852101335301213320247--------------
Q gi|254780707|r   26 NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ--------------   91 (346)
Q Consensus        26 ~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~--------------   91 (346)
                      +.|++=.+. -.-+.+.+.+.|++++ |++|. +...+++-.-+...+| .....|+........-              
T Consensus         2 ~ev~vY~~~-~~~~~~~l~~~Fek~t-GIkV~-~~~~~~~~~~kl~~e~-~~~~~Dvv~~~~~~~~~~~~~~g~~~~~~~   77 (318)
T d1q35a_           2 NEVNVYSYR-QPYLIEPMLKNFEKDT-GIKVN-IIFADKGLVDRVKQEG-ELSPADVLLTVDISRVMEIVNADLAQKIDS   77 (318)
T ss_dssp             CEEEEEESS-CGGGTHHHHHHHHHHH-CCEEE-EEECC-CCHHHHHHHG-GGCCCCEEEESCHHHHHHHHHTTCBCCCCC
T ss_pred             CEEEEEECC-CHHHHHHHHHHHHHHH-CCEEE-EEECCHHHHHHHHHCC-CCCCCCEEEECCHHHHHHHHHCCCCCCCCC
T ss_conf             859999698-8768999999998866-97899-9979889999999647-899998999788899999986375112574


Q ss_pred             HHHHHHH--HCCCCCCEEEEEECCCCEEEECCCC
Q ss_conf             6787676--2487872466652154125541666
Q gi|254780707|r   92 NELDECK--KHGVSDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus        92 ~E~~~~~--~~~~~~~~~~~v~~d~i~i~~n~~~  123 (346)
                      ..+....  .........+++....+++++|.+-
T Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~yN~~~  111 (318)
T d1q35a_          78 KVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDR  111 (318)
T ss_dssp             HHHHHHSCGGGBCTTSSCEEEEEEEEEEEEETTT
T ss_pred             HHHHHHCHHHHHHCCCCCCCCCCEEEEEEECHHH
T ss_conf             5544313166542132210022203788732545


No 17 
>d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]}
Probab=96.65  E-value=0.014  Score=30.58  Aligned_cols=84  Identities=18%  Similarity=0.152  Sum_probs=62.1

Q ss_pred             CEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCC
Q ss_conf             6799980342589-999999999987798079998157620578988521013353012133202476787676248787
Q gi|254780707|r   26 NRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD  104 (346)
Q Consensus        26 ~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~  104 (346)
                      ++|+|+-+.++.+ ++..+-..|.++||++++. +....|..-+..+.+|.    .|++....+....+           
T Consensus         5 G~lrig~~~~~~~~~lp~~l~~f~~~~P~v~l~-i~~~~~~~~~~~l~~~~----~d~~~~~~~~~~~~-----------   68 (212)
T d1i6aa_           5 GPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMY-LHEAQTHQLLAQLDSGK----LDAVILALVKESEA-----------   68 (212)
T ss_dssp             EEEEEEECTTTHHHHHHHHHHHHHHHCTTEEEE-EEECCHHHHHHHHHHTS----CSEEEEECCGGGTT-----------
T ss_pred             EEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCCCCCCCCCCCCC----HHHHHEECCCCCCC-----------
T ss_conf             899998377899999999999999988896899-99887755322232210----00000001112232-----------


Q ss_pred             CEEEEEECCCCEEEECCCCCC
Q ss_conf             246665215412554166654
Q gi|254780707|r  105 IQEVTIGHDGILLVSDRDMVS  125 (346)
Q Consensus       105 ~~~~~v~~d~i~i~~n~~~~~  125 (346)
                      +...++..+...++..++.+.
T Consensus        69 ~~~~~l~~~~~~~~~~~~hpl   89 (212)
T d1i6aa_          69 FIEVPLFDEPMLLAIYEDHPW   89 (212)
T ss_dssp             SEEEEEEEEEEEEEEETTSGG
T ss_pred             CCCEECCCCCEEEEEECCCHH
T ss_conf             120111222257875037721


No 18 
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]}
Probab=96.43  E-value=0.02  Score=29.76  Aligned_cols=93  Identities=12%  Similarity=0.184  Sum_probs=50.9

Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHH-HH-----HHHHHHCCCCCCCEEECCC-------------
Q ss_conf             7999803425899999999999877980799981576205-78-----9885210133530121332-------------
Q gi|254780707|r   27 RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV-GL-----KEFCRGIGDDTIDIVNSSR-------------   87 (346)
Q Consensus        27 ~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~-Gi-----~~~~~G~~~~~~dig~ssr-------------   87 (346)
                      ++.+.|...-..+++.+.++|+++||+++|. ++..+.+. ..     .+..+|.  ...||...+.             
T Consensus         7 ~~~~~g~p~~~~~~~~~i~~F~~~~p~i~V~-~~~~~~~~~~~~~~~~~~~~a~g--~~PDi~~~~~~~~~~~~~~g~l~   83 (407)
T d1eu8a_           7 VFAVGGAPNEIEYWKGVIAEFEKKYPGVTVE-LKRQATDTEQRRLDLVNALRGKS--SDPDVFLMDVAWLGQFIASGWLE   83 (407)
T ss_dssp             EEEECCSHHHHHHHHHHHHHHHHHSTTCEEE-EEECCSSHHHHHHHHHHHHTTTC--SSEEEEEEETTTHHHHHHHTCBC
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHCCCEEEE-EEECCCCHHHHHHHHHHHHHHCC--CCCEEEEECHHHHHHHHHCCCCC
T ss_conf             9997897669999999999999888691899-99736845999999999998289--99879998948899999879933


Q ss_pred             CCCHH--------------HHHHHHHCCCCCCEEEEEECCCCEEEECCCC
Q ss_conf             02476--------------7876762487872466652154125541666
Q gi|254780707|r   88 KITQN--------------ELDECKKHGVSDIQEVTIGHDGILLVSDRDM  123 (346)
Q Consensus        88 ~l~~~--------------E~~~~~~~~~~~~~~~~v~~d~i~i~~n~~~  123 (346)
                      +|++-              .++.+... ...+-.+|......++.+|++.
T Consensus        84 dL~~~~~~~~~~~~~~~~~~~~~~~~~-dG~~y~iP~~~~~~~~~yNkdl  132 (407)
T d1eu8a_          84 PLDDYVQKDNYDLSVFFQSVINLADKQ-GGKLYALPVYIDAGLLYYRKDL  132 (407)
T ss_dssp             CSHHHHHHHTCCGGGBCHHHHHHHTEE-TTEECCEEEEEEECEEEEEHHH
T ss_pred             CCCHHHHHCCHHHHHHCHHHHHHHHCC-CCEEECCCCCHHHHHHHCCCHH
T ss_conf             385765531132554048899875134-5423027630123455416125


No 19 
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]}
Probab=96.26  E-value=0.025  Score=29.21  Aligned_cols=108  Identities=16%  Similarity=0.235  Sum_probs=54.3

Q ss_pred             CCEEEE-E-ECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCH-HHHHHHH-HHCCCCCCCEEECCCC------------
Q ss_conf             767999-8-0342589999999999987798079998157620-5789885-2101335301213320------------
Q gi|254780707|r   25 RNRIRI-A-GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS-VGLKEFC-RGIGDDTIDIVNSSRK------------   88 (346)
Q Consensus        25 ~~~I~i-~-GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg-~Gi~~~~-~G~~~~~~dig~ssr~------------   88 (346)
                      ...|++ . .+..-...++.+.++|+++||+++|. +...++- .-++..+ +|.   ..||...+..            
T Consensus         5 eg~i~~W~~~~~~~~~~~~~~~~~F~~~~p~I~v~-~~~~~~~~~~l~~~~~~g~---~pDi~~~~~~~~~~~~~~g~l~   80 (380)
T d1elja_           5 EGKVVIWHAMQPNELEVFQSLAEEYMALCPEVEIV-FEQKPNLEDALKAAIPTGQ---GPDLFIWAHDWIGKFAEAGLLE   80 (380)
T ss_dssp             CEEEEEEECCCHHHHHHHHHHHHHHHHHCTTEEEE-EEECTTHHHHHHHHTTTTC---SCSEEEEEGGGHHHHHHTTCBC
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHCCCEEEE-EEECCCHHHHHHHHHHCCC---CCEEEEECCHHHHHHHHCCCCC
T ss_conf             63899995898038999999999999878397999-9868999999999997699---9819999937799999879963


Q ss_pred             -CCH---HHH-HH----HHH--CCCCCCEEEEEECCCCEEEECCCCCCC-CCCHHHHHHH
Q ss_conf             -247---678-76----762--487872466652154125541666545-6888888876
Q gi|254780707|r   89 -ITQ---NEL-DE----CKK--HGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKA  136 (346)
Q Consensus        89 -l~~---~E~-~~----~~~--~~~~~~~~~~v~~d~i~i~~n~~~~~~-~lt~~~l~~~  136 (346)
                       +++   .+. +.    ...  .....+-.+|...+..++++|++.... -.|-+++...
T Consensus        81 ~l~~~~~~~~~~~~~~~~~~~~~~dG~~y~~P~~~~~~~l~ynkd~~~~~P~T~~e~~~~  140 (380)
T d1elja_          81 PIDEYVTEDLLNEFAPMAQDAMQYKGHYYALPFAAETVAIIYNKEMVSEPPKTFDEMKAI  140 (380)
T ss_dssp             CCTTTCCHHHHTTBCHHHHHHTEETTEECEEEEEEEECEEEEETTTCSSCCSSHHHHHHH
T ss_pred             CCCHHHHHCCCCCCCHHHHHHEEECCEECCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             086654002211121666641034543011222221035666666764213328999999


No 20 
>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]}
Probab=96.25  E-value=0.019  Score=29.85  Aligned_cols=46  Identities=11%  Similarity=0.019  Sum_probs=28.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCC
Q ss_conf             9999999999877980799981576205789885210133530121332
Q gi|254780707|r   39 YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR   87 (346)
Q Consensus        39 ~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr   87 (346)
                      +++.+.+.|++++ |++|..+. .+++ =+.++.+...+...|+-.++.
T Consensus        13 ~~~~li~~Fek~t-GIkV~~~~-~~~~-~~~kl~ae~~~~~~DVv~~~~   58 (318)
T d1y9ua_          13 LIQPLLDAFAKDS-GIKVNTVF-VKDG-LLERVRAEGDKSPADVLMTVD   58 (318)
T ss_dssp             GTHHHHHHHHHHH-CCEEEEEE-CSSC-HHHHHHHHGGGCCCCEEEEES
T ss_pred             HHHHHHHHHHHHH-CCEEEEEE-CCHH-HHHHHHHCCCCCCCCEEEECC
T ss_conf             8999999998866-98899997-9889-999999657899988899687


No 21 
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]}
Probab=96.16  E-value=0.019  Score=29.79  Aligned_cols=50  Identities=8%  Similarity=-0.059  Sum_probs=31.0

Q ss_pred             CCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCC
Q ss_conf             79875036789997078856688999999997498740522027755963489
Q gi|254780707|r  277 SGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPIS  329 (346)
Q Consensus       277 ~g~YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp  329 (346)
                      .+.++..-...+.+++.. ...++.++|++|++|.+.|..  .+...|..+.|
T Consensus       255 ~~~~~~~~~~~~~i~~~s-~~~e~A~~fi~fl~s~e~~~~--~~~~~g~~~~~  304 (362)
T d3thia_         255 GQDIPLFYSDVVSVNSKT-AHPELAKKLANVMASADTVEQ--ALRPQADGQYP  304 (362)
T ss_dssp             SCCCCEEEEEEEEEETTC-SCHHHHHHHHHHHHSHHHHHH--HHSCCSTTCCC
T ss_pred             CCCCCCCCCCCEEEECCC-CCHHHHHHHHHHHCCHHHHHH--HHHHCCCCCCC
T ss_conf             789875450231101676-479999999999719999999--99846887674


No 22 
>d1us5a_ c.94.1.1 (A:) Putative GluR0 ligand binding core {Thermus thermophilus [TaxId: 274]}
Probab=96.04  E-value=0.032  Score=28.58  Aligned_cols=62  Identities=19%  Similarity=0.286  Sum_probs=48.7

Q ss_pred             CCCEEEEEEC---CHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCC
Q ss_conf             3767999803---42589999999999987798079998157620578988521013353012133202
Q gi|254780707|r   24 ARNRIRIAGS---STLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI   89 (346)
Q Consensus        24 a~~~I~i~GS---st~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l   89 (346)
                      |++.|+|+.+   ++-+++...+++.+.+..+++++.+..+.||..=++.+.+|.    +|+|.+.-..
T Consensus         1 a~~~l~i~tg~~gg~y~~~~~~la~~l~~~~~~i~~~~~~t~Gs~~Nl~~l~~g~----~d~a~~~~~~   65 (298)
T d1us5a_           1 AQEFITIGSGSTTGVYFPVATGIAKLVNDANVGIRANARSTGGSVANINAINAGE----FEMALAQNDI   65 (298)
T ss_dssp             CCEEEEEECCCTTSSHHHHHHHHHHHHHHHTSSEEEEEECCSCHHHHHHHHHTTS----CSEEEEEHHH
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHCCC----CEEEEECCHH
T ss_conf             9715999969998727999999999996058984899981788899999997799----6199955188


No 23 
>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
Probab=95.00  E-value=0.078  Score=26.44  Aligned_cols=92  Identities=12%  Similarity=0.086  Sum_probs=62.4

Q ss_pred             CCCCCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHH
Q ss_conf             201376799980342589-9999999999877980799981576205789885210133530121332024767876762
Q gi|254780707|r   21 GTFARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK   99 (346)
Q Consensus        21 ~~~a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~   99 (346)
                      ++.++.+|+|+-+.++.. ++..+-..|.+.+|++++. +....+....+.+.+|.    +|++..-.+..+...     
T Consensus         3 p~~~~~~~rI~~~~~~~~~~lp~ll~~f~~~~P~v~i~-l~~~~~~~~~~~l~~g~----~Dl~i~~~~~~~~~~-----   72 (212)
T d2esna2           3 PGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLR-LVNAERKLSVEALASGR----IDFALGYDEEHERLP-----   72 (212)
T ss_dssp             TTTCCCEEEEECCHHHHHHHHHHHHHHHHHHSTTCEEE-EECCSSSCCHHHHHHTS----SSEEEECCSTTCCCC-----
T ss_pred             CCCCCCEEEEEECHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCCHHHHHHHHHHC----CCCCCCCCCCCCCCC-----
T ss_conf             77478689999757999999999999999988996899-99547489999999723----454422111344455-----


Q ss_pred             CCCCCCEEEEEECCCCEEEECCCCCC
Q ss_conf             48787246665215412554166654
Q gi|254780707|r  100 HGVSDIQEVTIGHDGILLVSDRDMVS  125 (346)
Q Consensus       100 ~~~~~~~~~~v~~d~i~i~~n~~~~~  125 (346)
                         ..........+..+++.+...+.
T Consensus        73 ---~~~~~~~~~~~~~~~~~~~~~~~   95 (212)
T d2esna2          73 ---EGIQAHDWFADRYVVVARRDHPR   95 (212)
T ss_dssp             ---TTEEEEEEEEECEEEEEESSCTT
T ss_pred             ---CCCCCCCCCHHHHCCCCCCCCHH
T ss_conf             ---32222332001110012455412


No 24 
>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]}
Probab=94.57  E-value=0.1  Score=25.80  Aligned_cols=42  Identities=5%  Similarity=0.046  Sum_probs=28.8

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHH
Q ss_conf             999707885668899999999749874052202775596348999
Q gi|254780707|r  287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNE  331 (346)
Q Consensus       287 y~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~  331 (346)
                      .+.+.+.. ....+..+|++|++|.+.|..  .....||+|....
T Consensus       251 ~~~i~~~s-~n~~~A~~fi~fl~s~e~q~~--~~~~~g~~p~~~~  292 (341)
T d1a99a_         251 VFAMPADA-KNKDEAYQFLNYLLRPDVVAH--ISDHVFYANANKA  292 (341)
T ss_dssp             EEECBTTC-SCHHHHHHHHHHHHSHHHHHH--HHHHHCCEESBTT
T ss_pred             CCEEECCC-CCHHHHHHHHHHHHCHHHHHH--HHHHHCCCCCCHH
T ss_conf             11334478-886999999999847899999--9997388885788


No 25 
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]}
Probab=94.57  E-value=0.1  Score=25.80  Aligned_cols=51  Identities=12%  Similarity=0.053  Sum_probs=34.2

Q ss_pred             CCCEEEEEEEEECCCCCCCHHHHHHHHHHHCHHHCCCCCHHHHCCCCCCCHHHH
Q ss_conf             750367899970788566889999999974987405220277559634899999
Q gi|254780707|r  280 YPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER  333 (346)
Q Consensus       280 YPl~r~ly~yv~~~~~~~~~~~~~Fl~~~ls~~~~~~~~~~~~~GyvPLp~~~~  333 (346)
                      .++.-...+.+.+.. ....+..+|++|++|++.|.  .+....|++|.-.+..
T Consensus       253 ~~~~~~~~~~i~~~s-~~~e~A~~fl~~l~s~e~q~--~~~~~~g~~P~~~~~~  303 (367)
T d1ursa_         253 TPFLGVITAFVNKES-KTQAADWSLVQALTSAQAQQ--MYFRDSQQIPALLSVQ  303 (367)
T ss_dssp             CCEEEEEEEEEBTTC-SCHHHHHHHHHHHTSHHHHH--HHHHHHCCEESSHHHH
T ss_pred             CEECCCCCCEECCCC-CCHHHHHHHHHHHHCHHHHH--HHHHHCCCCCCCHHHH
T ss_conf             100056540102101-31688999999850699999--9999719888737677


No 26 
>d1utha_ c.94.1.1 (A:) LysR-type regulatory protein DntR {Burkholderia sp. [TaxId: 36773]}
Probab=92.74  E-value=0.22  Score=23.94  Aligned_cols=89  Identities=9%  Similarity=0.020  Sum_probs=63.8

Q ss_pred             CCCCCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHH
Q ss_conf             201376799980342589-9999999999877980799981576205789885210133530121332024767876762
Q gi|254780707|r   21 GTFARNRIRIAGSSTLFP-YSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK   99 (346)
Q Consensus        21 ~~~a~~~I~i~GSst~~P-~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~   99 (346)
                      ++.++.+|+|+=+.++.. ++..+...|.+.+|++++. +....+..-.+.+.+|.    +|+|....+....       
T Consensus         7 P~~~~~~~rI~~~~~~~~~~lp~ll~~f~~~~P~v~l~-i~~~~~~~~~~~l~~g~----~D~~i~~~~~~~~-------   74 (219)
T d1utha_           7 PFASTRTFNLAMTDIGEMYFMPPLMEALAQRAPHIQIS-TLRPNAGNLKEDMESGA----VDLALGLLPELQT-------   74 (219)
T ss_dssp             TTTCCCEEEEECCHHHHHHHHHHHHHHHHHHCTTCEEE-EECTTSSCHHHHHHHTS----CCEEEECCTTCCT-------
T ss_pred             CCCCCCEEEEEECHHHHHHHHHHHHHHHHHHCCCCEEE-EEECCHHHHHHHHHCCC----CEEEEEECCCCCC-------
T ss_conf             56369789999727999999999999999988998899-99555787999986488----4056641245555-------


Q ss_pred             CCCCCCEEEEEECCCCEEEECCCCCC
Q ss_conf             48787246665215412554166654
Q gi|254780707|r  100 HGVSDIQEVTIGHDGILLVSDRDMVS  125 (346)
Q Consensus       100 ~~~~~~~~~~v~~d~i~i~~n~~~~~  125 (346)
                          .+...++..+..+++.....+.
T Consensus        75 ----~~~~~~l~~~~~~~~~~~~~~~   96 (219)
T d1utha_          75 ----GFFQRRLFRHRYVCMFRKDHPS   96 (219)
T ss_dssp             ----TEEEEEEEEECEEEEEETTCSS
T ss_pred             ----CCHHHHCCCCCCCCCCCCCCHH
T ss_conf             ----2012110000001012355155


No 27 
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
Probab=32.89  E-value=11  Score=14.36  Aligned_cols=48  Identities=15%  Similarity=0.225  Sum_probs=36.1

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCC
Q ss_conf             9999999999987798079998157620578988521013353012133202
Q gi|254780707|r   38 PYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI   89 (346)
Q Consensus        38 P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l   89 (346)
                      +.+..++..+-++..++++......|++..++++.+|.    +|++.++...
T Consensus        25 ~~y~g~~~gl~~~~~Gl~ve~~~~~g~~~~~~al~~G~----~D~~~~~~~~   72 (228)
T d2ozza1          25 RLYEGLASGLKAQFDGIPFYYAHMRGADIRVECLLNGV----YDMAVVSRLA   72 (228)
T ss_dssp             HHHHHHHHHHHHTTTTSCEEEEECSCHHHHHHHHHTTS----CSEEEEEHHH
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHCCC----CCEEECCCHH
T ss_conf             88888999999973398289999138067899997699----7778617189


Done!